F445674

General Info

Members Datasets Scaffolds Average Seq Length
446 213 892 257

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100061703|Ga0070672_1000617032
Length 308
Sequence MLRLGRWRWTSVSRWQLSGCSAALQTSAVVGVDSGEGIMLAMRRMSVLLMALAVVVATTVQVSAQWFKYPTPGVPRTASGAVDVKAPALSGVWLASNPLPCPPLLRDGDDCQEKTPLSAWAYHIDAGLPGGLPYQPWAAAIVKQRGDDNSQDDPHVKCLPSNPPRAYTLPHYQKIVQTPRFIVMLHEFNASYRQIFTDGRPLPVDPQPSWTGYSTGQWEGDTLVVHTNGLRDGLWLDVAGDPLTDAAKLTERIQRPNFGTLSVDFTVDDPKAYTRPWTVHIEQTFIADEDLIDEICLEGARPLHVAPK

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 31.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100061703 3300005543 Bacteria 2956
2 JGI24746J21847_1008478 3300001977 Unclassified 1549
3 JGI25406J46586_10000340 3300003203 Bacteria 21105
4 JGI25406J46586_10001805 3300003203 Bacteria 10049
5 Ga0065712_10032079 3300005290 Bacteria 1492
6 Ga0065707_10127180 3300005295 Bacteria 1982
7 Ga0065707_10342587 3300005295 Unclassified 931
8 Ga0070658_10322469 3300005327 Unclassified 1319
9 Ga0070676_10233316 3300005328 Unclassified 1220
10 Ga0070683_100006964 3300005329 Bacteria 9509
11 Ga0070683_100008588 3300005329 Bacteria 8683
12 Ga0070683_100015153 3300005329 Bacteria 6767
13 Ga0070683_100068221 3300005329 Bacteria 3313
14 Ga0070683_100070412 3300005329 Unclassified 3262
15 Ga0070683_100122318 3300005329 Unclassified 2459
16 Ga0070690_100021997 3300005330 Bacteria 3899
17 Ga0070670_100011979 3300005331 Bacteria 7418
18 Ga0070670_100440875 3300005331 Bacteria 1153
19 Ga0070677_10004125 3300005333 Unclassified 4716
20 Ga0070677_10099749 3300005333 Bacteria 1278
21 Ga0068869_100026210 3300005334 Bacteria 4055
22 Ga0068869_100062210 3300005334 Bacteria 2739
23 Ga0070666_10095397 3300005335 Unclassified 2047
24 Ga0070666_10096003 3300005335 Bacteria 2040
25 Ga0070680_100016547 3300005336 Bacteria 5803
26 Ga0070682_100062811 3300005337 Unclassified 2353
27 Ga0068868_100012427 3300005338 Bacteria 6224
28 Ga0070660_100016538 3300005339 Bacteria 5356
29 Ga0070689_100207728 3300005340 Bacteria 1601
30 Ga0070691_10016359 3300005341 Unclassified 3406
31 Ga0070687_100192326 3300005343 Bacteria 1230
32 Ga0070687_100215925 3300005343 Unclassified 1171
33 Ga0070661_100031363 3300005344 Bacteria 3843
34 Ga0070661_100480314 3300005344 Bacteria 992
35 Ga0070692_10018725 3300005345 Bacteria 3333
36 Ga0070669_100012839 3300005353 Bacteria 5948
37 Ga0070669_100150401 3300005353 Unclassified 1802
38 Ga0070675_100001149 3300005354 Bacteria 19118
39 Ga0070675_100008035 3300005354 Bacteria 8180
40 Ga0070671_100000934 3300005355 Bacteria 21382
41 Ga0070671_100446078 3300005355 Unclassified 1110
42 Ga0070674_100078905 3300005356 Bacteria 2347
43 Ga0070674_100121001 3300005356 Bacteria 1938
44 Ga0070674_100154997 3300005356 Unclassified 1732
45 Ga0070673_100022447 3300005364 Bacteria 4593
46 Ga0070673_100069816 3300005364 Bacteria 2817
47 Ga0070673_100095775 3300005364 Bacteria 2435
48 Ga0070688_100183867 3300005365 Unclassified 1451
49 Ga0070659_100132853 3300005366 Unclassified 2022
50 Ga0070659_100346530 3300005366 Unclassified 1246
51 Ga0070667_100038624 3300005367 Unclassified 4002
52 Ga0070667_100121461 3300005367 Unclassified 2272
53 Ga0070709_10010472 3300005434 Bacteria 5139
54 Ga0070714_100637599 3300005435 Bacteria 1025
55 Ga0070713_100015081 3300005436 Bacteria 5759
56 Ga0070713_100052522 3300005436 Bacteria 3374
57 Ga0070713_100096313 3300005436 Bacteria 2555
58 Ga0070713_100179889 3300005436 Unclassified 1899
59 Ga0070701_10004759 3300005438 Bacteria 5544
60 Ga0070700_100055715 3300005441 Bacteria 2475
61 Ga0070700_100077298 3300005441 Bacteria 2140
62 Ga0070708_100207408 3300005445 Bacteria 1836
63 Ga0070678_100214334 3300005456 Unclassified 1597
64 Ga0070662_100043370 3300005457 Unclassified 3218
65 Ga0070662_100094912 3300005457 Bacteria 2247
66 Ga0070681_10044709 3300005458 Unclassified 4433
67 Ga0070681_10232654 3300005458 Unclassified 1757
68 Ga0070681_10236536 3300005458 Bacteria 1740
69 Ga0070681_10510927 3300005458 Unclassified 1115
70 Ga0070707_100086743 3300005468 Bacteria 3027
71 Ga0070707_100324805 3300005468 Unclassified 1495
72 Ga0070698_100025548 3300005471 Bacteria 6156
73 Ga0070698_100045138 3300005471 Bacteria 4511
74 Ga0070699_100248608 3300005518 Unclassified 1588
75 Ga0070699_100502748 3300005518 Bacteria 1101
76 Ga0070679_100003970 3300005530 Bacteria 13624
77 Ga0070679_100148790 3300005530 Bacteria 2319
78 Ga0070679_100183074 3300005530 Bacteria 2067
79 Ga0070684_100003181 3300005535 Bacteria 12278
80 Ga0070684_100778298 3300005535 Unclassified 894
81 Ga0068853_100057631 3300005539 Bacteria 3353
82 Ga0068853_100128065 3300005539 Bacteria 2269
83 Ga0068853_100210929 3300005539 Unclassified 1770
84 Ga0068853_100518145 3300005539 Bacteria 1127
85 Ga0070672_100040855 3300005543 Bacteria 3562
86 Ga0070672_100099389 3300005543 Bacteria 2358
87 Ga0070672_100134382 3300005543 Bacteria 2036
88 Ga0070672_100231726 3300005543 Unclassified 1552
89 Ga0070695_100217936 3300005545 Unclassified 1373
90 Ga0070695_100262411 3300005545 Bacteria 1262
91 Ga0070665_100358663 3300005548 Unclassified 1464
92 Ga0070665_100372987 3300005548 Bacteria 1434
93 Ga0068855_100001207 3300005563 Bacteria 32106
94 Ga0068855_100028997 3300005563 Bacteria 6620
95 Ga0068855_100055147 3300005563 Unclassified 4669
96 Ga0068855_100088154 3300005563 Bacteria 3584
97 Ga0068855_100538200 3300005563 Unclassified 1266
98 Ga0070664_100035832 3300005564 Bacteria 4167
99 Ga0070664_100075400 3300005564 Unclassified 2896
100 Ga0070664_100111919 3300005564 Bacteria 2383
101 Ga0070664_100290882 3300005564 Bacteria 1475
102 Ga0068857_100001525 3300005577 Bacteria 18503
103 Ga0068857_100018434 3300005577 Bacteria 6123
104 Ga0068857_100053777 3300005577 Unclassified 3572
105 Ga0068857_100063252 3300005577 Bacteria 3289
106 Ga0068857_100104339 3300005577 Bacteria 2545
107 Ga0068856_100001953 3300005614 Bacteria 21469
108 Ga0068856_100082280 3300005614 Bacteria 3195
109 Ga0068856_100124071 3300005614 Bacteria 2585
110 Ga0068856_100310402 3300005614 Unclassified 1595
111 Ga0070702_100137348 3300005615 Unclassified 1553
112 Ga0070702_100176899 3300005615 Unclassified 1393
113 Ga0068852_100009023 3300005616 Bacteria 7379
114 Ga0068859_100130945 3300005617 Unclassified 2580
115 Ga0068864_100023906 3300005618 Bacteria 5136
116 Ga0068864_100215928 3300005618 Bacteria 1768
117 Ga0068866_10170882 3300005718 Unclassified 1276
118 Ga0068861_100010093 3300005719 Bacteria 6546
119 Ga0068863_100084907 3300005841 Unclassified 3000
120 Ga0068863_100148172 3300005841 Unclassified 2245
121 Ga0068863_100479002 3300005841 Unclassified 1223
122 Ga0068858_100027037 3300005842 Bacteria 5329
123 Ga0068858_100034600 3300005842 Bacteria 4686
124 Ga0068858_100097103 3300005842 Unclassified 2746
125 Ga0068858_100115754 3300005842 Unclassified 2505
126 Ga0068858_100383570 3300005842 Bacteria 1349
127 Ga0068860_100477273 3300005843 Unclassified 1243
128 Ga0068862_100053746 3300005844 Unclassified 3448
129 Ga0068862_100076151 3300005844 Bacteria 2903
130 Ga0081539_10000013 3300005985 Bacteria 432395
131 Ga0081539_10000106 3300005985 Bacteria 195771
132 Ga0097621_100018370 3300006237 Bacteria 5338
133 Ga0097621_100083392 3300006237 Unclassified 2663
134 Ga0097621_100117238 3300006237 Unclassified 2256
135 Ga0068871_100058199 3300006358 Unclassified 3146
136 Ga0068871_100145430 3300006358 Unclassified 2018
137 Ga0068871_100232877 3300006358 Unclassified 1599
138 Ga0068871_100387412 3300006358 Bacteria 1243
139 Ga0068871_100416365 3300006358 Unclassified 1199
140 Ga0075428_100002439 3300006844 Bacteria 20204
141 Ga0075428_100065266 3300006844 Bacteria 3986
142 Ga0075428_100244606 3300006844 Bacteria 1935
143 Ga0075431_100153543 3300006847 Bacteria 2370
144 Ga0075433_10074292 3300006852 Bacteria 2991
145 Ga0075433_10196575 3300006852 Bacteria 1794
146 Ga0075434_100019270 3300006871 Bacteria 6600
147 Ga0075429_100028022 3300006880 Bacteria 4889
148 Ga0075429_100080396 3300006880 Bacteria 2842
149 Ga0075429_100381955 3300006880 Unclassified 1233
150 Ga0068865_100003436 3300006881 Bacteria 9482
151 Ga0097620_100130948 3300006931 Unclassified 2580
152 Ga0075435_100035819 3300007076 Bacteria 3940
153 Ga0075435_100269164 3300007076 Bacteria 1453
154 Ga0075435_100326544 3300007076 Unclassified 1314
155 Ga0105240_10031634 3300009093 Bacteria 6858
156 Ga0105240_10036560 3300009093 Bacteria 6314
157 Ga0105240_10121167 3300009093 Bacteria 3149
158 Ga0105240_10186027 3300009093 Bacteria 2446
159 Ga0105240_10275015 3300009093 Bacteria 1937
160 Ga0111539_10214768 3300009094 Bacteria 2241
161 Ga0105245_10001528 3300009098 Bacteria 20966
162 Ga0105245_10003347 3300009098 Bacteria 14383
163 Ga0105245_10074991 3300009098 Unclassified 3079
164 Ga0105245_10095330 3300009098 Bacteria 2745
165 Ga0105245_10208750 3300009098 Unclassified 1879
166 Ga0105245_10241222 3300009098 Unclassified 1752
167 Ga0105247_10244794 3300009101 Bacteria 1223
168 Ga0114129_10012468 3300009147 Bacteria 12101
169 Ga0114129_10016753 3300009147 Bacteria 10434
170 Ga0114129_10094374 3300009147 Bacteria 4143
171 Ga0114129_10138629 3300009147 Bacteria 3336
172 Ga0114129_10641837 3300009147 Bacteria 1371
173 Ga0114129_10734442 3300009147 Bacteria 1265
174 Ga0105243_10029294 3300009148 Bacteria 4233
175 Ga0105243_10072997 3300009148 Unclassified 2779
176 Ga0105243_10075448 3300009148 Bacteria 2737
177 Ga0105241_10024073 3300009174 Unclassified 4522
178 Ga0105241_10104376 3300009174 Bacteria 2258
179 Ga0105241_10130191 3300009174 Bacteria 2036
180 Ga0105241_10403772 3300009174 Unclassified 1199
181 Ga0105242_10022789 3300009176 Bacteria 4930
182 Ga0105242_10034049 3300009176 Bacteria 4083
183 Ga0105242_10612310 3300009176 Unclassified 1053
184 Ga0105248_10032727 3300009177 Bacteria 5808
185 Ga0105248_10059365 3300009177 Bacteria 4296
186 Ga0105248_10130219 3300009177 Bacteria 2838
187 Ga0105248_10257175 3300009177 Unclassified 1966
188 Ga0105237_10172990 3300009545 Unclassified 2160
189 Ga0105238_10013626 3300009551 Bacteria 8212
190 Ga0105238_10048503 3300009551 Bacteria 4280
191 Ga0105238_10055656 3300009551 Bacteria 3970
192 Ga0105238_10155109 3300009551 Unclassified 2265
193 Ga0105238_10156436 3300009551 Unclassified 2254
194 Ga0105249_10033812 3300009553 Bacteria 4631
195 Ga0105249_10093782 3300009553 Bacteria 2813
196 Ga0105249_10683061 3300009553 Unclassified 1086
197 Ga0105249_10697294 3300009553 Bacteria 1075
198 Ga0105239_10005326 3300010375 Bacteria 15096
199 Ga0105239_10055736 3300010375 Bacteria 4335
200 Ga0105239_10117519 3300010375 Bacteria 2951
201 Ga0105246_10154524 3300011119 Bacteria 1741
202 Ga0105246_10287342 3300011119 Unclassified 1322
203 Ga0105246_10455473 3300011119 Unclassified 1076
204 Ga0157318_1002049 3300012482 Unclassified 1065
205 Ga0157371_10060528 3300013102 Unclassified 2685
206 Ga0157370_10009621 3300013104 Bacteria 10289
207 Ga0157370_10174556 3300013104 Unclassified 1997
208 Ga0157369_10004817 3300013105 Bacteria 15848
209 Ga0157369_10194986 3300013105 Unclassified 2127
210 Ga0157369_10338498 3300013105 Bacteria 1563
211 Ga0157374_10150749 3300013296 Bacteria 2261
212 Ga0157374_10216699 3300013296 Bacteria 1878
213 Ga0157374_10233639 3300013296 Unclassified 1807
214 Ga0157378_10007676 3300013297 Bacteria 9414
215 Ga0157378_10213216 3300013297 Bacteria 1832
216 Ga0157378_10725044 3300013297 Unclassified 1015
217 Ga0163162_10002455 3300013306 Bacteria 17496
218 Ga0163162_10034293 3300013306 Bacteria 5050
219 Ga0157372_10012000 3300013307 Bacteria 9226
220 Ga0157372_10012073 3300013307 Bacteria 9200
221 Ga0157372_10046001 3300013307 Bacteria 4843
222 Ga0157372_10107572 3300013307 Bacteria 3191
223 Ga0157372_10121653 3300013307 Bacteria 2999
224 Ga0157372_10268761 3300013307 Bacteria 1981
225 Ga0157375_10058114 3300013308 Unclassified 3826
226 Ga0163163_10009028 3300014325 Bacteria 8883
227 Ga0163163_10034358 3300014325 Unclassified 4909
228 Ga0163163_10073211 3300014325 Unclassified 3416
229 Ga0163163_10353809 3300014325 Bacteria 1525
230 Ga0157380_10004550 3300014326 Bacteria 9625
231 Ga0157380_10064036 3300014326 Bacteria 2950
232 Ga0157380_10282840 3300014326 Bacteria 1519
233 Ga0157377_10029222 3300014745 Bacteria 2974
234 Ga0157377_10036381 3300014745 Unclassified 2708
235 Ga0157379_10085355 3300014968 Unclassified 2829
236 Ga0157379_10200667 3300014968 Bacteria 1804
237 Ga0157376_10040136 3300014969 Unclassified 3824
238 Ga0157376_10152925 3300014969 Unclassified 2083
239 Ga0157376_10189081 3300014969 Bacteria 1887
240 Ga0157376_10333643 3300014969 Unclassified 1446
241 Ga0207697_10028895 3300025315 Bacteria 2268
242 Ga0207682_10014155 3300025893 Bacteria 3109
243 Ga0207688_10015677 3300025901 Bacteria 4110
244 Ga0207680_10045562 3300025903 Unclassified 2586
245 Ga0207699_10105528 3300025906 Bacteria 1796
246 Ga0207699_10136714 3300025906 Unclassified 1606
247 Ga0207645_10036431 3300025907 Bacteria 3158
248 Ga0207643_10352853 3300025908 Unclassified 924
249 Ga0207654_10011563 3300025911 Bacteria 4503
250 Ga0207654_10088193 3300025911 Unclassified 1884
251 Ga0207654_10306526 3300025911 Bacteria 1081
252 Ga0207707_10001442 3300025912 Bacteria 21981
253 Ga0207707_10371454 3300025912 Unclassified 1230
254 Ga0207695_10003161 3300025913 Bacteria 23484
255 Ga0207695_10037226 3300025913 Bacteria 5251
256 Ga0207695_10202186 3300025913 Bacteria 1900
257 Ga0207671_10015015 3300025914 Bacteria 6088
258 Ga0207671_10263658 3300025914 Bacteria 1356
259 Ga0207663_10117378 3300025916 Unclassified 1816
260 Ga0207660_10060671 3300025917 Unclassified 2720
261 Ga0207662_10029182 3300025918 Bacteria 3194
262 Ga0207657_10079800 3300025919 Bacteria 2752
263 Ga0207649_10299217 3300025920 Bacteria 1176
264 Ga0207652_10010387 3300025921 Bacteria 7496
265 Ga0207652_10226404 3300025921 Bacteria 1685
266 Ga0207646_10073876 3300025922 Bacteria 3046
267 Ga0207646_10244068 3300025922 Unclassified 1622
268 Ga0207681_10070105 3300025923 Bacteria 2440
269 Ga0207681_10175642 3300025923 Bacteria 1627
270 Ga0207694_10007352 3300025924 Bacteria 8353
271 Ga0207694_10011174 3300025924 Bacteria 6777
272 Ga0207694_10015329 3300025924 Bacteria 5783
273 Ga0207694_10022173 3300025924 Bacteria 4815
274 Ga0207694_10044768 3300025924 Bacteria 3417
275 Ga0207650_10132132 3300025925 Bacteria 1954
276 Ga0207659_10000263 3300025926 Bacteria 32122
277 Ga0207659_10007036 3300025926 Bacteria 6907
278 Ga0207659_10065549 3300025926 Unclassified 2632
279 Ga0207659_10102772 3300025926 Unclassified 2158
280 Ga0207659_10262988 3300025926 Bacteria 1404
281 Ga0207687_10003356 3300025927 Bacteria 10819
282 Ga0207687_10004585 3300025927 Bacteria 9194
283 Ga0207687_10005715 3300025927 Bacteria 8228
284 Ga0207687_10007239 3300025927 Bacteria 7320
285 Ga0207687_10017237 3300025927 Unclassified 4752
286 Ga0207687_10130526 3300025927 Bacteria 1893
287 Ga0207687_10183293 3300025927 Unclassified 1624
288 Ga0207700_10053153 3300025928 Unclassified 3033
289 Ga0207700_10054321 3300025928 Bacteria 3006
290 Ga0207644_10038221 3300025931 Bacteria 3380
291 Ga0207644_10496648 3300025931 Unclassified 1006
292 Ga0207690_10050624 3300025932 Bacteria 2774
293 Ga0207706_10015079 3300025933 Bacteria 6995
294 Ga0207706_10080360 3300025933 Bacteria 2867
295 Ga0207686_10005479 3300025934 Bacteria 6812
296 Ga0207686_10007798 3300025934 Bacteria 5771
297 Ga0207686_10052986 3300025934 Bacteria 2535
298 Ga0207709_10014945 3300025935 Bacteria 4296
299 Ga0207704_10006773 3300025938 Bacteria 5368
300 Ga0207704_10111347 3300025938 Unclassified 1851
301 Ga0207691_10074193 3300025940 Unclassified 3068
302 Ga0207711_10001453 3300025941 Bacteria 22141
303 Ga0207711_10079466 3300025941 Bacteria 2863
304 Ga0207711_10135905 3300025941 Unclassified 2208
305 Ga0207711_10166324 3300025941 Bacteria 1999
306 Ga0207689_10003130 3300025942 Bacteria 15183
307 Ga0207689_10467375 3300025942 Unclassified 1055
308 Ga0207661_10004163 3300025944 Bacteria 10120
309 Ga0207661_10005775 3300025944 Bacteria 8725
310 Ga0207661_10019060 3300025944 Bacteria 5107
311 Ga0207661_10032801 3300025944 Bacteria 4027
312 Ga0207679_10006661 3300025945 Bacteria 7314
313 Ga0207679_10064211 3300025945 Unclassified 2743
314 Ga0207667_10005190 3300025949 Bacteria 15905
315 Ga0207667_10011243 3300025949 Bacteria 10412
316 Ga0207667_10036346 3300025949 Bacteria 5279
317 Ga0207667_10061261 3300025949 Bacteria 3936
318 Ga0207651_10083282 3300025960 Unclassified 2312
319 Ga0207651_10557464 3300025960 Unclassified 997
320 Ga0207712_10024284 3300025961 Bacteria 4012
321 Ga0207712_10070311 3300025961 Bacteria 2514
322 Ga0207640_10361525 3300025981 Unclassified 1170
323 Ga0207677_10187092 3300026023 Unclassified 1634
324 Ga0207677_10274580 3300026023 Bacteria 1381
325 Ga0207703_10104336 3300026035 Unclassified 2408
326 Ga0207703_10291597 3300026035 Bacteria 1485
327 Ga0207639_10053635 3300026041 Bacteria 3077
328 Ga0207639_10070006 3300026041 Bacteria 2739
329 Ga0207678_10121405 3300026067 Unclassified 2230
330 Ga0207708_10065629 3300026075 Bacteria 2775
331 Ga0207708_10135464 3300026075 Bacteria 1929
332 Ga0207702_10007696 3300026078 Bacteria 9153
333 Ga0207702_10080092 3300026078 Bacteria 2833
334 Ga0207702_10125859 3300026078 Unclassified 2300
335 Ga0207702_10234955 3300026078 Unclassified 1715
336 Ga0207702_10271368 3300026078 Unclassified 1600
337 Ga0207641_10041698 3300026088 Unclassified 3847
338 Ga0207641_10136526 3300026088 Bacteria 2208
339 Ga0207641_10276043 3300026088 Unclassified 1579
340 Ga0207641_10282654 3300026088 Unclassified 1561
341 Ga0207648_10000358 3300026089 Bacteria 50234
342 Ga0207648_10017353 3300026089 Bacteria 6554
343 Ga0207648_10154344 3300026089 Bacteria 2026
344 Ga0207676_10021085 3300026095 Bacteria 4777
345 Ga0207676_10216182 3300026095 Bacteria 1704
346 Ga0207674_10000493 3300026116 Bacteria 51995
347 Ga0207674_10018075 3300026116 Bacteria 7678
348 Ga0207674_10025432 3300026116 Bacteria 6313
349 Ga0207674_10028486 3300026116 Bacteria 5896
350 Ga0207674_10177314 3300026116 Bacteria 2084
351 Ga0207675_100047217 3300026118 Bacteria 4021
352 Ga0207675_100060394 3300026118 Bacteria 3539
353 Ga0207698_10055873 3300026142 Unclassified 3045
354 Ga0207698_10147802 3300026142 Bacteria 2035
355 Ga0207428_10029592 3300027907 Bacteria 4537
356 Ga0207428_10045586 3300027907 Bacteria 3530
357 Ga0268264_10011130 3300028381 Bacteria 7432
358 Ga0268264_10065378 3300028381 Unclassified 3064
359 Ga0268264_10080538 3300028381 Unclassified 2781
360 Ga0265338_10219050 3300028800 Unclassified 1423
361 Ga0265340_10064321 3300031247 Bacteria 1749
362 Ga0265313_10025405 3300031595 Bacteria 3140
363 Ga0265314_10000941 3300031711 Bacteria 34248
364 Ga0265314_10003877 3300031711 Bacteria 14238
365 Ga0373934_0000438 3300035086 Bacteria 14494
366 Ga0373944_0012464 3300035089 Bacteria 2344
367 Ga0373952_0042602 3300035092 Unclassified 1055
368 Ga0373939_0022769 3300035114 Bacteria 1729
369 Ga0373953_0116876 3300035117 Bacteria 1131
370 Ga0373954_0007717 3300035118 Unclassified 4708
371 Ga0373954_0026690 3300035118 Unclassified 2648
372 Ga0373954_0143061 3300035118 Unclassified 1167
373 Ga0373943_0014296 3300035170 Bacteria 3592
374 Ga0373943_0052687 3300035170 Unclassified 2007
375 Ga0373955_0021558 3300035172 Unclassified 3255
376 Ga0373955_0047750 3300035172 Bacteria 2319
377 Ga0373924_0013214 3300035410 Bacteria 3099
378 Ga0373924_0087125 3300035410 Bacteria 1333
379 Ga0373931_0175083 3300035691 Unclassified 1267
380 Ga0373933_0218182 3300035724 Bacteria 1223
381 Ga0373933_0297057 3300035724 Bacteria 1045
382 Ga0373947_0033766 3300035725 Bacteria 3023
383 Ga0373937_0001151 3300036401 Bacteria 22158
384 Ga0373937_0021744 3300036401 Bacteria 5758
385 Ga0373937_0334602 3300036401 Bacteria 1433
386 Ga0373925_0001175 3300037068 Bacteria 23154
387 Ga0373925_0030418 3300037068 Bacteria 3963
388 Ga0373925_0275594 3300037068 Unclassified 1354
389 Ga0451853_0086401 3300041512 Unclassified 1779
390 Ga0450890_014559 3300042127 Unclassified 1031
391 Ga0495592_0135284 3300046454 Bacteria 1720
392 Ga0495603_0039195 3300046455 Bacteria 2840
393 Ga0495580_0102374 3300046472 Unclassified 1991
394 Ga0495580_0363023 3300046472 Bacteria 980
395 Ga0495582_0044802 3300046473 Bacteria 2436
396 Ga0495594_0018341 3300046499 Unclassified 3705
397 Ga0495608_0055355 3300046511 Bacteria 2621
398 Ga0495628_0192535 3300046516 Bacteria 1539
399 Ga0495630_0007788 3300046517 Bacteria 7669
400 Ga0495652_0032986 3300046529 Bacteria 4525
401 Ga0495665_0091402 3300046531 Bacteria 1599
402 Ga0495586_0021864 3300046535 Bacteria 3414
403 Ga0495586_0293103 3300046535 Bacteria 932
404 Ga0495587_0021666 3300046536 Unclassified 3965
405 Ga0495587_0054158 3300046536 Bacteria 2364
406 Ga0495587_0257677 3300046536 Bacteria 980
407 Ga0495598_0014913 3300046537 Unclassified 1951
408 Ga0495621_0152168 3300046539 Unclassified 911
409 Ga0495645_0040697 3300046543 Unclassified 3390
410 Ga0495667_0017384 3300046559 Bacteria 4857
411 Ga0495667_0050134 3300046559 Bacteria 2756
412 Ga0495656_0063981 3300046615 Unclassified 1614
413 Ga0495634_0013331 3300046642 Bacteria 5941
414 Ga0495599_0003394 3300046678 Bacteria 9317
415 Ga0495599_0381721 3300046678 Unclassified 841
416 Ga0495623_0315063 3300046679 Bacteria 860
417 Ga0495658_0076538 3300046683 Bacteria 1956
418 Ga0495613_0006330 3300046689 Bacteria 8855
419 Ga0495604_0013980 3300047317 Bacteria 6402
420 Ga0495674_0149510 3300047319 Bacteria 1959
421 Ga0495674_0199304 3300047319 Bacteria 1661
422 Ga0495675_0098801 3300047444 Bacteria 1828
423 Ga0495684_0000781 3300047471 Bacteria 25805
424 Ga0495602_0004852 3300048088 Bacteria 14080
425 Ga0496109_0570962 3300048912 Unclassified 1066
426 Ga0496112_0216590 3300048915 Bacteria 1871
427 Ga0496114_0761577 3300048917 Unclassified 846
428 Ga0501298_023369 3300049521 Unclassified 1171
429 nmdc:mga05p37_175656_c1 3300050507 Bacteria 2610
430 nmdc:mga05p37_280262_c1 3300050507 Bacteria 1988
431 nmdc:mga05p37_339212_c1 3300050507 Bacteria 1773
432 nmdc:mga05p37_41499_c1 3300050507 Bacteria 5649
433 nmdc:mga05p37_88800_c1 3300050507 Unclassified 3810
434 nmdc:mga09592_243110_c1 3300050508 Bacteria 1560
435 nmdc:mga09592_74103_c1 3300050508 Bacteria 2893
436 nmdc:mga0qj67_54139_c1 3300050509 Bacteria 3177
437 nmdc:mga0qj67_71040_c1 3300050509 Bacteria 2778
438 nmdc:mga08y16_124476_c1 3300050511 Bacteria 2682
439 nmdc:mga08y16_45827_c1 3300050511 Bacteria 4581
440 nmdc:mga0n895_14563_c1 3300050512 Bacteria 7147
441 nmdc:mga0n895_225801_c1 3300050512 Bacteria 1901
442 nmdc:mga0rr50_205819_c1 3300050513 Bacteria 1619
443 nmdc:mga0a205_28244_c1 3300050515 Bacteria 5363
444 nmdc:mga0a205_515295_c1 3300050515 Bacteria 1053
445 Ga0495595_0122732 3300053084 Bacteria 1266
446 Ga0495619_0001596 3300053085 Bacteria 14893
447 Ga0070672_100061703
448 JGI24746J21847_1008478
449 JGI25406J46586_10000340
450 JGI25406J46586_10001805
451 Ga0065712_10032079
452 Ga0065707_10127180
453 Ga0065707_10342587
454 Ga0070658_10322469
455 Ga0070676_10233316
456 Ga0070683_100006964
457 Ga0070683_100008588
458 Ga0070683_100015153
459 Ga0070683_100068221
460 Ga0070683_100070412
461 Ga0070683_100122318
462 Ga0070690_100021997
463 Ga0070670_100011979
464 Ga0070670_100440875
465 Ga0070677_10004125
466 Ga0070677_10099749
467 Ga0068869_100026210
468 Ga0068869_100062210
469 Ga0070666_10095397
470 Ga0070666_10096003
471 Ga0070680_100016547
472 Ga0070682_100062811
473 Ga0068868_100012427
474 Ga0070660_100016538
475 Ga0070689_100207728
476 Ga0070691_10016359
477 Ga0070687_100192326
478 Ga0070687_100215925
479 Ga0070661_100031363
480 Ga0070661_100480314
481 Ga0070692_10018725
482 Ga0070669_100012839
483 Ga0070669_100150401
484 Ga0070675_100001149
485 Ga0070675_100008035
486 Ga0070671_100000934
487 Ga0070671_100446078
488 Ga0070674_100078905
489 Ga0070674_100121001
490 Ga0070674_100154997
491 Ga0070673_100022447
492 Ga0070673_100069816
493 Ga0070673_100095775
494 Ga0070688_100183867
495 Ga0070659_100132853
496 Ga0070659_100346530
497 Ga0070667_100038624
498 Ga0070667_100121461
499 Ga0070709_10010472
500 Ga0070714_100637599
501 Ga0070713_100015081
502 Ga0070713_100052522
503 Ga0070713_100096313
504 Ga0070713_100179889
505 Ga0070701_10004759
506 Ga0070700_100055715
507 Ga0070700_100077298
508 Ga0070708_100207408
509 Ga0070678_100214334
510 Ga0070662_100043370
511 Ga0070662_100094912
512 Ga0070681_10044709
513 Ga0070681_10232654
514 Ga0070681_10236536
515 Ga0070681_10510927
516 Ga0070707_100086743
517 Ga0070707_100324805
518 Ga0070698_100025548
519 Ga0070698_100045138
520 Ga0070699_100248608
521 Ga0070699_100502748
522 Ga0070679_100003970
523 Ga0070679_100148790
524 Ga0070679_100183074
525 Ga0070684_100003181
526 Ga0070684_100778298
527 Ga0068853_100057631
528 Ga0068853_100128065
529 Ga0068853_100210929
530 Ga0068853_100518145
531 Ga0070672_100040855
532 Ga0070672_100099389
533 Ga0070672_100134382
534 Ga0070672_100231726
535 Ga0070695_100217936
536 Ga0070695_100262411
537 Ga0070665_100358663
538 Ga0070665_100372987
539 Ga0068855_100001207
540 Ga0068855_100028997
541 Ga0068855_100055147
542 Ga0068855_100088154
543 Ga0068855_100538200
544 Ga0070664_100035832
545 Ga0070664_100075400
546 Ga0070664_100111919
547 Ga0070664_100290882
548 Ga0068857_100001525
549 Ga0068857_100018434
550 Ga0068857_100053777
551 Ga0068857_100063252
552 Ga0068857_100104339
553 Ga0068856_100001953
554 Ga0068856_100082280
555 Ga0068856_100124071
556 Ga0068856_100310402
557 Ga0070702_100137348
558 Ga0070702_100176899
559 Ga0068852_100009023
560 Ga0068859_100130945
561 Ga0068864_100023906
562 Ga0068864_100215928
563 Ga0068866_10170882
564 Ga0068861_100010093
565 Ga0068863_100084907
566 Ga0068863_100148172
567 Ga0068863_100479002
568 Ga0068858_100027037
569 Ga0068858_100034600
570 Ga0068858_100097103
571 Ga0068858_100115754
572 Ga0068858_100383570
573 Ga0068860_100477273
574 Ga0068862_100053746
575 Ga0068862_100076151
576 Ga0081539_10000013
577 Ga0081539_10000106
578 Ga0097621_100018370
579 Ga0097621_100083392
580 Ga0097621_100117238
581 Ga0068871_100058199
582 Ga0068871_100145430
583 Ga0068871_100232877
584 Ga0068871_100387412
585 Ga0068871_100416365
586 Ga0075428_100002439
587 Ga0075428_100065266
588 Ga0075428_100244606
589 Ga0075431_100153543
590 Ga0075433_10074292
591 Ga0075433_10196575
592 Ga0075434_100019270
593 Ga0075429_100028022
594 Ga0075429_100080396
595 Ga0075429_100381955
596 Ga0068865_100003436
597 Ga0097620_100130948
598 Ga0075435_100035819
599 Ga0075435_100269164
600 Ga0075435_100326544
601 Ga0105240_10031634
602 Ga0105240_10036560
603 Ga0105240_10121167
604 Ga0105240_10186027
605 Ga0105240_10275015
606 Ga0111539_10214768
607 Ga0105245_10001528
608 Ga0105245_10003347
609 Ga0105245_10074991
610 Ga0105245_10095330
611 Ga0105245_10208750
612 Ga0105245_10241222
613 Ga0105247_10244794
614 Ga0114129_10012468
615 Ga0114129_10016753
616 Ga0114129_10094374
617 Ga0114129_10138629
618 Ga0114129_10641837
619 Ga0114129_10734442
620 Ga0105243_10029294
621 Ga0105243_10072997
622 Ga0105243_10075448
623 Ga0105241_10024073
624 Ga0105241_10104376
625 Ga0105241_10130191
626 Ga0105241_10403772
627 Ga0105242_10022789
628 Ga0105242_10034049
629 Ga0105242_10612310
630 Ga0105248_10032727
631 Ga0105248_10059365
632 Ga0105248_10130219
633 Ga0105248_10257175
634 Ga0105237_10172990
635 Ga0105238_10013626
636 Ga0105238_10048503
637 Ga0105238_10055656
638 Ga0105238_10155109
639 Ga0105238_10156436
640 Ga0105249_10033812
641 Ga0105249_10093782
642 Ga0105249_10683061
643 Ga0105249_10697294
644 Ga0105239_10005326
645 Ga0105239_10055736
646 Ga0105239_10117519
647 Ga0105246_10154524
648 Ga0105246_10287342
649 Ga0105246_10455473
650 Ga0157318_1002049
651 Ga0157371_10060528
652 Ga0157370_10009621
653 Ga0157370_10174556
654 Ga0157369_10004817
655 Ga0157369_10194986
656 Ga0157369_10338498
657 Ga0157374_10150749
658 Ga0157374_10216699
659 Ga0157374_10233639
660 Ga0157378_10007676
661 Ga0157378_10213216
662 Ga0157378_10725044
663 Ga0163162_10002455
664 Ga0163162_10034293
665 Ga0157372_10012000
666 Ga0157372_10012073
667 Ga0157372_10046001
668 Ga0157372_10107572
669 Ga0157372_10121653
670 Ga0157372_10268761
671 Ga0157375_10058114
672 Ga0163163_10009028
673 Ga0163163_10034358
674 Ga0163163_10073211
675 Ga0163163_10353809
676 Ga0157380_10004550
677 Ga0157380_10064036
678 Ga0157380_10282840
679 Ga0157377_10029222
680 Ga0157377_10036381
681 Ga0157379_10085355
682 Ga0157379_10200667
683 Ga0157376_10040136
684 Ga0157376_10152925
685 Ga0157376_10189081
686 Ga0157376_10333643
687 Ga0207697_10028895
688 Ga0207682_10014155
689 Ga0207688_10015677
690 Ga0207680_10045562
691 Ga0207699_10105528
692 Ga0207699_10136714
693 Ga0207645_10036431
694 Ga0207643_10352853
695 Ga0207654_10011563
696 Ga0207654_10088193
697 Ga0207654_10306526
698 Ga0207707_10001442
699 Ga0207707_10371454
700 Ga0207695_10003161
701 Ga0207695_10037226
702 Ga0207695_10202186
703 Ga0207671_10015015
704 Ga0207671_10263658
705 Ga0207663_10117378
706 Ga0207660_10060671
707 Ga0207662_10029182
708 Ga0207657_10079800
709 Ga0207649_10299217
710 Ga0207652_10010387
711 Ga0207652_10226404
712 Ga0207646_10073876
713 Ga0207646_10244068
714 Ga0207681_10070105
715 Ga0207681_10175642
716 Ga0207694_10007352
717 Ga0207694_10011174
718 Ga0207694_10015329
719 Ga0207694_10022173
720 Ga0207694_10044768
721 Ga0207650_10132132
722 Ga0207659_10000263
723 Ga0207659_10007036
724 Ga0207659_10065549
725 Ga0207659_10102772
726 Ga0207659_10262988
727 Ga0207687_10003356
728 Ga0207687_10004585
729 Ga0207687_10005715
730 Ga0207687_10007239
731 Ga0207687_10017237
732 Ga0207687_10130526
733 Ga0207687_10183293
734 Ga0207700_10053153
735 Ga0207700_10054321
736 Ga0207644_10038221
737 Ga0207644_10496648
738 Ga0207690_10050624
739 Ga0207706_10015079
740 Ga0207706_10080360
741 Ga0207686_10005479
742 Ga0207686_10007798
743 Ga0207686_10052986
744 Ga0207709_10014945
745 Ga0207704_10006773
746 Ga0207704_10111347
747 Ga0207691_10074193
748 Ga0207711_10001453
749 Ga0207711_10079466
750 Ga0207711_10135905
751 Ga0207711_10166324
752 Ga0207689_10003130
753 Ga0207689_10467375
754 Ga0207661_10004163
755 Ga0207661_10005775
756 Ga0207661_10019060
757 Ga0207661_10032801
758 Ga0207679_10006661
759 Ga0207679_10064211
760 Ga0207667_10005190
761 Ga0207667_10011243
762 Ga0207667_10036346
763 Ga0207667_10061261
764 Ga0207651_10083282
765 Ga0207651_10557464
766 Ga0207712_10024284
767 Ga0207712_10070311
768 Ga0207640_10361525
769 Ga0207677_10187092
770 Ga0207677_10274580
771 Ga0207703_10104336
772 Ga0207703_10291597
773 Ga0207639_10053635
774 Ga0207639_10070006
775 Ga0207678_10121405
776 Ga0207708_10065629
777 Ga0207708_10135464
778 Ga0207702_10007696
779 Ga0207702_10080092
780 Ga0207702_10125859
781 Ga0207702_10234955
782 Ga0207702_10271368
783 Ga0207641_10041698
784 Ga0207641_10136526
785 Ga0207641_10276043
786 Ga0207641_10282654
787 Ga0207648_10000358
788 Ga0207648_10017353
789 Ga0207648_10154344
790 Ga0207676_10021085
791 Ga0207676_10216182
792 Ga0207674_10000493
793 Ga0207674_10018075
794 Ga0207674_10025432
795 Ga0207674_10028486
796 Ga0207674_10177314
797 Ga0207675_100047217
798 Ga0207675_100060394
799 Ga0207698_10055873
800 Ga0207698_10147802
801 Ga0207428_10029592
802 Ga0207428_10045586
803 Ga0268264_10011130
804 Ga0268264_10065378
805 Ga0268264_10080538
806 Ga0265338_10219050
807 Ga0265340_10064321
808 Ga0265313_10025405
809 Ga0265314_10000941
810 Ga0265314_10003877
811 Ga0373934_0000438
812 Ga0373944_0012464
813 Ga0373952_0042602
814 Ga0373939_0022769
815 Ga0373953_0116876
816 Ga0373954_0007717
817 Ga0373954_0026690
818 Ga0373954_0143061
819 Ga0373943_0014296
820 Ga0373943_0052687
821 Ga0373955_0021558
822 Ga0373955_0047750
823 Ga0373924_0013214
824 Ga0373924_0087125
825 Ga0373931_0175083
826 Ga0373933_0218182
827 Ga0373933_0297057
828 Ga0373947_0033766
829 Ga0373937_0001151
830 Ga0373937_0021744
831 Ga0373937_0334602
832 Ga0373925_0001175
833 Ga0373925_0030418
834 Ga0373925_0275594
835 Ga0451853_0086401
836 Ga0450890_014559
837 Ga0495592_0135284
838 Ga0495603_0039195
839 Ga0495580_0102374
840 Ga0495580_0363023
841 Ga0495582_0044802
842 Ga0495594_0018341
843 Ga0495608_0055355
844 Ga0495628_0192535
845 Ga0495630_0007788
846 Ga0495652_0032986
847 Ga0495665_0091402
848 Ga0495586_0021864
849 Ga0495586_0293103
850 Ga0495587_0021666
851 Ga0495587_0054158
852 Ga0495587_0257677
853 Ga0495598_0014913
854 Ga0495621_0152168
855 Ga0495645_0040697
856 Ga0495667_0017384
857 Ga0495667_0050134
858 Ga0495656_0063981
859 Ga0495634_0013331
860 Ga0495599_0003394
861 Ga0495599_0381721
862 Ga0495623_0315063
863 Ga0495658_0076538
864 Ga0495613_0006330
865 Ga0495604_0013980
866 Ga0495674_0149510
867 Ga0495674_0199304
868 Ga0495675_0098801
869 Ga0495684_0000781
870 Ga0495602_0004852
871 Ga0496109_0570962
872 Ga0496112_0216590
873 Ga0496114_0761577
874 Ga0501298_023369
875 nmdc:mga05p37_175656_c1
876 nmdc:mga05p37_280262_c1
877 nmdc:mga05p37_339212_c1
878 nmdc:mga05p37_41499_c1
879 nmdc:mga05p37_88800_c1
880 nmdc:mga09592_243110_c1
881 nmdc:mga09592_74103_c1
882 nmdc:mga0qj67_54139_c1
883 nmdc:mga0qj67_71040_c1
884 nmdc:mga08y16_124476_c1
885 nmdc:mga08y16_45827_c1
886 nmdc:mga0n895_14563_c1
887 nmdc:mga0n895_225801_c1
888 nmdc:mga0rr50_205819_c1
889 nmdc:mga0a205_28244_c1
890 nmdc:mga0a205_515295_c1
891 Ga0495595_0122732
892 Ga0495619_0001596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ceo-assembly1.cif.gz_d yeast rna polymerase ii transcription pre-initiation complex with core mediator and the +1 nucleosome 0.7504 169 227
3s0p-assembly4.cif.gz_G copper-reconstituted tomato chloroplast superoxide dismutase 0.7471 194 216
3s0p-assembly4.cif.gz_H copper-reconstituted tomato chloroplast superoxide dismutase 0.747 194 216
3s0p-assembly3.cif.gz_F copper-reconstituted tomato chloroplast superoxide dismutase 0.7463 194 216
3s0p-assembly1.cif.gz_B copper-reconstituted tomato chloroplast superoxide dismutase 0.7459 194 216
ID Description Score Start End Superfamily
af_A0A1D8PSL1_87_509_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8389 120 144 1.25.40.10
af_E9PTR6_25_177_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8287 195 232 2.40.128.20
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7496 190 215 2.60.40.200
3bdrA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.709 163 234 2.40.128.20
4tq2A00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6991 168 235 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A2V8LXP7-F1-model_v4 Uncharacterized protein 0.9674 130 235
AF-A0A2V8N442-F1-model_v4 Uncharacterized protein 0.9645 123 235
AF-A0A317HUV8-F1-model_v4 Uncharacterized protein 0.963 156 235
AF-A0A2V9C7H0-F1-model_v4 Uncharacterized protein 0.9629 159 235
AF-A0A1F2S872-F1-model_v4 Uncharacterized protein 0.9555 111 231

Map