F445676

General Info

Members Datasets Scaffolds Average Seq Length
446 177 892 251

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100146109|Ga0070665_1001461092
Length 260
Sequence MEEMATQTVCAKCGGTGWIIVERGQVSGAEPCDCRTAGRAERLEDRAQIPPLYQKASLENFSVPGPENPIARRELTNVLLAVKTFLRDFPNPSRPGLLLIGSPGTGKTHLAVAALRTIISKGFEGVFCDYKSLLDRIRSGYDPNSNSADKEAYRIALDSEVLLLDDLGAHRVTDWVEDTVTSIVTHRCNNRRALIATTNLPDADAGVATMKRSASGNIDYAPATLAERVGPRARSRLFEMCTVIKMPIVDDYRLRKARSF

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.22
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 17.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100146109 3300005548 Unclassified 2367
2 Ga0070658_10045868 3300005327 Bacteria 3535
3 Ga0070658_10425904 3300005327 Unclassified 1142
4 Ga0070683_100000049 3300005329 Bacteria 93310
5 Ga0070683_100034365 3300005329 Bacteria 4631
6 Ga0070683_100039888 3300005329 Bacteria 4313
7 Ga0070683_100103491 3300005329 Unclassified 2683
8 Ga0070683_100285742 3300005329 Bacteria 1569
9 Ga0070670_100470035 3300005331 Bacteria 1116
10 Ga0070666_10140408 3300005335 Unclassified 1682
11 Ga0070666_10290946 3300005335 Bacteria 1162
12 Ga0070682_100235693 3300005337 Bacteria 1311
13 Ga0068868_100030206 3300005338 Bacteria 4155
14 Ga0068868_100126853 3300005338 Bacteria 2085
15 Ga0068868_100182196 3300005338 Bacteria 1743
16 Ga0070660_100258581 3300005339 Bacteria 1421
17 Ga0070691_10038062 3300005341 Bacteria 2271
18 Ga0070688_100221976 3300005365 Bacteria 1332
19 Ga0070688_100277809 3300005365 Unclassified 1202
20 Ga0070667_100016119 3300005367 Bacteria 6182
21 Ga0070667_100308482 3300005367 Bacteria 1426
22 Ga0070709_10438172 3300005434 Unclassified 982
23 Ga0070714_100182888 3300005435 Bacteria 1908
24 Ga0070714_100224218 3300005435 Bacteria 1729
25 Ga0070713_100006142 3300005436 Bacteria 8294
26 Ga0070663_100103917 3300005455 Bacteria 2124
27 Ga0070681_10001496 3300005458 Bacteria 20664
28 Ga0070681_10034909 3300005458 Bacteria 5051
29 Ga0070681_10110273 3300005458 Bacteria 2691
30 Ga0070681_10121396 3300005458 Bacteria 2548
31 Ga0070679_100015529 3300005530 Bacteria 7317
32 Ga0070679_100051467 3300005530 Bacteria 4102
33 Ga0070684_100000040 3300005535 Bacteria 93306
34 Ga0070684_100017739 3300005535 Bacteria 5850
35 Ga0070684_100050796 3300005535 Bacteria 3602
36 Ga0070684_100091661 3300005535 Bacteria 2703
37 Ga0068853_100027705 3300005539 Bacteria 4762
38 Ga0068853_100644770 3300005539 Bacteria 1008
39 Ga0070686_100207474 3300005544 Bacteria 1408
40 Ga0070665_100024621 3300005548 Bacteria 6066
41 Ga0070665_100076121 3300005548 Bacteria 3363
42 Ga0070665_100076919 3300005548 Bacteria 3343
43 Ga0070665_100094457 3300005548 Bacteria 2995
44 Ga0070665_100154154 3300005548 Unclassified 2299
45 Ga0070665_100296397 3300005548 Bacteria 1620
46 Ga0070665_100506113 3300005548 Bacteria 1219
47 Ga0070704_100368231 3300005549 Unclassified 1218
48 Ga0068855_100003521 3300005563 Bacteria 19148
49 Ga0068855_100071912 3300005563 Bacteria 4020
50 Ga0068855_100178793 3300005563 Bacteria 2399
51 Ga0068855_100210284 3300005563 Bacteria 2186
52 Ga0068855_100249502 3300005563 Bacteria 1980
53 Ga0068857_100000790 3300005577 Bacteria 23681
54 Ga0068857_100004199 3300005577 Bacteria 12128
55 Ga0068857_100007541 3300005577 Bacteria 9364
56 Ga0068857_100017543 3300005577 Bacteria 6276
57 Ga0068857_100085413 3300005577 Bacteria 2821
58 Ga0068856_100013708 3300005614 Bacteria 7837
59 Ga0068856_100227730 3300005614 Bacteria 1879
60 Ga0068856_100421900 3300005614 Bacteria 1354
61 Ga0068856_100711627 3300005614 Bacteria 1024
62 Ga0068852_100002171 3300005616 Bacteria 13449
63 Ga0068852_100047237 3300005616 Unclassified 3672
64 Ga0068852_100210983 3300005616 Bacteria 1842
65 Ga0068859_100460905 3300005617 Bacteria 1367
66 Ga0068864_100380967 3300005618 Bacteria 1337
67 Ga0068863_100017517 3300005841 Bacteria 6868
68 Ga0068863_100600153 3300005841 Bacteria 1090
69 Ga0068858_100001542 3300005842 Bacteria 23653
70 Ga0068858_100022662 3300005842 Bacteria 5857
71 Ga0068858_100226910 3300005842 Bacteria 1770
72 Ga0068860_100004650 3300005843 Bacteria 14013
73 Ga0070717_10376798 3300006028 Bacteria 1272
74 Ga0097621_100007348 3300006237 Bacteria 7877
75 Ga0097621_100013506 3300006237 Bacteria 6089
76 Ga0097621_100040231 3300006237 Bacteria 3758
77 Ga0097621_100526026 3300006237 Bacteria 1074
78 Ga0097621_100535873 3300006237 Bacteria 1064
79 Ga0097621_100654496 3300006237 Bacteria 964
80 Ga0097621_100681490 3300006237 Bacteria 945
81 Ga0097621_100774606 3300006237 Unclassified 887
82 Ga0068871_100011461 3300006358 Bacteria 6504
83 Ga0068871_100017407 3300006358 Bacteria 5438
84 Ga0068871_100067354 3300006358 Bacteria 2937
85 Ga0068871_100147415 3300006358 Bacteria 2005
86 Ga0068871_100266000 3300006358 Unclassified 1497
87 Ga0068865_100010793 3300006881 Bacteria 5698
88 Ga0097620_100460876 3300006931 Bacteria 1367
89 Ga0105240_10001488 3300009093 Bacteria 39873
90 Ga0105240_10157791 3300009093 Bacteria 2697
91 Ga0105240_10220525 3300009093 Bacteria 2210
92 Ga0105240_10271056 3300009093 Unclassified 1954
93 Ga0105245_10000447 3300009098 Bacteria 37818
94 Ga0105245_10004761 3300009098 Bacteria 11980
95 Ga0105245_10070890 3300009098 Bacteria 3164
96 Ga0105245_10179155 3300009098 Bacteria 2024
97 Ga0105245_10375344 3300009098 Bacteria 1415
98 Ga0105247_10132721 3300009101 Unclassified 1624
99 Ga0105243_10073278 3300009148 Unclassified 2774
100 Ga0105243_10182490 3300009148 Bacteria 1826
101 Ga0105241_10057013 3300009174 Bacteria 2996
102 Ga0105241_10151794 3300009174 Unclassified 1896
103 Ga0105241_10196403 3300009174 Unclassified 1682
104 Ga0105241_10221338 3300009174 Unclassified 1591
105 Ga0105241_10338073 3300009174 Bacteria 1304
106 Ga0105241_10489953 3300009174 Bacteria 1094
107 Ga0105242_10002438 3300009176 Bacteria 14611
108 Ga0105242_10010069 3300009176 Bacteria 7239
109 Ga0105242_10016576 3300009176 Bacteria 5729
110 Ga0105242_10166248 3300009176 Unclassified 1935
111 Ga0105242_10218552 3300009176 Unclassified 1702
112 Ga0105242_10281889 3300009176 Bacteria 1510
113 Ga0105248_10006815 3300009177 Bacteria 12524
114 Ga0105248_10011074 3300009177 Bacteria 9948
115 Ga0105248_10061425 3300009177 Unclassified 4219
116 Ga0105248_10103568 3300009177 Bacteria 3208
117 Ga0105248_10112776 3300009177 Bacteria 3066
118 Ga0105248_10260170 3300009177 Bacteria 1953
119 Ga0105248_10263379 3300009177 Unclassified 1941
120 Ga0105248_10353994 3300009177 Unclassified 1653
121 Ga0105248_10362840 3300009177 Bacteria 1631
122 Ga0105248_10440334 3300009177 Bacteria 1468
123 Ga0105248_10581214 3300009177 Unclassified 1264
124 Ga0105248_10638594 3300009177 Bacteria 1201
125 Ga0105237_10004149 3300009545 Bacteria 16886
126 Ga0105237_10006535 3300009545 Bacteria 12901
127 Ga0105237_10008379 3300009545 Bacteria 11206
128 Ga0105237_10030477 3300009545 Bacteria 5478
129 Ga0105237_10137201 3300009545 Bacteria 2440
130 Ga0105238_10003081 3300009551 Bacteria 16629
131 Ga0105238_10011951 3300009551 Bacteria 8747
132 Ga0105238_10017211 3300009551 Bacteria 7342
133 Ga0105238_10018155 3300009551 Bacteria 7153
134 Ga0105238_10021510 3300009551 Bacteria 6570
135 Ga0105238_10028320 3300009551 Bacteria 5709
136 Ga0105238_10146410 3300009551 Bacteria 2339
137 Ga0105238_10161660 3300009551 Bacteria 2215
138 Ga0105238_11030275 3300009551 Unclassified 844
139 Ga0105238_11168560 3300009551 Bacteria 793
140 Ga0105239_10005776 3300010375 Bacteria 14435
141 Ga0105239_10006454 3300010375 Bacteria 13604
142 Ga0105239_10047495 3300010375 Bacteria 4705
143 Ga0105239_10077623 3300010375 Bacteria 3655
144 Ga0105239_10141716 3300010375 Bacteria 2679
145 Ga0105239_10163147 3300010375 Bacteria 2490
146 Ga0105239_10177790 3300010375 Bacteria 2380
147 Ga0105239_10199567 3300010375 Bacteria 2241
148 Ga0105239_10456452 3300010375 Bacteria 1450
149 Ga0105239_10652632 3300010375 Unclassified 1202
150 Ga0105239_10661485 3300010375 Bacteria 1193
151 Ga0105246_10080014 3300011119 Unclassified 2325
152 Ga0105246_10121683 3300011119 Bacteria 1935
153 Ga0157370_10092217 3300013104 Bacteria 2843
154 Ga0157370_10180064 3300013104 Bacteria 1964
155 Ga0157370_10246602 3300013104 Bacteria 1652
156 Ga0157370_10317095 3300013104 Unclassified 1438
157 Ga0157369_10055746 3300013105 Unclassified 4266
158 Ga0157369_10073170 3300013105 Bacteria 3677
159 Ga0157369_10191054 3300013105 Bacteria 2152
160 Ga0157369_10463302 3300013105 Unclassified 1312
161 Ga0157374_10045196 3300013296 Bacteria 4075
162 Ga0157378_10003109 3300013297 Bacteria 14757
163 Ga0157378_10240146 3300013297 Unclassified 1730
164 Ga0157378_10616510 3300013297 Bacteria 1098
165 Ga0163162_10001773 3300013306 Bacteria 20228
166 Ga0163162_11017049 3300013306 Bacteria 937
167 Ga0157372_10007106 3300013307 Bacteria 11934
168 Ga0157372_10053364 3300013307 Bacteria 4506
169 Ga0157372_10636320 3300013307 Unclassified 1242
170 Ga0157375_10248036 3300013308 Bacteria 1941
171 Ga0157375_11002217 3300013308 Unclassified 975
172 Ga0163163_10031458 3300014325 Bacteria 5121
173 Ga0163163_10046684 3300014325 Unclassified 4254
174 Ga0163163_10258357 3300014325 Bacteria 1793
175 Ga0163163_10396354 3300014325 Unclassified 1438
176 Ga0157379_10198623 3300014968 Unclassified 1813
177 Ga0157376_10093445 3300014969 Bacteria 2611
178 Ga0157376_10115018 3300014969 Unclassified 2374
179 Ga0157376_10234232 3300014969 Unclassified 1707
180 Ga0157376_10267639 3300014969 Bacteria 1604
181 Ga0157376_10286421 3300014969 Unclassified 1554
182 Ga0206352_11271141 3300020078 Unclassified 948
183 Ga0213876_10005447 3300021384 Bacteria 6999
184 Ga0213875_10000065 3300021388 Bacteria 128682
185 Ga0213875_10002442 3300021388 Bacteria 11109
186 Ga0213875_10020262 3300021388 Bacteria 3191
187 Ga0213875_10087512 3300021388 Bacteria 1453
188 Ga0207680_10220814 3300025903 Unclassified 1299
189 Ga0207654_10043718 3300025911 Bacteria 2541
190 Ga0207654_10079496 3300025911 Bacteria 1970
191 Ga0207654_10111344 3300025911 Unclassified 1704
192 Ga0207707_10064810 3300025912 Bacteria 3181
193 Ga0207707_10104285 3300025912 Bacteria 2478
194 Ga0207707_10153606 3300025912 Unclassified 2012
195 Ga0207707_10188301 3300025912 Bacteria 1801
196 Ga0207707_10275363 3300025912 Bacteria 1458
197 Ga0207695_10002549 3300025913 Bacteria 26774
198 Ga0207695_10005000 3300025913 Bacteria 17819
199 Ga0207695_10022166 3300025913 Bacteria 7223
200 Ga0207695_10051877 3300025913 Bacteria 4303
201 Ga0207695_10131226 3300025913 Bacteria 2463
202 Ga0207671_10004767 3300025914 Bacteria 12802
203 Ga0207671_10064703 3300025914 Bacteria 2719
204 Ga0207671_10101045 3300025914 Bacteria 2185
205 Ga0207660_10105592 3300025917 Bacteria 2111
206 Ga0207660_10283210 3300025917 Bacteria 1316
207 Ga0207660_10409753 3300025917 Bacteria 1092
208 Ga0207652_10100004 3300025921 Bacteria 2560
209 Ga0207652_10201040 3300025921 Bacteria 1793
210 Ga0207694_10001067 3300025924 Bacteria 23855
211 Ga0207694_10004825 3300025924 Bacteria 10464
212 Ga0207694_10012048 3300025924 Bacteria 6519
213 Ga0207694_10062187 3300025924 Bacteria 2907
214 Ga0207694_10644231 3300025924 Unclassified 893
215 Ga0207687_10000964 3300025927 Bacteria 19563
216 Ga0207687_10006530 3300025927 Bacteria 7705
217 Ga0207687_10029031 3300025927 Bacteria 3718
218 Ga0207700_10380785 3300025928 Bacteria 1234
219 Ga0207686_10008604 3300025934 Bacteria 5510
220 Ga0207686_10024107 3300025934 Bacteria 3521
221 Ga0207686_10108868 3300025934 Bacteria 1865
222 Ga0207686_10161102 3300025934 Unclassified 1572
223 Ga0207670_10101842 3300025936 Unclassified 2052
224 Ga0207704_10044029 3300025938 Bacteria 2641
225 Ga0207704_10261723 3300025938 Bacteria 1305
226 Ga0207711_10001158 3300025941 Bacteria 25079
227 Ga0207711_10116674 3300025941 Unclassified 2380
228 Ga0207711_10121041 3300025941 Bacteria 2336
229 Ga0207711_10242170 3300025941 Bacteria 1654
230 Ga0207711_10265372 3300025941 Bacteria 1579
231 Ga0207711_10305742 3300025941 Unclassified 1467
232 Ga0207711_10522384 3300025941 Bacteria 1107
233 Ga0207689_10021053 3300025942 Bacteria 5481
234 Ga0207661_10000050 3300025944 Bacteria 93646
235 Ga0207661_10061745 3300025944 Bacteria 3029
236 Ga0207661_10112855 3300025944 Bacteria 2302
237 Ga0207661_10152368 3300025944 Unclassified 1999
238 Ga0207661_10238875 3300025944 Bacteria 1611
239 Ga0207661_10250721 3300025944 Bacteria 1573
240 Ga0207667_10001521 3300025949 Bacteria 29152
241 Ga0207667_10185647 3300025949 Bacteria 2135
242 Ga0207667_10206804 3300025949 Bacteria 2012
243 Ga0207658_10016232 3300025986 Bacteria 5120
244 Ga0207658_10365932 3300025986 Bacteria 1259
245 Ga0207677_10160175 3300026023 Bacteria 1747
246 Ga0207677_10513927 3300026023 Bacteria 1038
247 Ga0207703_10008554 3300026035 Bacteria 8080
248 Ga0207703_10056468 3300026035 Bacteria 3198
249 Ga0207703_10060336 3300026035 Bacteria 3101
250 Ga0207703_10099622 3300026035 Bacteria 2460
251 Ga0207703_10289188 3300026035 Bacteria 1491
252 Ga0207639_10084990 3300026041 Bacteria 2515
253 Ga0207639_10529644 3300026041 Bacteria 1080
254 Ga0207678_10108038 3300026067 Unclassified 2373
255 Ga0207702_10044568 3300026078 Unclassified 3729
256 Ga0207702_10139774 3300026078 Bacteria 2190
257 Ga0207702_10756722 3300026078 Bacteria 959
258 Ga0207641_10036463 3300026088 Bacteria 4105
259 Ga0207641_10381927 3300026088 Unclassified 1349
260 Ga0207641_10542521 3300026088 Bacteria 1133
261 Ga0207676_10070246 3300026095 Bacteria 2808
262 Ga0207676_10577911 3300026095 Bacteria 1077
263 Ga0207674_10002017 3300026116 Bacteria 25760
264 Ga0207674_10005796 3300026116 Bacteria 14656
265 Ga0207674_10030744 3300026116 Bacteria 5644
266 Ga0207674_10076880 3300026116 Bacteria 3345
267 Ga0207683_10118633 3300026121 Bacteria 2374
268 Ga0207698_10006849 3300026142 Bacteria 7129
269 Ga0207698_10245585 3300026142 Unclassified 1634
270 Ga0268266_10017145 3300028379 Bacteria 6184
271 Ga0268266_10040880 3300028379 Bacteria 3953
272 Ga0268266_10095027 3300028379 Bacteria 2617
273 Ga0268266_10282020 3300028379 Bacteria 1545
274 Ga0268266_10407588 3300028379 Bacteria 1286
275 Ga0268264_10049981 3300028381 Bacteria 3480
276 Ga0268264_10242803 3300028381 Unclassified 1669
277 Ga0268264_10719624 3300028381 Bacteria 992
278 Ga0265330_10116744 3300031235 Unclassified 1138
279 Ga0265332_10175093 3300031238 Unclassified 895
280 Ga0265320_10015209 3300031240 Bacteria 4355
281 Ga0265329_10008054 3300031242 Bacteria 4029
282 Ga0265331_10026080 3300031250 Bacteria 2943
283 Ga0265331_10119899 3300031250 Bacteria 1203
284 Ga0265316_10003057 3300031344 Bacteria 17084
285 Ga0265316_10003280 3300031344 Bacteria 16419
286 Ga0265316_10035103 3300031344 Unclassified 4068
287 Ga0265316_10066947 3300031344 Unclassified 2778
288 Ga0265316_10069183 3300031344 Bacteria 2724
289 Ga0265314_10000978 3300031711 Bacteria 33599
290 Ga0265314_10004666 3300031711 Bacteria 12588
291 Ga0265314_10005160 3300031711 Bacteria 11869
292 Ga0265342_10218961 3300031712 Bacteria 1026
293 Ga0373934_0015860 3300035086 Bacteria 2862
294 Ga0373923_0073409 3300035111 Bacteria 1473
295 Ga0373953_0007945 3300035117 Bacteria 3579
296 Ga0373954_0012114 3300035118 Bacteria 3832
297 Ga0373954_0013338 3300035118 Bacteria 3662
298 Ga0373954_0085094 3300035118 Unclassified 1514
299 Ga0373956_0150307 3300035119 Unclassified 1096
300 Ga0373943_0041382 3300035170 Bacteria 2228
301 Ga0373935_0024852 3300035692 Bacteria 3690
302 Ga0373935_0145891 3300035692 Bacteria 1602
303 Ga0373935_0301278 3300035692 Unclassified 1133
304 Ga0373935_0400044 3300035692 Bacteria 986
305 Ga0373927_0004677 3300035695 Bacteria 9546
306 Ga0373933_0009519 3300035724 Bacteria 5306
307 Ga0373947_0026333 3300035725 Bacteria 3398
308 Ga0373947_0114187 3300035725 Unclassified 1710
309 Ga0373947_0163016 3300035725 Bacteria 1443
310 Ga0373937_0003169 3300036401 Bacteria 13765
311 Ga0373937_0016750 3300036401 Bacteria 6514
312 Ga0373937_0118804 3300036401 Unclassified 2463
313 Ga0373937_0552399 3300036401 Bacteria 1094
314 Ga0373925_0284312 3300037068 Bacteria 1333
315 Ga0373925_0311776 3300037068 Bacteria 1272
316 Ga0395898_0509832 3300037466 Unclassified 1144
317 Ga0436364_0062214 3300037853 Bacteria 2431
318 Ga0436364_0065534 3300037853 Bacteria 2966
319 Ga0436364_0088421 3300037853 Bacteria 2058
320 Ga0436364_0213713 3300037853 Unclassified 1351
321 Ga0436364_0828992 3300037853 Bacteria 61632
322 Ga0436364_1077903 3300037853 Bacteria 12825
323 Ga0436364_1087136 3300037853 Bacteria 5139
324 Ga0436364_1193946 3300037853 Bacteria 1738
325 Ga0436364_1259051 3300037853 Unclassified 1647
326 Ga0436365_0366619 3300039437 Bacteria 17333
327 Ga0436360_0053971 3300039438 Bacteria 38094
328 Ga0436361_0878260 3300039447 Bacteria 5473
329 Ga0436363_0334082 3300039450 Bacteria 1753
330 Ga0436362_0583644 3300039453 Bacteria 1375
331 Ga0466960_0066342 3300044901 Bacteria 1784
332 Ga0451576_0027751 3300045051 Bacteria 6078
333 Ga0451576_0396508 3300045051 Bacteria 1447
334 Ga0466967_0720383 3300045976 Bacteria 989
335 Ga0495592_0007040 3300046454 Bacteria 8411
336 Ga0495592_0109448 3300046454 Bacteria 1957
337 Ga0495629_0157676 3300046459 Unclassified 1577
338 Ga0495651_0031113 3300046462 Bacteria 4162
339 Ga0495580_0084347 3300046472 Unclassified 2213
340 Ga0495580_0105879 3300046472 Bacteria 1954
341 Ga0495580_0151091 3300046472 Bacteria 1609
342 Ga0495580_0188744 3300046472 Unclassified 1422
343 Ga0495582_0016829 3300046473 Bacteria 4004
344 Ga0495664_0082755 3300046477 Bacteria 1925
345 Ga0495664_0139291 3300046477 Unclassified 1470
346 Ga0495594_0026522 3300046499 Bacteria 3118
347 Ga0495608_0072123 3300046511 Bacteria 2253
348 Ga0495608_0079868 3300046511 Bacteria 2127
349 Ga0495618_0100998 3300046514 Bacteria 1847
350 Ga0495618_0341942 3300046514 Bacteria 923
351 Ga0495628_0098725 3300046516 Bacteria 2255
352 Ga0495628_0374757 3300046516 Unclassified 1043
353 Ga0495630_0155278 3300046517 Bacteria 1742
354 Ga0495666_0217476 3300046526 Bacteria 876
355 Ga0495652_0030971 3300046529 Bacteria 4688
356 Ga0495652_0046697 3300046529 Bacteria 3716
357 Ga0495652_0364863 3300046529 Unclassified 1031
358 Ga0495652_0387721 3300046529 Bacteria 992
359 Ga0495665_0074387 3300046531 Unclassified 1789
360 Ga0495665_0194559 3300046531 Bacteria 1052
361 Ga0495665_0258305 3300046531 Unclassified 896
362 Ga0495640_0087098 3300046533 Bacteria 2066
363 Ga0495640_0305155 3300046533 Bacteria 988
364 Ga0495587_0005431 3300046536 Bacteria 8319
365 Ga0495587_0077004 3300046536 Unclassified 1937
366 Ga0495587_0105951 3300046536 Bacteria 1617
367 Ga0495645_0048604 3300046543 Bacteria 3089
368 Ga0495645_0122886 3300046543 Bacteria 1826
369 Ga0495645_0186388 3300046543 Bacteria 1418
370 Ga0495645_0238921 3300046543 Bacteria 1213
371 Ga0495645_0337409 3300046543 Bacteria 974
372 Ga0495667_0102390 3300046559 Bacteria 1852
373 Ga0495667_0221682 3300046559 Bacteria 1207
374 Ga0495667_0280662 3300046559 Bacteria 1057
375 Ga0495635_0057210 3300046663 Bacteria 2683
376 Ga0495635_0482859 3300046663 Bacteria 817
377 Ga0495599_0064694 3300046678 Bacteria 2284
378 Ga0495599_0227567 3300046678 Bacteria 1139
379 Ga0495623_0035007 3300046679 Bacteria 3219
380 Ga0495623_0182030 3300046679 Bacteria 1220
381 Ga0495646_0204802 3300046680 Bacteria 1073
382 Ga0495658_0033024 3300046683 Bacteria 2831
383 Ga0495613_0104718 3300046689 Bacteria 2043
384 Ga0495613_0135908 3300046689 Bacteria 1759
385 Ga0495613_0295908 3300046689 Bacteria 1121
386 Ga0495604_0055215 3300047317 Bacteria 3062
387 Ga0495604_0064805 3300047317 Bacteria 2783
388 Ga0495674_0037961 3300047319 Bacteria 4327
389 Ga0495674_0045019 3300047319 Bacteria 3920
390 Ga0495674_0047652 3300047319 Bacteria 3798
391 Ga0495674_0138677 3300047319 Bacteria 2045
392 Ga0495674_0590893 3300047319 Unclassified 880
393 Ga0495680_0018201 3300047322 Bacteria 5973
394 Ga0495680_0059864 3300047322 Bacteria 2938
395 Ga0495680_0230524 3300047322 Bacteria 1319
396 Ga0495675_0048067 3300047444 Bacteria 2714
397 Ga0495675_0154678 3300047444 Bacteria 1415
398 Ga0495675_0183662 3300047444 Bacteria 1279
399 Ga0495675_0224897 3300047444 Bacteria 1134
400 Ga0495684_0001189 3300047471 Bacteria 20997
401 Ga0495684_0022645 3300047471 Bacteria 4832
402 Ga0495684_0058372 3300047471 Bacteria 2940
403 Ga0495684_0065617 3300047471 Bacteria 2759
404 Ga0495684_0093065 3300047471 Bacteria 2283
405 Ga0495602_0019096 3300048088 Bacteria 6818
406 Ga0495602_0133184 3300048088 Unclassified 1979
407 Ga0495602_0209404 3300048088 Bacteria 1481
408 Ga0496115_0064442 3300048918 Bacteria 2958
409 Ga0501031_0018959 3300049568 Bacteria 4479
410 Ga0501032_0000753 3300049569 Bacteria 26307
411 Ga0501034_0074125 3300049571 Bacteria 3412
412 Ga0501036_0000903 3300049572 Bacteria 22237
413 Ga0501037_0006095 3300049573 Bacteria 8813
414 Ga0501038_0018082 3300049574 Bacteria 6367
415 Ga0501039_0002253 3300049575 Bacteria 14308
416 Ga0501043_0006128 3300049579 Bacteria 9658
417 Ga0501043_0394501 3300049579 Unclassified 1046
418 Ga0501046_0001219 3300049580 Bacteria 24926
419 Ga0501046_0019596 3300049580 Bacteria 5610
420 Ga0501047_0032430 3300049581 Bacteria 5042
421 Ga0501047_0091136 3300049581 Bacteria 2926
422 Ga0501048_0034899 3300049582 Bacteria 3625
423 Ga0501048_0452669 3300049582 Unclassified 919
424 Ga0501067_0000509 3300049583 Bacteria 21255
425 Ga0501068_0000678 3300049584 Bacteria 17415
426 Ga0501069_0009649 3300049585 Bacteria 5099
427 Ga0501070_0010550 3300049586 Bacteria 7810
428 Ga0501070_0014085 3300049586 Bacteria 6732
429 Ga0501070_0109336 3300049586 Bacteria 2284
430 Ga0501072_0001402 3300049588 Bacteria 18127
431 Ga0501073_0000471 3300049589 Bacteria 27854
432 Ga0501074_0057430 3300049590 Bacteria 2803
433 Ga0501077_0048496 3300049593 Bacteria 2698
434 Ga0501079_0007513 3300049741 Bacteria 8245
435 Ga0501080_0000006 3300049742 Bacteria 138444
436 Ga0501080_0080525 3300049742 Bacteria 3027
437 Ga0501083_0012241 3300049744 Bacteria 6003
438 Ga0501035_0011422 3300049822 Bacteria 8234
439 Ga0501035_0107971 3300049822 Bacteria 2440
440 Ga0501044_0001294 3300049823 Bacteria 29569
441 Ga0501044_0007259 3300049823 Bacteria 12187
442 Ga0501044_0025330 3300049823 Bacteria 6287
443 Ga0501044_0026136 3300049823 Bacteria 6182
444 Ga0495595_0162434 3300053084 Bacteria 1103
445 Ga0500568_0000602 3300053139 Bacteria 26139
446 Ga0501082_0000180 3300060353 Bacteria 54743
447 Ga0070665_100146109
448 Ga0070658_10045868
449 Ga0070658_10425904
450 Ga0070683_100000049
451 Ga0070683_100034365
452 Ga0070683_100039888
453 Ga0070683_100103491
454 Ga0070683_100285742
455 Ga0070670_100470035
456 Ga0070666_10140408
457 Ga0070666_10290946
458 Ga0070682_100235693
459 Ga0068868_100030206
460 Ga0068868_100126853
461 Ga0068868_100182196
462 Ga0070660_100258581
463 Ga0070691_10038062
464 Ga0070688_100221976
465 Ga0070688_100277809
466 Ga0070667_100016119
467 Ga0070667_100308482
468 Ga0070709_10438172
469 Ga0070714_100182888
470 Ga0070714_100224218
471 Ga0070713_100006142
472 Ga0070663_100103917
473 Ga0070681_10001496
474 Ga0070681_10034909
475 Ga0070681_10110273
476 Ga0070681_10121396
477 Ga0070679_100015529
478 Ga0070679_100051467
479 Ga0070684_100000040
480 Ga0070684_100017739
481 Ga0070684_100050796
482 Ga0070684_100091661
483 Ga0068853_100027705
484 Ga0068853_100644770
485 Ga0070686_100207474
486 Ga0070665_100024621
487 Ga0070665_100076121
488 Ga0070665_100076919
489 Ga0070665_100094457
490 Ga0070665_100154154
491 Ga0070665_100296397
492 Ga0070665_100506113
493 Ga0070704_100368231
494 Ga0068855_100003521
495 Ga0068855_100071912
496 Ga0068855_100178793
497 Ga0068855_100210284
498 Ga0068855_100249502
499 Ga0068857_100000790
500 Ga0068857_100004199
501 Ga0068857_100007541
502 Ga0068857_100017543
503 Ga0068857_100085413
504 Ga0068856_100013708
505 Ga0068856_100227730
506 Ga0068856_100421900
507 Ga0068856_100711627
508 Ga0068852_100002171
509 Ga0068852_100047237
510 Ga0068852_100210983
511 Ga0068859_100460905
512 Ga0068864_100380967
513 Ga0068863_100017517
514 Ga0068863_100600153
515 Ga0068858_100001542
516 Ga0068858_100022662
517 Ga0068858_100226910
518 Ga0068860_100004650
519 Ga0070717_10376798
520 Ga0097621_100007348
521 Ga0097621_100013506
522 Ga0097621_100040231
523 Ga0097621_100526026
524 Ga0097621_100535873
525 Ga0097621_100654496
526 Ga0097621_100681490
527 Ga0097621_100774606
528 Ga0068871_100011461
529 Ga0068871_100017407
530 Ga0068871_100067354
531 Ga0068871_100147415
532 Ga0068871_100266000
533 Ga0068865_100010793
534 Ga0097620_100460876
535 Ga0105240_10001488
536 Ga0105240_10157791
537 Ga0105240_10220525
538 Ga0105240_10271056
539 Ga0105245_10000447
540 Ga0105245_10004761
541 Ga0105245_10070890
542 Ga0105245_10179155
543 Ga0105245_10375344
544 Ga0105247_10132721
545 Ga0105243_10073278
546 Ga0105243_10182490
547 Ga0105241_10057013
548 Ga0105241_10151794
549 Ga0105241_10196403
550 Ga0105241_10221338
551 Ga0105241_10338073
552 Ga0105241_10489953
553 Ga0105242_10002438
554 Ga0105242_10010069
555 Ga0105242_10016576
556 Ga0105242_10166248
557 Ga0105242_10218552
558 Ga0105242_10281889
559 Ga0105248_10006815
560 Ga0105248_10011074
561 Ga0105248_10061425
562 Ga0105248_10103568
563 Ga0105248_10112776
564 Ga0105248_10260170
565 Ga0105248_10263379
566 Ga0105248_10353994
567 Ga0105248_10362840
568 Ga0105248_10440334
569 Ga0105248_10581214
570 Ga0105248_10638594
571 Ga0105237_10004149
572 Ga0105237_10006535
573 Ga0105237_10008379
574 Ga0105237_10030477
575 Ga0105237_10137201
576 Ga0105238_10003081
577 Ga0105238_10011951
578 Ga0105238_10017211
579 Ga0105238_10018155
580 Ga0105238_10021510
581 Ga0105238_10028320
582 Ga0105238_10146410
583 Ga0105238_10161660
584 Ga0105238_11030275
585 Ga0105238_11168560
586 Ga0105239_10005776
587 Ga0105239_10006454
588 Ga0105239_10047495
589 Ga0105239_10077623
590 Ga0105239_10141716
591 Ga0105239_10163147
592 Ga0105239_10177790
593 Ga0105239_10199567
594 Ga0105239_10456452
595 Ga0105239_10652632
596 Ga0105239_10661485
597 Ga0105246_10080014
598 Ga0105246_10121683
599 Ga0157370_10092217
600 Ga0157370_10180064
601 Ga0157370_10246602
602 Ga0157370_10317095
603 Ga0157369_10055746
604 Ga0157369_10073170
605 Ga0157369_10191054
606 Ga0157369_10463302
607 Ga0157374_10045196
608 Ga0157378_10003109
609 Ga0157378_10240146
610 Ga0157378_10616510
611 Ga0163162_10001773
612 Ga0163162_11017049
613 Ga0157372_10007106
614 Ga0157372_10053364
615 Ga0157372_10636320
616 Ga0157375_10248036
617 Ga0157375_11002217
618 Ga0163163_10031458
619 Ga0163163_10046684
620 Ga0163163_10258357
621 Ga0163163_10396354
622 Ga0157379_10198623
623 Ga0157376_10093445
624 Ga0157376_10115018
625 Ga0157376_10234232
626 Ga0157376_10267639
627 Ga0157376_10286421
628 Ga0206352_11271141
629 Ga0213876_10005447
630 Ga0213875_10000065
631 Ga0213875_10002442
632 Ga0213875_10020262
633 Ga0213875_10087512
634 Ga0207680_10220814
635 Ga0207654_10043718
636 Ga0207654_10079496
637 Ga0207654_10111344
638 Ga0207707_10064810
639 Ga0207707_10104285
640 Ga0207707_10153606
641 Ga0207707_10188301
642 Ga0207707_10275363
643 Ga0207695_10002549
644 Ga0207695_10005000
645 Ga0207695_10022166
646 Ga0207695_10051877
647 Ga0207695_10131226
648 Ga0207671_10004767
649 Ga0207671_10064703
650 Ga0207671_10101045
651 Ga0207660_10105592
652 Ga0207660_10283210
653 Ga0207660_10409753
654 Ga0207652_10100004
655 Ga0207652_10201040
656 Ga0207694_10001067
657 Ga0207694_10004825
658 Ga0207694_10012048
659 Ga0207694_10062187
660 Ga0207694_10644231
661 Ga0207687_10000964
662 Ga0207687_10006530
663 Ga0207687_10029031
664 Ga0207700_10380785
665 Ga0207686_10008604
666 Ga0207686_10024107
667 Ga0207686_10108868
668 Ga0207686_10161102
669 Ga0207670_10101842
670 Ga0207704_10044029
671 Ga0207704_10261723
672 Ga0207711_10001158
673 Ga0207711_10116674
674 Ga0207711_10121041
675 Ga0207711_10242170
676 Ga0207711_10265372
677 Ga0207711_10305742
678 Ga0207711_10522384
679 Ga0207689_10021053
680 Ga0207661_10000050
681 Ga0207661_10061745
682 Ga0207661_10112855
683 Ga0207661_10152368
684 Ga0207661_10238875
685 Ga0207661_10250721
686 Ga0207667_10001521
687 Ga0207667_10185647
688 Ga0207667_10206804
689 Ga0207658_10016232
690 Ga0207658_10365932
691 Ga0207677_10160175
692 Ga0207677_10513927
693 Ga0207703_10008554
694 Ga0207703_10056468
695 Ga0207703_10060336
696 Ga0207703_10099622
697 Ga0207703_10289188
698 Ga0207639_10084990
699 Ga0207639_10529644
700 Ga0207678_10108038
701 Ga0207702_10044568
702 Ga0207702_10139774
703 Ga0207702_10756722
704 Ga0207641_10036463
705 Ga0207641_10381927
706 Ga0207641_10542521
707 Ga0207676_10070246
708 Ga0207676_10577911
709 Ga0207674_10002017
710 Ga0207674_10005796
711 Ga0207674_10030744
712 Ga0207674_10076880
713 Ga0207683_10118633
714 Ga0207698_10006849
715 Ga0207698_10245585
716 Ga0268266_10017145
717 Ga0268266_10040880
718 Ga0268266_10095027
719 Ga0268266_10282020
720 Ga0268266_10407588
721 Ga0268264_10049981
722 Ga0268264_10242803
723 Ga0268264_10719624
724 Ga0265330_10116744
725 Ga0265332_10175093
726 Ga0265320_10015209
727 Ga0265329_10008054
728 Ga0265331_10026080
729 Ga0265331_10119899
730 Ga0265316_10003057
731 Ga0265316_10003280
732 Ga0265316_10035103
733 Ga0265316_10066947
734 Ga0265316_10069183
735 Ga0265314_10000978
736 Ga0265314_10004666
737 Ga0265314_10005160
738 Ga0265342_10218961
739 Ga0373934_0015860
740 Ga0373923_0073409
741 Ga0373953_0007945
742 Ga0373954_0012114
743 Ga0373954_0013338
744 Ga0373954_0085094
745 Ga0373956_0150307
746 Ga0373943_0041382
747 Ga0373935_0024852
748 Ga0373935_0145891
749 Ga0373935_0301278
750 Ga0373935_0400044
751 Ga0373927_0004677
752 Ga0373933_0009519
753 Ga0373947_0026333
754 Ga0373947_0114187
755 Ga0373947_0163016
756 Ga0373937_0003169
757 Ga0373937_0016750
758 Ga0373937_0118804
759 Ga0373937_0552399
760 Ga0373925_0284312
761 Ga0373925_0311776
762 Ga0395898_0509832
763 Ga0436364_0062214
764 Ga0436364_0065534
765 Ga0436364_0088421
766 Ga0436364_0213713
767 Ga0436364_0828992
768 Ga0436364_1077903
769 Ga0436364_1087136
770 Ga0436364_1193946
771 Ga0436364_1259051
772 Ga0436365_0366619
773 Ga0436360_0053971
774 Ga0436361_0878260
775 Ga0436363_0334082
776 Ga0436362_0583644
777 Ga0466960_0066342
778 Ga0451576_0027751
779 Ga0451576_0396508
780 Ga0466967_0720383
781 Ga0495592_0007040
782 Ga0495592_0109448
783 Ga0495629_0157676
784 Ga0495651_0031113
785 Ga0495580_0084347
786 Ga0495580_0105879
787 Ga0495580_0151091
788 Ga0495580_0188744
789 Ga0495582_0016829
790 Ga0495664_0082755
791 Ga0495664_0139291
792 Ga0495594_0026522
793 Ga0495608_0072123
794 Ga0495608_0079868
795 Ga0495618_0100998
796 Ga0495618_0341942
797 Ga0495628_0098725
798 Ga0495628_0374757
799 Ga0495630_0155278
800 Ga0495666_0217476
801 Ga0495652_0030971
802 Ga0495652_0046697
803 Ga0495652_0364863
804 Ga0495652_0387721
805 Ga0495665_0074387
806 Ga0495665_0194559
807 Ga0495665_0258305
808 Ga0495640_0087098
809 Ga0495640_0305155
810 Ga0495587_0005431
811 Ga0495587_0077004
812 Ga0495587_0105951
813 Ga0495645_0048604
814 Ga0495645_0122886
815 Ga0495645_0186388
816 Ga0495645_0238921
817 Ga0495645_0337409
818 Ga0495667_0102390
819 Ga0495667_0221682
820 Ga0495667_0280662
821 Ga0495635_0057210
822 Ga0495635_0482859
823 Ga0495599_0064694
824 Ga0495599_0227567
825 Ga0495623_0035007
826 Ga0495623_0182030
827 Ga0495646_0204802
828 Ga0495658_0033024
829 Ga0495613_0104718
830 Ga0495613_0135908
831 Ga0495613_0295908
832 Ga0495604_0055215
833 Ga0495604_0064805
834 Ga0495674_0037961
835 Ga0495674_0045019
836 Ga0495674_0047652
837 Ga0495674_0138677
838 Ga0495674_0590893
839 Ga0495680_0018201
840 Ga0495680_0059864
841 Ga0495680_0230524
842 Ga0495675_0048067
843 Ga0495675_0154678
844 Ga0495675_0183662
845 Ga0495675_0224897
846 Ga0495684_0001189
847 Ga0495684_0022645
848 Ga0495684_0058372
849 Ga0495684_0065617
850 Ga0495684_0093065
851 Ga0495602_0019096
852 Ga0495602_0133184
853 Ga0495602_0209404
854 Ga0496115_0064442
855 Ga0501031_0018959
856 Ga0501032_0000753
857 Ga0501034_0074125
858 Ga0501036_0000903
859 Ga0501037_0006095
860 Ga0501038_0018082
861 Ga0501039_0002253
862 Ga0501043_0006128
863 Ga0501043_0394501
864 Ga0501046_0001219
865 Ga0501046_0019596
866 Ga0501047_0032430
867 Ga0501047_0091136
868 Ga0501048_0034899
869 Ga0501048_0452669
870 Ga0501067_0000509
871 Ga0501068_0000678
872 Ga0501069_0009649
873 Ga0501070_0010550
874 Ga0501070_0014085
875 Ga0501070_0109336
876 Ga0501072_0001402
877 Ga0501073_0000471
878 Ga0501074_0057430
879 Ga0501077_0048496
880 Ga0501079_0007513
881 Ga0501080_0000006
882 Ga0501080_0080525
883 Ga0501083_0012241
884 Ga0501035_0011422
885 Ga0501035_0107971
886 Ga0501044_0001294
887 Ga0501044_0007259
888 Ga0501044_0025330
889 Ga0501044_0026136
890 Ga0495595_0162434
891 Ga0500568_0000602
892 Ga0501082_0000180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01695

IstB_IS21

IstB-like ATP binding protein

54

208

0.87

PF07728

AAA_5

AAA domain (dynein-related subfamily)

96

212

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ec2-assembly1.cif.gz_A crystal structure of the dnac helicase loader 0.8541 46 241
3ec2-assembly1.cif.gz_A crystal structure of the dnac helicase loader 0.8506 46 241
6qel-assembly1.cif.gz_H e. coli dnabc apo complex 0.8481 32 242
6qem-assembly1.cif.gz_I e. coli dnabc complex bound to ssdna 0.8331 30 243
1l8q-assembly1.cif.gz_A crystal structure of dna replication initiation factor 0.8282 44 240
ID Description Score Start End Superfamily
3ec2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8576 69 239 3.40.50.300
5bq5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8341 75 240 3.40.50.300
af_P77546_50_225_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8327 34 231 3.40.50.300
3ec2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8321 69 239 3.40.50.300
af_Q2FWR4_66_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8215 35 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A023WZY9-F1-model_v4 DNA replication protein 0.9216 29 247 GO:0005524
GO:0006260
GO:0016887
AF-A0A2V8QYE6-F1-model_v4 DNA replication protein DnaC 0.9119 48 247 GO:0005524
GO:0006260
AF-G5HGS5-F1-model_v4 IstB-like ATP-binding domain-containing protein 0.9106 32 247 GO:0005524
GO:0006260
AF-A0A4R3N379-F1-model_v4 DNA replication protein DnaC 0.9078 26 241 GO:0005524
GO:0006260
AF-A0A2N0KFE5-F1-model_v4 IstB-like ATP-binding domain-containing protein 0.907 92 251 GO:0005524
GO:0006260

Map