F445683

General Info

Members Datasets Scaffolds Average Seq Length
446 183 892 303

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100147300|Ga0068856_1001473002
Length 339
Sequence VRQVLRRSNLAVVHVRKDYKKTKRMEWAICRMGAVILVAASVSAFAVSAQQMPADYDQAMKTLGKQGDFKDNVLKINIPRNDLKVTIDGIATPTPFGFGGWLAMTKGDGGMDVMMGDLVLLEDEVNPVMSALLDNGLEVTAVHNHFFFDSPRVFYMHVHGHGKAAELAKMAKPAVDLIGHGKAQHQSTVSGGKSNISAGKIDTAKIAQIVGHQGEQSGDVYKITVGRDDLNLKEMGAPINSRMGLNTWAAFYGSDANAEVAGDVAMLSNELTRVLKALRANGLNVVAVHNHMTNQAVLGSGQPQPTIFFLHYWGTGPTEKLANGFEAALNELGKPAHAH

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 4.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.45
Rhizosphere 99.55
Stem 0
Stem Tuber 0
Unclassified 19.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100147300 3300005614 Bacteria 2362
2 JGI25406J46586_10000718 3300003203 Bacteria 15496
3 JGI25406J46586_10013981 3300003203 Bacteria 3425
4 JGI25406J46586_10046113 3300003203 Unclassified 1495
5 Ga0058863_11885406 3300004799 Bacteria 2166
6 Ga0058863_11928421 3300004799 Unclassified 1003
7 Ga0058861_11258497 3300004800 Unclassified 1185
8 Ga0058861_11585912 3300004800 Bacteria 2092
9 Ga0058862_11570054 3300004803 Unclassified 1868
10 Ga0058862_12477463 3300004803 Bacteria 2058
11 Ga0058862_12503585 3300004803 Unclassified 1184
12 Ga0070658_10007538 3300005327 Bacteria 8781
13 Ga0070683_100005026 3300005329 Bacteria 10976
14 Ga0070683_100102530 3300005329 Unclassified 2695
15 Ga0070690_100035743 3300005330 Unclassified 3119
16 Ga0070670_100031788 3300005331 Bacteria 4546
17 Ga0070670_100061059 3300005331 Bacteria 3236
18 Ga0068869_100061983 3300005334 Bacteria 2744
19 Ga0070666_10014666 3300005335 Unclassified 4991
20 Ga0070680_100041238 3300005336 Bacteria 3742
21 Ga0070680_100221185 3300005336 Bacteria 1598
22 Ga0068868_100016303 3300005338 Bacteria 5514
23 Ga0068868_100046655 3300005338 Bacteria 3392
24 Ga0068868_100262996 3300005338 Bacteria 1455
25 Ga0070660_100097025 3300005339 Unclassified 2332
26 Ga0070660_100175214 3300005339 Bacteria 1734
27 Ga0070660_100283317 3300005339 Unclassified 1356
28 Ga0070689_100263140 3300005340 Bacteria 1426
29 Ga0070691_10005873 3300005341 Bacteria 5602
30 Ga0070661_100048782 3300005344 Bacteria 3100
31 Ga0070661_100118021 3300005344 Unclassified 1985
32 Ga0070692_10202568 3300005345 Viruses 1163
33 Ga0070671_100060625 3300005355 Bacteria 3150
34 Ga0070673_100024210 3300005364 Bacteria 4448
35 Ga0070667_100236209 3300005367 Bacteria 1631
36 Ga0070709_10366407 3300005434 Archaea 1068
37 Ga0070714_100026830 3300005435 Bacteria 4763
38 Ga0070714_100063407 3300005435 Bacteria 3179
39 Ga0070714_100245480 3300005435 Unclassified 1654
40 Ga0070713_100005698 3300005436 Bacteria 8552
41 Ga0070713_100019998 3300005436 Bacteria 5125
42 Ga0070713_100203554 3300005436 Unclassified 1789
43 Ga0070713_100517391 3300005436 Unclassified 1127
44 Ga0070711_100107472 3300005439 Unclassified 2042
45 Ga0070711_100244721 3300005439 Unclassified 1404
46 Ga0070681_10001314 3300005458 Bacteria 21693
47 Ga0070681_10013714 3300005458 Bacteria 8067
48 Ga0070681_10015040 3300005458 Bacteria 7698
49 Ga0070681_10149464 3300005458 Bacteria 2263
50 Ga0068867_100161789 3300005459 Unclassified 1766
51 Ga0068867_100196113 3300005459 Bacteria 1614
52 Ga0070706_100173884 3300005467 Bacteria 2011
53 Ga0070706_100293131 3300005467 Bacteria 1518
54 Ga0070707_100233009 3300005468 Bacteria 1792
55 Ga0070707_100254486 3300005468 Bacteria 1709
56 Ga0070679_100022868 3300005530 Bacteria 6114
57 Ga0070679_100030593 3300005530 Bacteria 5315
58 Ga0070679_100086133 3300005530 Bacteria 3129
59 Ga0070679_100203089 3300005530 Bacteria 1947
60 Ga0070684_100001360 3300005535 Bacteria 17533
61 Ga0070684_100088774 3300005535 Plasmid 2747
62 Ga0070684_100117803 3300005535 Unclassified 2386
63 Ga0070684_100152673 3300005535 Bacteria 2093
64 Ga0070684_100168398 3300005535 Bacteria 1989
65 Ga0068853_100019760 3300005539 Bacteria 5593
66 Ga0068853_100051627 3300005539 Bacteria 3539
67 Ga0068853_100335851 3300005539 Bacteria 1403
68 Ga0070672_100050392 3300005543 Unclassified 3242
69 Ga0070695_100123548 3300005545 Bacteria 1774
70 Ga0070693_100045823 3300005547 Unclassified 2481
71 Ga0070693_100070234 3300005547 Bacteria 2060
72 Ga0070665_100037366 3300005548 Bacteria 4884
73 Ga0070704_100005404 3300005549 Bacteria 7438
74 Ga0070704_100136955 3300005549 Bacteria 1906
75 Ga0068855_100010622 3300005563 Bacteria 11100
76 Ga0068855_100049631 3300005563 Bacteria 4949
77 Ga0068855_100201902 3300005563 Bacteria 2238
78 Ga0068855_100229537 3300005563 Unclassified 2079
79 Ga0070664_100125774 3300005564 Bacteria 2249
80 Ga0068857_100001124 3300005577 Bacteria 20827
81 Ga0068857_100017583 3300005577 Bacteria 6269
82 Ga0068857_100051621 3300005577 Unclassified 3649
83 Ga0068856_100021765 3300005614 Bacteria 6231
84 Ga0068856_100032137 3300005614 Bacteria 5138
85 Ga0068856_100073735 3300005614 Bacteria 3379
86 Ga0068856_100128158 3300005614 Bacteria 2541
87 Ga0068856_100210567 3300005614 Unclassified 1959
88 Ga0068856_100249560 3300005614 Unclassified 1790
89 Ga0068856_100322385 3300005614 Unclassified 1562
90 Ga0068852_100105028 3300005616 Bacteria 2558
91 Ga0068852_100105146 3300005616 Bacteria 2557
92 Ga0068859_100214882 3300005617 Unclassified 2010
93 Ga0068859_100234134 3300005617 Bacteria 1925
94 Ga0068864_100338500 3300005618 Bacteria 1417
95 Ga0068866_10027550 3300005718 Bacteria 2697
96 Ga0068870_10028067 3300005840 Bacteria 2822
97 Ga0068863_100101744 3300005841 Bacteria 2732
98 Ga0068858_100011822 3300005842 Bacteria 8230
99 Ga0068858_100306738 3300005842 Bacteria 1515
100 Ga0068860_100023941 3300005843 Bacteria 5902
101 Ga0068860_100170517 3300005843 Bacteria 2102
102 Ga0068860_100376763 3300005843 Bacteria 1400
103 Ga0081539_10000025 3300005985 Bacteria 340255
104 Ga0081539_10002857 3300005985 Bacteria 22977
105 Ga0070717_10008235 3300006028 Bacteria 7784
106 Ga0070717_10015306 3300006028 Bacteria 5922
107 Ga0070717_10093592 3300006028 Bacteria 2541
108 Ga0070717_10138025 3300006028 Bacteria 2101
109 Ga0070717_10353951 3300006028 Unclassified 1313
110 Ga0070712_100446922 3300006175 Unclassified 1076
111 Ga0097621_100027721 3300006237 Bacteria 4457
112 Ga0097621_100034197 3300006237 Unclassified 4053
113 Ga0068871_100008940 3300006358 Bacteria 7229
114 Ga0068871_100021445 3300006358 Bacteria 4965
115 Ga0068871_100023522 3300006358 Unclassified 4769
116 Ga0068871_100150497 3300006358 Bacteria 1984
117 Ga0068871_100178112 3300006358 Bacteria 1826
118 Ga0068871_100213058 3300006358 Unclassified 1671
119 Ga0068871_100401853 3300006358 Bacteria 1220
120 Ga0075431_100025621 3300006847 Bacteria 6046
121 Ga0075429_100213642 3300006880 Bacteria 1690
122 Ga0075436_100202449 3300006914 Unclassified 1406
123 Ga0097620_100214863 3300006931 Unclassified 2010
124 Ga0097620_100234145 3300006931 Bacteria 1925
125 Ga0105240_10005630 3300009093 Bacteria 18595
126 Ga0105240_10019694 3300009093 Bacteria 9013
127 Ga0105240_10021243 3300009093 Bacteria 8639
128 Ga0105240_10049669 3300009093 Bacteria 5293
129 Ga0105240_10055968 3300009093 Unclassified 4937
130 Ga0105240_10104780 3300009093 Bacteria 3434
131 Ga0105240_10106422 3300009093 Unclassified 3402
132 Ga0105240_10129413 3300009093 Bacteria 3029
133 Ga0105240_10327481 3300009093 Bacteria 1744
134 Ga0105240_10499967 3300009093 Unclassified 1352
135 Ga0105240_10607574 3300009093 Bacteria 1203
136 Ga0105240_10661489 3300009093 Bacteria 1144
137 Ga0111539_10015018 3300009094 Bacteria 9651
138 Ga0111539_10449873 3300009094 Bacteria 1500
139 Ga0105245_10008801 3300009098 Bacteria 8804
140 Ga0105245_10012756 3300009098 Bacteria 7319
141 Ga0105245_10022146 3300009098 Bacteria 5580
142 Ga0105245_10035049 3300009098 Bacteria 4452
143 Ga0105245_10055879 3300009098 Bacteria 3547
144 Ga0105247_10004711 3300009101 Bacteria 8693
145 Ga0105247_10037175 3300009101 Bacteria 2970
146 Ga0114129_10008973 3300009147 Bacteria 14257
147 Ga0114129_10126818 3300009147 Bacteria 3509
148 Ga0114129_10138624 3300009147 Bacteria 3337
149 Ga0105243_10110446 3300009148 Bacteria 2299
150 Ga0105241_10000675 3300009174 Bacteria 25715
151 Ga0105241_10012444 3300009174 Bacteria 6237
152 Ga0105241_10012765 3300009174 Bacteria 6165
153 Ga0105241_10020228 3300009174 Bacteria 4917
154 Ga0105241_10603327 3300009174 Bacteria 992
155 Ga0105242_10003587 3300009176 Bacteria 12070
156 Ga0105242_10019799 3300009176 Bacteria 5273
157 Ga0105248_10001852 3300009177 Bacteria 23445
158 Ga0105248_10035452 3300009177 Bacteria 5580
159 Ga0105248_10079648 3300009177 Bacteria 3682
160 Ga0105248_10170315 3300009177 Unclassified 2454
161 Ga0105248_10229316 3300009177 Bacteria 2091
162 Ga0105248_10403950 3300009177 Bacteria 1538
163 Ga0105248_10463827 3300009177 Unclassified 1428
164 Ga0105237_10001266 3300009545 Bacteria 33725
165 Ga0105237_10003082 3300009545 Bacteria 20083
166 Ga0105237_10018426 3300009545 Bacteria 7224
167 Ga0105237_10018722 3300009545 Bacteria 7160
168 Ga0105237_10060041 3300009545 Bacteria 3804
169 Ga0105237_10130408 3300009545 Bacteria 2508
170 Ga0105237_10207162 3300009545 Bacteria 1961
171 Ga0105238_10010562 3300009551 Bacteria 9271
172 Ga0105238_10023826 3300009551 Bacteria 6240
173 Ga0105238_10026250 3300009551 Bacteria 5937
174 Ga0105238_10026911 3300009551 Bacteria 5862
175 Ga0105238_10053463 3300009551 Bacteria 4058
176 Ga0105238_10105332 3300009551 Bacteria 2802
177 Ga0105238_10119426 3300009551 Unclassified 2616
178 Ga0105238_10180067 3300009551 Bacteria 2090
179 Ga0105249_10041589 3300009553 Bacteria 4178
180 Ga0105249_10228953 3300009553 Bacteria 1833
181 Ga0099796_10052904 3300010159 Bacteria 1415
182 Ga0105239_10011681 3300010375 Bacteria 9802
183 Ga0105239_10016503 3300010375 Bacteria 8167
184 Ga0105239_10021136 3300010375 Bacteria 7179
185 Ga0105239_10029578 3300010375 Bacteria 6023
186 Ga0105239_10041270 3300010375 Bacteria 5057
187 Ga0105239_10126099 3300010375 Bacteria 2845
188 Ga0105239_10152647 3300010375 Bacteria 2578
189 Ga0105239_10532921 3300010375 Bacteria 1336
190 Ga0105246_10003330 3300011119 Bacteria 9724
191 Ga0105246_10147208 3300011119 Bacteria 1778
192 Ga0105246_10172062 3300011119 Bacteria 1660
193 Ga0157371_10033808 3300013102 Bacteria 3672
194 Ga0157370_10011213 3300013104 Bacteria 9398
195 Ga0157370_10038401 3300013104 Plasmid 4631
196 Ga0157370_10178809 3300013104 Bacteria 1972
197 Ga0157370_10434861 3300013104 Bacteria 1207
198 Ga0157369_10001421 3300013105 Bacteria 29409
199 Ga0157369_10011975 3300013105 Bacteria 9851
200 Ga0157369_10059084 3300013105 Plasmid 4136
201 Ga0157369_10180070 3300013105 Bacteria 2224
202 Ga0157369_10188089 3300013105 Bacteria 2171
203 Ga0157369_10263532 3300013105 Bacteria 1797
204 Ga0157374_10057694 3300013296 Bacteria 3627
205 Ga0157374_10138021 3300013296 Bacteria 2365
206 Ga0157374_10185091 3300013296 Bacteria 2036
207 Ga0157374_10185586 3300013296 Bacteria 2033
208 Ga0157374_10262867 3300013296 Bacteria 1700
209 Ga0157374_10407754 3300013296 Unclassified 1357
210 Ga0157378_10002179 3300013297 Bacteria 17362
211 Ga0157378_10003520 3300013297 Bacteria 13887
212 Ga0157378_10069881 3300013297 Bacteria 3151
213 Ga0157378_10290317 3300013297 Bacteria 1579
214 Ga0163162_10046053 3300013306 Bacteria 4372
215 Ga0157372_10018350 3300013307 Bacteria 7519
216 Ga0157372_10030546 3300013307 Bacteria 5894
217 Ga0157372_10049185 3300013307 Unclassified 4688
218 Ga0157372_10273281 3300013307 Unclassified 1964
219 Ga0157375_10002294 3300013308 Bacteria 16533
220 Ga0157375_11013275 3300013308 Unclassified 970
221 Ga0163163_10003880 3300014325 Bacteria 12744
222 Ga0163163_10009424 3300014325 Bacteria 8720
223 Ga0163163_10076061 3300014325 Bacteria 3351
224 Ga0163163_10097959 3300014325 Bacteria 2953
225 Ga0163163_10219584 3300014325 Bacteria 1949
226 Ga0163163_10306838 3300014325 Unclassified 1640
227 Ga0157379_10044569 3300014968 Plasmid 3959
228 Ga0157379_10086916 3300014968 Bacteria 2803
229 Ga0157379_10198715 3300014968 Unclassified 1813
230 Ga0157376_10021501 3300014969 Bacteria 5011
231 Ga0157376_10028994 3300014969 Bacteria 4406
232 Ga0157376_10033213 3300014969 Bacteria 4151
233 Ga0157376_10201289 3300014969 Bacteria 1832
234 Ga0197907_10917173 3300020069 Bacteria 1522
235 Ga0197907_11225713 3300020069 Bacteria 978
236 Ga0206356_10657834 3300020070 Unclassified 1617
237 Ga0206356_11767643 3300020070 Unclassified 1057
238 Ga0206349_1368824 3300020075 Bacteria 1790
239 Ga0206355_1195168 3300020076 Bacteria 2163
240 Ga0206352_10053285 3300020078 Bacteria 2881
241 Ga0206352_11176953 3300020078 Bacteria 1136
242 Ga0206350_11312504 3300020080 Bacteria 1380
243 Ga0206350_11388105 3300020080 Bacteria 2244
244 Ga0206353_10198152 3300020082 Bacteria 1099
245 Ga0224712_10123407 3300022467 Bacteria 1124
246 Ga0207680_10264827 3300025903 Unclassified 1191
247 Ga0207699_10031037 3300025906 Bacteria 2997
248 Ga0207705_10052758 3300025909 Unclassified 2928
249 Ga0207654_10005842 3300025911 Bacteria 6204
250 Ga0207654_10015019 3300025911 Bacteria 4010
251 Ga0207707_10002885 3300025912 Bacteria 15347
252 Ga0207707_10005940 3300025912 Bacteria 10684
253 Ga0207707_10074737 3300025912 Unclassified 2956
254 Ga0207707_10094721 3300025912 Bacteria 2609
255 Ga0207695_10001188 3300025913 Bacteria 44859
256 Ga0207695_10001310 3300025913 Bacteria 42176
257 Ga0207695_10005765 3300025913 Bacteria 16306
258 Ga0207695_10112912 3300025913 Bacteria 2694
259 Ga0207695_10155789 3300025913 Bacteria 2219
260 Ga0207695_10160641 3300025913 Bacteria 2179
261 Ga0207695_10276096 3300025913 Bacteria 1575
262 Ga0207695_10338579 3300025913 Unclassified 1392
263 Ga0207695_10557973 3300025913 Bacteria 1027
264 Ga0207671_10007106 3300025914 Bacteria 9786
265 Ga0207671_10012177 3300025914 Bacteria 6938
266 Ga0207671_10024427 3300025914 Bacteria 4545
267 Ga0207671_10029844 3300025914 Bacteria 4070
268 Ga0207671_10036746 3300025914 Bacteria 3633
269 Ga0207671_10042507 3300025914 Bacteria 3364
270 Ga0207693_10311834 3300025915 Unclassified 1232
271 Ga0207660_10391036 3300025917 Unclassified 1119
272 Ga0207657_10082998 3300025919 Unclassified 2689
273 Ga0207657_10247043 3300025919 Bacteria 1423
274 Ga0207657_10261468 3300025919 Unclassified 1377
275 Ga0207652_10032998 3300025921 Unclassified 4358
276 Ga0207652_10156726 3300025921 Unclassified 2040
277 Ga0207646_10015471 3300025922 Bacteria 7205
278 Ga0207646_10398047 3300025922 Bacteria 1244
279 Ga0207694_10003775 3300025924 Bacteria 12000
280 Ga0207694_10007427 3300025924 Bacteria 8305
281 Ga0207694_10028787 3300025924 Bacteria 4237
282 Ga0207694_10145961 3300025924 Bacteria 1904
283 Ga0207694_10216602 3300025924 Bacteria 1561
284 Ga0207694_10229270 3300025924 Bacteria 1516
285 Ga0207694_10329057 3300025924 Unclassified 1262
286 Ga0207650_10012889 3300025925 Bacteria 5777
287 Ga0207687_10005251 3300025927 Bacteria 8590
288 Ga0207687_10053934 3300025927 Bacteria 2811
289 Ga0207687_10089157 3300025927 Bacteria 2245
290 Ga0207700_10003166 3300025928 Bacteria 9496
291 Ga0207700_10021504 3300025928 Bacteria 4407
292 Ga0207700_10047695 3300025928 Bacteria 3177
293 Ga0207700_10151143 3300025928 Unclassified 1919
294 Ga0207700_10353182 3300025928 Unclassified 1280
295 Ga0207664_10000243 3300025929 Bacteria 41025
296 Ga0207664_10118450 3300025929 Bacteria 2212
297 Ga0207644_10056513 3300025931 Bacteria 2832
298 Ga0207686_10015958 3300025934 Bacteria 4209
299 Ga0207686_10023520 3300025934 Bacteria 3560
300 Ga0207686_10023603 3300025934 Bacteria 3555
301 Ga0207709_10060824 3300025935 Bacteria 2357
302 Ga0207670_10232345 3300025936 Bacteria 1417
303 Ga0207670_10427020 3300025936 Bacteria 1064
304 Ga0207704_10081321 3300025938 Bacteria 2095
305 Ga0207711_10021837 3300025941 Bacteria 5346
306 Ga0207711_10030259 3300025941 Bacteria 4567
307 Ga0207711_10169053 3300025941 Unclassified 1983
308 Ga0207711_10195460 3300025941 Bacteria 1845
309 Ga0207711_10327222 3300025941 Bacteria 1417
310 Ga0207689_10038058 3300025942 Bacteria 3986
311 Ga0207689_10551916 3300025942 Bacteria 968
312 Ga0207661_10056543 3300025944 Bacteria 3150
313 Ga0207661_10527444 3300025944 Unclassified 1080
314 Ga0207679_10157752 3300025945 Bacteria 1854
315 Ga0207679_10275157 3300025945 Bacteria 1441
316 Ga0207679_10297859 3300025945 Unclassified 1389
317 Ga0207667_10002066 3300025949 Bacteria 25168
318 Ga0207667_10004805 3300025949 Bacteria 16525
319 Ga0207667_10010926 3300025949 Bacteria 10582
320 Ga0207667_10169175 3300025949 Bacteria 2246
321 Ga0207651_10110789 3300025960 Bacteria 2060
322 Ga0207651_10221374 3300025960 Unclassified 1530
323 Ga0207712_10050080 3300025961 Bacteria 2915
324 Ga0207677_10027475 3300026023 Bacteria 3584
325 Ga0207677_10146301 3300026023 Bacteria 1816
326 Ga0207703_10037410 3300026035 Unclassified 3866
327 Ga0207703_10105005 3300026035 Bacteria 2401
328 Ga0207639_10014062 3300026041 Bacteria 5617
329 Ga0207639_10022573 3300026041 Bacteria 4534
330 Ga0207639_10248252 3300026041 Bacteria 1551
331 Ga0207702_10009300 3300026078 Bacteria 8256
332 Ga0207702_10014896 3300026078 Bacteria 6449
333 Ga0207702_10045760 3300026078 Unclassified 3681
334 Ga0207702_10263402 3300026078 Bacteria 1624
335 Ga0207641_10143201 3300026088 Bacteria 2159
336 Ga0207648_10051195 3300026089 Bacteria 3609
337 Ga0207648_10167028 3300026089 Bacteria 1945
338 Ga0207676_10335302 3300026095 Bacteria 1393
339 Ga0207674_10001767 3300026116 Bacteria 27630
340 Ga0207674_10074112 3300026116 Bacteria 3417
341 Ga0207674_10084573 3300026116 Bacteria 3170
342 Ga0207674_10086350 3300026116 Unclassified 3132
343 Ga0207674_10477632 3300026116 Bacteria 1205
344 Ga0207683_10242646 3300026121 Bacteria 1644
345 Ga0207698_10054915 3300026142 Bacteria 3067
346 Ga0207698_10132888 3300026142 Bacteria 2130
347 Ga0207698_10180208 3300026142 Bacteria 1871
348 Ga0207698_10254723 3300026142 Unclassified 1608
349 Ga0268264_10007884 3300028381 Bacteria 8861
350 Ga0268264_10047792 3300028381 Bacteria 3558
351 Ga0268264_10474650 3300028381 Unclassified 1216
352 Ga0307408_100338094 3300031548 Bacteria 1273
353 Ga0307407_10068771 3300031903 Bacteria 2099
354 Ga0307416_100063925 3300032002 Bacteria 3016
355 Ga0307411_10455035 3300032005 Bacteria 1072
356 Ga0307415_100330976 3300032126 Bacteria 1274
357 Ga0373926_0013543 3300035083 Plasmid 2768
358 Ga0373923_0025639 3300035111 Unclassified 2339
359 Ga0373954_0014549 3300035118 Bacteria 3509
360 Ga0373954_0020592 3300035118 Bacteria 2985
361 Ga0373954_0034853 3300035118 Bacteria 2332
362 Ga0373943_0044045 3300035170 Bacteria 2170
363 Ga0373955_0008232 3300035172 Bacteria 4835
364 Ga0373955_0024834 3300035172 Bacteria 3069
365 Ga0373935_0060831 3300035692 Unclassified 2417
366 Ga0373935_0206526 3300035692 Bacteria 1360
367 Ga0373935_0236191 3300035692 Bacteria 1275
368 Ga0373927_0000664 3300035695 Bacteria 26142
369 Ga0373927_0000847 3300035695 Bacteria 23338
370 Ga0373927_0011302 3300035695 Bacteria 5942
371 Ga0373927_0017561 3300035695 Bacteria 4708
372 Ga0373927_0292251 3300035695 Bacteria 1072
373 Ga0373933_0006193 3300035724 Bacteria 6512
374 Ga0373933_0081951 3300035724 Unclassified 1980
375 Ga0373933_0113511 3300035724 Bacteria 1692
376 Ga0373933_0332826 3300035724 Bacteria 985
377 Ga0373947_0000400 3300035725 Bacteria 24469
378 Ga0373937_0001491 3300036401 Bacteria 19633
379 Ga0373937_0005455 3300036401 Bacteria 10891
380 Ga0373937_0010928 3300036401 Bacteria 7951
381 Ga0373937_0048251 3300036401 Bacteria 3897
382 Ga0373937_0054067 3300036401 Unclassified 3684
383 Ga0373937_0082981 3300036401 Unclassified 2965
384 Ga0373937_0194849 3300036401 Bacteria 1904
385 Ga0373925_0016571 3300037068 Bacteria 5339
386 Ga0466959_0275932 3300045049 Unclassified 1155
387 Ga0451576_0043170 3300045051 Bacteria 4758
388 Ga0495592_0025315 3300046454 Unclassified 4505
389 Ga0495651_0002690 3300046462 Bacteria 13790
390 Ga0495651_0033298 3300046462 Unclassified 4019
391 Ga0495651_0135926 3300046462 Bacteria 1789
392 Ga0495651_0141498 3300046462 Unclassified 1744
393 Ga0495580_0002877 3300046472 Bacteria 14817
394 Ga0495580_0007885 3300046472 Bacteria 8521
395 Ga0495580_0028426 3300046472 Bacteria 4063
396 Ga0495580_0077274 3300046472 Bacteria 2322
397 Ga0495664_0008895 3300046477 Bacteria 5612
398 Ga0495664_0077904 3300046477 Bacteria 1985
399 Ga0495664_0086219 3300046477 Unclassified 1886
400 Ga0495628_0004680 3300046516 Bacteria 12073
401 Ga0495630_0008281 3300046517 Bacteria 7466
402 Ga0495652_0013631 3300046529 Bacteria 7315
403 Ga0495652_0113446 3300046529 Bacteria 2176
404 Ga0495652_0270579 3300046529 Bacteria 1249
405 Ga0495640_0230447 3300046533 Bacteria 1165
406 Ga0495586_0163723 3300046535 Bacteria 1255
407 Ga0495587_0003460 3300046536 Bacteria 10526
408 Ga0495587_0057746 3300046536 Bacteria 2281
409 Ga0495587_0074194 3300046536 Bacteria 1976
410 Ga0495609_0128415 3300046538 Unclassified 1087
411 Ga0495645_0003950 3300046543 Bacteria 10115
412 Ga0495645_0037085 3300046543 Bacteria 3553
413 Ga0495645_0076344 3300046543 Unclassified 2411
414 Ga0495667_0048860 3300046559 Bacteria 2793
415 Ga0495667_0226928 3300046559 Unclassified 1191
416 Ga0495634_0110201 3300046642 Bacteria 1771
417 Ga0495635_0003877 3300046663 Bacteria 10391
418 Ga0495635_0226690 3300046663 Unclassified 1263
419 Ga0495599_0055315 3300046678 Bacteria 2486
420 Ga0495623_0011797 3300046679 Bacteria 5660
421 Ga0495623_0120388 3300046679 Bacteria 1580
422 Ga0495623_0135395 3300046679 Bacteria 1471
423 Ga0495613_0085726 3300046689 Unclassified 2285
424 Ga0495624_0099588 3300046690 Unclassified 1790
425 Ga0495600_0253157 3300046809 Unclassified 1120
426 Ga0495581_0295418 3300047315 Unclassified 947
427 Ga0495636_0062628 3300047318 Bacteria 1575
428 Ga0495674_0007677 3300047319 Bacteria 10302
429 Ga0495674_0008064 3300047319 Bacteria 10054
430 Ga0495676_0358548 3300047321 Bacteria 974
431 Ga0495680_0157586 3300047322 Bacteria 1651
432 Ga0495684_0000960 3300047471 Bacteria 23493
433 Ga0495684_0009731 3300047471 Bacteria 7417
434 Ga0495684_0026527 3300047471 Plasmid 4453
435 Ga0495684_0032825 3300047471 Bacteria 3988
436 Ga0495684_0282695 3300047471 Unclassified 1196
437 Ga0495602_0019021 3300048088 Bacteria 6834
438 Ga0496102_0103213 3300048905 Bacteria 2652
439 Ga0496115_0092754 3300048918 Bacteria 2469
440 Ga0501268_008892 3300049765 Bacteria 1533
441 nmdc:mga05p37_29176_c1 3300050507 Bacteria 6735
442 nmdc:mga05p37_657799_c1 3300050507 Unclassified 1172
443 nmdc:mga09592_162728_c1 3300050508 Bacteria 1928
444 nmdc:mga06r32_16421_c1 3300050510 Bacteria 6747
445 nmdc:mga08y16_113330_c1 3300050511 Bacteria 2823
446 nmdc:mga08y16_456804_c1 3300050511 Bacteria 1302
447 Ga0068856_100147300
448 JGI25406J46586_10000718
449 JGI25406J46586_10013981
450 JGI25406J46586_10046113
451 Ga0058863_11885406
452 Ga0058863_11928421
453 Ga0058861_11258497
454 Ga0058861_11585912
455 Ga0058862_11570054
456 Ga0058862_12477463
457 Ga0058862_12503585
458 Ga0070658_10007538
459 Ga0070683_100005026
460 Ga0070683_100102530
461 Ga0070690_100035743
462 Ga0070670_100031788
463 Ga0070670_100061059
464 Ga0068869_100061983
465 Ga0070666_10014666
466 Ga0070680_100041238
467 Ga0070680_100221185
468 Ga0068868_100016303
469 Ga0068868_100046655
470 Ga0068868_100262996
471 Ga0070660_100097025
472 Ga0070660_100175214
473 Ga0070660_100283317
474 Ga0070689_100263140
475 Ga0070691_10005873
476 Ga0070661_100048782
477 Ga0070661_100118021
478 Ga0070692_10202568
479 Ga0070671_100060625
480 Ga0070673_100024210
481 Ga0070667_100236209
482 Ga0070709_10366407
483 Ga0070714_100026830
484 Ga0070714_100063407
485 Ga0070714_100245480
486 Ga0070713_100005698
487 Ga0070713_100019998
488 Ga0070713_100203554
489 Ga0070713_100517391
490 Ga0070711_100107472
491 Ga0070711_100244721
492 Ga0070681_10001314
493 Ga0070681_10013714
494 Ga0070681_10015040
495 Ga0070681_10149464
496 Ga0068867_100161789
497 Ga0068867_100196113
498 Ga0070706_100173884
499 Ga0070706_100293131
500 Ga0070707_100233009
501 Ga0070707_100254486
502 Ga0070679_100022868
503 Ga0070679_100030593
504 Ga0070679_100086133
505 Ga0070679_100203089
506 Ga0070684_100001360
507 Ga0070684_100088774
508 Ga0070684_100117803
509 Ga0070684_100152673
510 Ga0070684_100168398
511 Ga0068853_100019760
512 Ga0068853_100051627
513 Ga0068853_100335851
514 Ga0070672_100050392
515 Ga0070695_100123548
516 Ga0070693_100045823
517 Ga0070693_100070234
518 Ga0070665_100037366
519 Ga0070704_100005404
520 Ga0070704_100136955
521 Ga0068855_100010622
522 Ga0068855_100049631
523 Ga0068855_100201902
524 Ga0068855_100229537
525 Ga0070664_100125774
526 Ga0068857_100001124
527 Ga0068857_100017583
528 Ga0068857_100051621
529 Ga0068856_100021765
530 Ga0068856_100032137
531 Ga0068856_100073735
532 Ga0068856_100128158
533 Ga0068856_100210567
534 Ga0068856_100249560
535 Ga0068856_100322385
536 Ga0068852_100105028
537 Ga0068852_100105146
538 Ga0068859_100214882
539 Ga0068859_100234134
540 Ga0068864_100338500
541 Ga0068866_10027550
542 Ga0068870_10028067
543 Ga0068863_100101744
544 Ga0068858_100011822
545 Ga0068858_100306738
546 Ga0068860_100023941
547 Ga0068860_100170517
548 Ga0068860_100376763
549 Ga0081539_10000025
550 Ga0081539_10002857
551 Ga0070717_10008235
552 Ga0070717_10015306
553 Ga0070717_10093592
554 Ga0070717_10138025
555 Ga0070717_10353951
556 Ga0070712_100446922
557 Ga0097621_100027721
558 Ga0097621_100034197
559 Ga0068871_100008940
560 Ga0068871_100021445
561 Ga0068871_100023522
562 Ga0068871_100150497
563 Ga0068871_100178112
564 Ga0068871_100213058
565 Ga0068871_100401853
566 Ga0075431_100025621
567 Ga0075429_100213642
568 Ga0075436_100202449
569 Ga0097620_100214863
570 Ga0097620_100234145
571 Ga0105240_10005630
572 Ga0105240_10019694
573 Ga0105240_10021243
574 Ga0105240_10049669
575 Ga0105240_10055968
576 Ga0105240_10104780
577 Ga0105240_10106422
578 Ga0105240_10129413
579 Ga0105240_10327481
580 Ga0105240_10499967
581 Ga0105240_10607574
582 Ga0105240_10661489
583 Ga0111539_10015018
584 Ga0111539_10449873
585 Ga0105245_10008801
586 Ga0105245_10012756
587 Ga0105245_10022146
588 Ga0105245_10035049
589 Ga0105245_10055879
590 Ga0105247_10004711
591 Ga0105247_10037175
592 Ga0114129_10008973
593 Ga0114129_10126818
594 Ga0114129_10138624
595 Ga0105243_10110446
596 Ga0105241_10000675
597 Ga0105241_10012444
598 Ga0105241_10012765
599 Ga0105241_10020228
600 Ga0105241_10603327
601 Ga0105242_10003587
602 Ga0105242_10019799
603 Ga0105248_10001852
604 Ga0105248_10035452
605 Ga0105248_10079648
606 Ga0105248_10170315
607 Ga0105248_10229316
608 Ga0105248_10403950
609 Ga0105248_10463827
610 Ga0105237_10001266
611 Ga0105237_10003082
612 Ga0105237_10018426
613 Ga0105237_10018722
614 Ga0105237_10060041
615 Ga0105237_10130408
616 Ga0105237_10207162
617 Ga0105238_10010562
618 Ga0105238_10023826
619 Ga0105238_10026250
620 Ga0105238_10026911
621 Ga0105238_10053463
622 Ga0105238_10105332
623 Ga0105238_10119426
624 Ga0105238_10180067
625 Ga0105249_10041589
626 Ga0105249_10228953
627 Ga0099796_10052904
628 Ga0105239_10011681
629 Ga0105239_10016503
630 Ga0105239_10021136
631 Ga0105239_10029578
632 Ga0105239_10041270
633 Ga0105239_10126099
634 Ga0105239_10152647
635 Ga0105239_10532921
636 Ga0105246_10003330
637 Ga0105246_10147208
638 Ga0105246_10172062
639 Ga0157371_10033808
640 Ga0157370_10011213
641 Ga0157370_10038401
642 Ga0157370_10178809
643 Ga0157370_10434861
644 Ga0157369_10001421
645 Ga0157369_10011975
646 Ga0157369_10059084
647 Ga0157369_10180070
648 Ga0157369_10188089
649 Ga0157369_10263532
650 Ga0157374_10057694
651 Ga0157374_10138021
652 Ga0157374_10185091
653 Ga0157374_10185586
654 Ga0157374_10262867
655 Ga0157374_10407754
656 Ga0157378_10002179
657 Ga0157378_10003520
658 Ga0157378_10069881
659 Ga0157378_10290317
660 Ga0163162_10046053
661 Ga0157372_10018350
662 Ga0157372_10030546
663 Ga0157372_10049185
664 Ga0157372_10273281
665 Ga0157375_10002294
666 Ga0157375_11013275
667 Ga0163163_10003880
668 Ga0163163_10009424
669 Ga0163163_10076061
670 Ga0163163_10097959
671 Ga0163163_10219584
672 Ga0163163_10306838
673 Ga0157379_10044569
674 Ga0157379_10086916
675 Ga0157379_10198715
676 Ga0157376_10021501
677 Ga0157376_10028994
678 Ga0157376_10033213
679 Ga0157376_10201289
680 Ga0197907_10917173
681 Ga0197907_11225713
682 Ga0206356_10657834
683 Ga0206356_11767643
684 Ga0206349_1368824
685 Ga0206355_1195168
686 Ga0206352_10053285
687 Ga0206352_11176953
688 Ga0206350_11312504
689 Ga0206350_11388105
690 Ga0206353_10198152
691 Ga0224712_10123407
692 Ga0207680_10264827
693 Ga0207699_10031037
694 Ga0207705_10052758
695 Ga0207654_10005842
696 Ga0207654_10015019
697 Ga0207707_10002885
698 Ga0207707_10005940
699 Ga0207707_10074737
700 Ga0207707_10094721
701 Ga0207695_10001188
702 Ga0207695_10001310
703 Ga0207695_10005765
704 Ga0207695_10112912
705 Ga0207695_10155789
706 Ga0207695_10160641
707 Ga0207695_10276096
708 Ga0207695_10338579
709 Ga0207695_10557973
710 Ga0207671_10007106
711 Ga0207671_10012177
712 Ga0207671_10024427
713 Ga0207671_10029844
714 Ga0207671_10036746
715 Ga0207671_10042507
716 Ga0207693_10311834
717 Ga0207660_10391036
718 Ga0207657_10082998
719 Ga0207657_10247043
720 Ga0207657_10261468
721 Ga0207652_10032998
722 Ga0207652_10156726
723 Ga0207646_10015471
724 Ga0207646_10398047
725 Ga0207694_10003775
726 Ga0207694_10007427
727 Ga0207694_10028787
728 Ga0207694_10145961
729 Ga0207694_10216602
730 Ga0207694_10229270
731 Ga0207694_10329057
732 Ga0207650_10012889
733 Ga0207687_10005251
734 Ga0207687_10053934
735 Ga0207687_10089157
736 Ga0207700_10003166
737 Ga0207700_10021504
738 Ga0207700_10047695
739 Ga0207700_10151143
740 Ga0207700_10353182
741 Ga0207664_10000243
742 Ga0207664_10118450
743 Ga0207644_10056513
744 Ga0207686_10015958
745 Ga0207686_10023520
746 Ga0207686_10023603
747 Ga0207709_10060824
748 Ga0207670_10232345
749 Ga0207670_10427020
750 Ga0207704_10081321
751 Ga0207711_10021837
752 Ga0207711_10030259
753 Ga0207711_10169053
754 Ga0207711_10195460
755 Ga0207711_10327222
756 Ga0207689_10038058
757 Ga0207689_10551916
758 Ga0207661_10056543
759 Ga0207661_10527444
760 Ga0207679_10157752
761 Ga0207679_10275157
762 Ga0207679_10297859
763 Ga0207667_10002066
764 Ga0207667_10004805
765 Ga0207667_10010926
766 Ga0207667_10169175
767 Ga0207651_10110789
768 Ga0207651_10221374
769 Ga0207712_10050080
770 Ga0207677_10027475
771 Ga0207677_10146301
772 Ga0207703_10037410
773 Ga0207703_10105005
774 Ga0207639_10014062
775 Ga0207639_10022573
776 Ga0207639_10248252
777 Ga0207702_10009300
778 Ga0207702_10014896
779 Ga0207702_10045760
780 Ga0207702_10263402
781 Ga0207641_10143201
782 Ga0207648_10051195
783 Ga0207648_10167028
784 Ga0207676_10335302
785 Ga0207674_10001767
786 Ga0207674_10074112
787 Ga0207674_10084573
788 Ga0207674_10086350
789 Ga0207674_10477632
790 Ga0207683_10242646
791 Ga0207698_10054915
792 Ga0207698_10132888
793 Ga0207698_10180208
794 Ga0207698_10254723
795 Ga0268264_10007884
796 Ga0268264_10047792
797 Ga0268264_10474650
798 Ga0307408_100338094
799 Ga0307407_10068771
800 Ga0307416_100063925
801 Ga0307411_10455035
802 Ga0307415_100330976
803 Ga0373926_0013543
804 Ga0373923_0025639
805 Ga0373954_0014549
806 Ga0373954_0020592
807 Ga0373954_0034853
808 Ga0373943_0044045
809 Ga0373955_0008232
810 Ga0373955_0024834
811 Ga0373935_0060831
812 Ga0373935_0206526
813 Ga0373935_0236191
814 Ga0373927_0000664
815 Ga0373927_0000847
816 Ga0373927_0011302
817 Ga0373927_0017561
818 Ga0373927_0292251
819 Ga0373933_0006193
820 Ga0373933_0081951
821 Ga0373933_0113511
822 Ga0373933_0332826
823 Ga0373947_0000400
824 Ga0373937_0001491
825 Ga0373937_0005455
826 Ga0373937_0010928
827 Ga0373937_0048251
828 Ga0373937_0054067
829 Ga0373937_0082981
830 Ga0373937_0194849
831 Ga0373925_0016571
832 Ga0466959_0275932
833 Ga0451576_0043170
834 Ga0495592_0025315
835 Ga0495651_0002690
836 Ga0495651_0033298
837 Ga0495651_0135926
838 Ga0495651_0141498
839 Ga0495580_0002877
840 Ga0495580_0007885
841 Ga0495580_0028426
842 Ga0495580_0077274
843 Ga0495664_0008895
844 Ga0495664_0077904
845 Ga0495664_0086219
846 Ga0495628_0004680
847 Ga0495630_0008281
848 Ga0495652_0013631
849 Ga0495652_0113446
850 Ga0495652_0270579
851 Ga0495640_0230447
852 Ga0495586_0163723
853 Ga0495587_0003460
854 Ga0495587_0057746
855 Ga0495587_0074194
856 Ga0495609_0128415
857 Ga0495645_0003950
858 Ga0495645_0037085
859 Ga0495645_0076344
860 Ga0495667_0048860
861 Ga0495667_0226928
862 Ga0495634_0110201
863 Ga0495635_0003877
864 Ga0495635_0226690
865 Ga0495599_0055315
866 Ga0495623_0011797
867 Ga0495623_0120388
868 Ga0495623_0135395
869 Ga0495613_0085726
870 Ga0495624_0099588
871 Ga0495600_0253157
872 Ga0495581_0295418
873 Ga0495636_0062628
874 Ga0495674_0007677
875 Ga0495674_0008064
876 Ga0495676_0358548
877 Ga0495680_0157586
878 Ga0495684_0000960
879 Ga0495684_0009731
880 Ga0495684_0026527
881 Ga0495684_0032825
882 Ga0495684_0282695
883 Ga0495602_0019021
884 Ga0496102_0103213
885 Ga0496115_0092754
886 Ga0501268_008892
887 nmdc:mga05p37_29176_c1
888 nmdc:mga05p37_657799_c1
889 nmdc:mga09592_162728_c1
890 nmdc:mga06r32_16421_c1
891 nmdc:mga08y16_113330_c1
892 nmdc:mga08y16_456804_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07485

DUF1529

Domain of Unknown Function (DUF1259)

57

177

0.97

PF07485

DUF1529

Domain of Unknown Function (DUF1259)

204

331

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p8z-assembly1.cif.gz_T fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp:sordarin cryo-em reconstruction 0.7257 226 293
2p8w-assembly1.cif.gz_T fitted structure of eef2 in the 80s:eef2:gdpnp cryo-em reconstruction 0.7256 226 293
6mmo-assembly1.cif.gz_B carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to amp 0.7077 227 289
6icz-assembly1.cif.gz_C cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom 0.7034 214 291
6mmq-assembly1.cif.gz_B carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to camp 0.7001 224 289
ID Description Score Start End Superfamily
af_I6X9E2_51_172_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9639 29 147 3.30.1460.10
af_I6X9E2_51_172_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9335 29 147 3.30.1460.10
af_I6X9E2_193_312_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9174 29 147 3.30.1460.10
af_I6X9E2_193_312_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.896 29 147 3.30.1460.10
af_A0A1D6GPI2_538_640_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8261 231 274 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V9LSU1-F1-model_v4 DUF1259 domain-containing protein 0.9976 215 294
AF-A0A3D4AXT3-F1-model_v4 DUF1259 domain-containing protein 0.9884 230 295
AF-A0A2V6KAH2-F1-model_v4 DUF1259 domain-containing protein 0.9878 215 293
AF-A0A2V9K845-F1-model_v4 DUF1259 domain-containing protein 0.9843 209 292
AF-A0A7W1G666-F1-model_v4 DUF1259 domain-containing protein 0.9797 214 291

Map