F445651

General Info

Members Datasets Scaffolds Average Seq Length
446 252 892 317

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100001845|Ga0070680_1000018453
Length 328
Sequence VPSARQAQAASELTVASKDVAAEVARWLEHLGAERRMSGKTLSAYERDTRQFLTFMAGHLGGAPTLAELAALAPQDVRAFMAARRAAGIGSRSLMRVLAGVRSFARFLERNGKGKVGALAAVRAPKVPKTLPKPLTVTAAKQVSDVDIRAGEEREPWILARDAAVLALLYGSGLRISEALGLTRGDIPAPGKNTSSQVDAITVTGKGNKQRMVPLLPQVTQAIADYVALCPYDLPAEAALFIGARGKPLSPRIIQLVMERLRGALGLPDSATPHALRHSFATHLLARGGDLRAIQELLGHASLATTQIYTAVDTDRLLEAYRSAHPRA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 0
Rhizoplane 6.95
Rhizosphere 86.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100001845 3300005336 Bacteria 15533
2 JGI24745J21846_1001719 3300002073 Bacteria 2154
3 JGI24034J26672_10003867 3300002239 Bacteria 2104
4 JGI24742J22300_10006963 3300002244 Bacteria 1864
5 JGI24751J29686_10002044 3300002459 Bacteria 4101
6 Ga0065712_10128185 3300005290 Bacteria 1582
7 Ga0070676_10010374 3300005328 Bacteria 5054
8 Ga0070676_10213680 3300005328 Bacteria 1270
9 Ga0070690_100002267 3300005330 Bacteria 10301
10 Ga0070690_100019374 3300005330 Bacteria 4128
11 Ga0070670_100122581 3300005331 Bacteria 2242
12 Ga0070670_100141718 3300005331 Bacteria 2079
13 Ga0070670_100156051 3300005331 Bacteria 1977
14 Ga0070670_100394584 3300005331 Bacteria 1221
15 Ga0068869_100045941 3300005334 Bacteria 3146
16 Ga0070666_10023897 3300005335 Bacteria 3979
17 Ga0070666_10062730 3300005335 Bacteria 2519
18 Ga0070660_100077539 3300005339 Bacteria 2604
19 Ga0070689_100007071 3300005340 Bacteria 7814
20 Ga0070689_100018650 3300005340 Bacteria 5116
21 Ga0070689_100027892 3300005340 Bacteria 4261
22 Ga0070691_10018174 3300005341 Bacteria 3240
23 Ga0070687_100002334 3300005343 Bacteria 7068
24 Ga0070668_100032486 3300005347 Bacteria 3972
25 Ga0070668_100115529 3300005347 Bacteria 2139
26 Ga0070669_100022195 3300005353 Bacteria 4539
27 Ga0070669_100056941 3300005353 Bacteria 2867
28 Ga0070675_100139070 3300005354 Bacteria 2074
29 Ga0070675_100235014 3300005354 Bacteria 1600
30 Ga0070671_100011200 3300005355 Bacteria 7203
31 Ga0070671_100049916 3300005355 Bacteria 3481
32 Ga0070671_100099856 3300005355 Bacteria 2435
33 Ga0070674_100012783 3300005356 Bacteria 5165
34 Ga0070674_100068639 3300005356 Bacteria 2498
35 Ga0070673_100034535 3300005364 Bacteria 3828
36 Ga0070673_100099870 3300005364 Bacteria 2388
37 Ga0070673_100218671 3300005364 Bacteria 1648
38 Ga0070688_100004652 3300005365 Bacteria 7163
39 Ga0070659_100017490 3300005366 Bacteria 5399
40 Ga0070709_10066729 3300005434 Bacteria 2309
41 Ga0070714_100068419 3300005435 Bacteria 3063
42 Ga0070701_10003124 3300005438 Bacteria 6498
43 Ga0070711_100055985 3300005439 Bacteria 2726
44 Ga0070711_100171362 3300005439 Bacteria 1655
45 Ga0070663_100010765 3300005455 Bacteria 5711
46 Ga0070678_100013848 3300005456 Bacteria 5070
47 Ga0070678_100021590 3300005456 Bacteria 4249
48 Ga0070678_100043220 3300005456 Bacteria 3208
49 Ga0070662_100045427 3300005457 Bacteria 3151
50 Ga0070681_10119145 3300005458 Bacteria 2576
51 Ga0068867_100006416 3300005459 Bacteria 8307
52 Ga0068867_100193372 3300005459 Bacteria 1625
53 Ga0070685_10016133 3300005466 Bacteria 3975
54 Ga0070679_100025568 3300005530 Bacteria 5795
55 Ga0070679_100066196 3300005530 Bacteria 3601
56 Ga0070684_100148583 3300005535 Bacteria 2122
57 Ga0070686_100003323 3300005544 Bacteria 8810
58 Ga0070686_100110774 3300005544 Bacteria 1870
59 Ga0070693_100096454 3300005547 Bacteria 1793
60 Ga0070665_100043288 3300005548 Bacteria 4525
61 Ga0070704_100250679 3300005549 Bacteria 1454
62 Ga0068855_100342525 3300005563 Bacteria 1648
63 Ga0070664_100012300 3300005564 Bacteria 6954
64 Ga0070664_100211137 3300005564 Bacteria 1735
65 Ga0068857_100137763 3300005577 Bacteria 2205
66 Ga0068854_100093388 3300005578 Bacteria 2242
67 Ga0068856_100067381 3300005614 Bacteria 3537
68 Ga0068856_100237026 3300005614 Bacteria 1840
69 Ga0070702_100092027 3300005615 Bacteria 1841
70 Ga0068852_100188049 3300005616 Bacteria 1946
71 Ga0068859_100072291 3300005617 Bacteria 3486
72 Ga0068859_100172654 3300005617 Bacteria 2243
73 Ga0068864_100011718 3300005618 Bacteria 7239
74 Ga0068864_100026199 3300005618 Bacteria 4916
75 Ga0068861_100180283 3300005719 Bacteria 1758
76 Ga0068870_10001834 3300005840 Bacteria 8725
77 Ga0068863_100084658 3300005841 Bacteria 3005
78 Ga0068858_100014197 3300005842 Bacteria 7511
79 Ga0068860_100266846 3300005843 Bacteria 1670
80 Ga0081455_10014172 3300005937 Bacteria 7832
81 Ga0081538_10007225 3300005981 Bacteria 9637
82 Ga0081540_1000191 3300005983 Bacteria 63533
83 Ga0081540_1017998 3300005983 Bacteria 4351
84 Ga0081540_1039505 3300005983 Bacteria 2473
85 Ga0081539_10001145 3300005985 Bacteria 48039
86 Ga0070717_10137151 3300006028 Bacteria 2108
87 Ga0075368_10113004 3300006042 Bacteria 1120
88 Ga0075363_100008003 3300006048 Bacteria 4898
89 Ga0075363_100013843 3300006048 Bacteria 3926
90 Ga0070712_100031204 3300006175 Bacteria 3588
91 Ga0075362_10007679 3300006177 Bacteria 4097
92 Ga0075362_10009511 3300006177 Bacteria 3762
93 Ga0075367_10035642 3300006178 Bacteria 2881
94 Ga0075367_10061208 3300006178 Bacteria 2246
95 Ga0075367_10116339 3300006178 Bacteria 1644
96 Ga0075367_10233029 3300006178 Bacteria 1153
97 Ga0075366_10050965 3300006195 Bacteria 2459
98 Ga0075370_10037643 3300006353 Bacteria 2720
99 Ga0075370_10062852 3300006353 Bacteria 2116
100 Ga0075430_100001401 3300006846 Bacteria 19600
101 Ga0075431_100286512 3300006847 Bacteria 1667
102 Ga0075433_10013568 3300006852 Bacteria 6632
103 Ga0075434_100335009 3300006871 Bacteria 1533
104 Ga0068865_100016990 3300006881 Bacteria 4670
105 Ga0068865_100325653 3300006881 Bacteria 1238
106 Ga0097620_100072290 3300006931 Bacteria 3486
107 Ga0097620_100172643 3300006931 Bacteria 2243
108 Ga0099795_10002657 3300007788 Bacteria 4256
109 Ga0099795_10060811 3300007788 Bacteria 1401
110 Ga0111539_10042799 3300009094 Bacteria 5434
111 Ga0111539_10145709 3300009094 Bacteria 2773
112 Ga0105245_10043377 3300009098 Bacteria 4012
113 Ga0105245_10591650 3300009098 Bacteria 1135
114 Ga0105247_10016131 3300009101 Bacteria 4476
115 Ga0105247_10021658 3300009101 Bacteria 3868
116 Ga0114129_10446335 3300009147 Bacteria 1697
117 Ga0105243_10016572 3300009148 Bacteria 5571
118 Ga0105241_10067444 3300009174 Bacteria 2769
119 Ga0105248_10036774 3300009177 Bacteria 5475
120 Ga0105238_10052333 3300009551 Bacteria 4104
121 Ga0105249_10028622 3300009553 Bacteria 5029
122 Ga0105249_10138096 3300009553 Bacteria 2335
123 Ga0105249_10376401 3300009553 Bacteria 1445
124 Ga0099796_10001071 3300010159 Bacteria 5218
125 Ga0105239_10031238 3300010375 Bacteria 5859
126 Ga0105246_10062223 3300011119 Bacteria 2599
127 Ga0105246_10082950 3300011119 Bacteria 2289
128 Ga0163162_10244622 3300013306 Bacteria 1925
129 Ga0163162_10277983 3300013306 Bacteria 1806
130 Ga0157375_10615044 3300013308 Bacteria 1245
131 Ga0163163_10132303 3300014325 Bacteria 2535
132 Ga0163163_10171558 3300014325 Bacteria 2216
133 Ga0157380_10092574 3300014326 Bacteria 2498
134 Ga0157380_10142730 3300014326 Bacteria 2059
135 Ga0157380_10185708 3300014326 Bacteria 1831
136 Ga0157380_10192618 3300014326 Bacteria 1801
137 Ga0157380_10252838 3300014326 Bacteria 1596
138 Ga0182008_10015688 3300014497 Bacteria 3950
139 Ga0157377_10012801 3300014745 Bacteria 4229
140 Ga0157379_10455739 3300014968 Bacteria 1181
141 Ga0157376_10159862 3300014969 Bacteria 2041
142 Ga0157376_10274778 3300014969 Bacteria 1584
143 Ga0163161_10028718 3300017792 Bacteria 3951
144 Ga0213875_10000345 3300021388 Bacteria 43695
145 Ga0224572_1021470 3300024225 Bacteria 1239
146 Ga0209455_1001542 3300025272 Bacteria 10242
147 Ga0207697_10050043 3300025315 Bacteria 1725
148 Ga0207656_10090260 3300025321 Bacteria 1390
149 Ga0207682_10004048 3300025893 Bacteria 6234
150 Ga0207692_10006819 3300025898 Bacteria 4647
151 Ga0207642_10008626 3300025899 Bacteria 3507
152 Ga0207688_10005873 3300025901 Bacteria 6681
153 Ga0207680_10058924 3300025903 Bacteria 2330
154 Ga0207699_10005345 3300025906 Bacteria 6154
155 Ga0207645_10068903 3300025907 Bacteria 2263
156 Ga0207643_10032894 3300025908 Bacteria 2899
157 Ga0207693_10006569 3300025915 Bacteria 9623
158 Ga0207663_10106100 3300025916 Bacteria 1898
159 Ga0207657_10019804 3300025919 Bacteria 6378
160 Ga0207657_10057426 3300025919 Bacteria 3354
161 Ga0207649_10019694 3300025920 Bacteria 3861
162 Ga0207652_10040054 3300025921 Bacteria 3978
163 Ga0207681_10038526 3300025923 Bacteria 3168
164 Ga0207650_10008493 3300025925 Bacteria 7011
165 Ga0207650_10115303 3300025925 Bacteria 2085
166 Ga0207650_10189111 3300025925 Bacteria 1644
167 Ga0207659_10002615 3300025926 Bacteria 10716
168 Ga0207659_10159087 3300025926 Bacteria 1771
169 Ga0207687_10025649 3300025927 Bacteria 3944
170 Ga0207700_10060871 3300025928 Bacteria 2861
171 Ga0207664_10116490 3300025929 Bacteria 2229
172 Ga0207644_10030634 3300025931 Bacteria 3743
173 Ga0207644_10034887 3300025931 Bacteria 3521
174 Ga0207644_10046422 3300025931 Bacteria 3095
175 Ga0207644_10142422 3300025931 Bacteria 1847
176 Ga0207690_10046625 3300025932 Bacteria 2871
177 Ga0207686_10094168 3300025934 Bacteria 1985
178 Ga0207686_10145602 3300025934 Bacteria 1643
179 Ga0207709_10003285 3300025935 Bacteria 9703
180 Ga0207670_10082715 3300025936 Bacteria 2250
181 Ga0207670_10161901 3300025936 Bacteria 1671
182 Ga0207669_10029840 3300025937 Bacteria 3021
183 Ga0207669_10113742 3300025937 Bacteria 1820
184 Ga0207704_10289593 3300025938 Bacteria 1249
185 Ga0207665_10257977 3300025939 Bacteria 1290
186 Ga0207691_10001529 3300025940 Bacteria 23010
187 Ga0207691_10005263 3300025940 Bacteria 12490
188 Ga0207711_10006463 3300025941 Bacteria 9867
189 Ga0207711_10177119 3300025941 Bacteria 1937
190 Ga0207689_10018858 3300025942 Bacteria 5819
191 Ga0207689_10022952 3300025942 Bacteria 5241
192 Ga0207679_10013484 3300025945 Bacteria 5359
193 Ga0207679_10169277 3300025945 Bacteria 1797
194 Ga0207651_10042704 3300025960 Bacteria 3020
195 Ga0207651_10283887 3300025960 Bacteria 1369
196 Ga0207712_10006050 3300025961 Bacteria 7632
197 Ga0207668_10136558 3300025972 Bacteria 1880
198 Ga0207703_10016489 3300026035 Bacteria 5761
199 Ga0207678_10006780 3300026067 Bacteria 10152
200 Ga0207708_10004507 3300026075 Bacteria 10250
201 Ga0207702_10240835 3300026078 Bacteria 1695
202 Ga0207648_10004650 3300026089 Bacteria 14049
203 Ga0207648_10035740 3300026089 Bacteria 4378
204 Ga0207676_10077148 3300026095 Bacteria 2694
205 Ga0207676_10292648 3300026095 Bacteria 1483
206 Ga0207674_10066643 3300026116 Bacteria 3626
207 Ga0207674_10129660 3300026116 Bacteria 2486
208 Ga0207675_100010404 3300026118 Bacteria 8716
209 Ga0207675_100161237 3300026118 Bacteria 2139
210 Ga0207675_100226510 3300026118 Bacteria 1803
211 Ga0207675_100278321 3300026118 Bacteria 1625
212 Ga0207683_10006966 3300026121 Bacteria 9687
213 Ga0207683_10055130 3300026121 Bacteria 3486
214 Ga0207683_10083175 3300026121 Bacteria 2844
215 Ga0207698_10017320 3300026142 Bacteria 4885
216 Ga0207698_10198910 3300026142 Bacteria 1793
217 Ga0268266_10033991 3300028379 Bacteria 4334
218 Ga0268266_10130573 3300028379 Bacteria 2246
219 Ga0265325_10001803 3300031241 Bacteria 14829
220 Ga0265325_10047767 3300031241 Bacteria 2215
221 Ga0265340_10057523 3300031247 Bacteria 1869
222 Ga0265340_10115846 3300031247 Bacteria 1235
223 Ga0265339_10040592 3300031249 Bacteria 2586
224 Ga0265313_10065864 3300031595 Bacteria 1681
225 Ga0265342_10059480 3300031712 Bacteria 2257
226 Ga0373959_0003844 3300034820 Bacteria 2404
227 Ga0373938_0038793 3300034957 Bacteria 1051
228 Ga0373928_0045918 3300035084 Bacteria 1018
229 Ga0373929_0005199 3300035085 Bacteria 2340
230 Ga0373945_0010359 3300035116 Bacteria 3069
231 Ga0373945_0055875 3300035116 Bacteria 1463
232 Ga0373945_0097273 3300035116 Bacteria 1148
233 Ga0373943_0010396 3300035170 Bacteria 4170
234 Ga0373955_0066596 3300035172 Bacteria 2003
235 Ga0373961_0007452 3300035241 Bacteria 2647
236 Ga0373931_0004684 3300035691 Bacteria 6260
237 Ga0373931_0010376 3300035691 Bacteria 4476
238 Ga0373931_0037748 3300035691 Bacteria 2523
239 Ga0373935_0043806 3300035692 Bacteria 2818
240 Ga0373935_0081769 3300035692 Bacteria 2101
241 Ga0373935_0082924 3300035692 Bacteria 2086
242 Ga0373935_0453085 3300035692 Bacteria 927
243 Ga0373927_0059125 3300035695 Bacteria 2479
244 Ga0373927_0071592 3300035695 Bacteria 2244
245 Ga0373927_0125082 3300035695 Bacteria 1678
246 Ga0373933_0063558 3300035724 Bacteria 2231
247 Ga0373925_0253801 3300037068 Bacteria 1411
248 Ga0373925_0386380 3300037068 Bacteria 1140
249 Ga0436364_0160704 3300037853 Bacteria 43989
250 Ga0436365_0263703 3300039437 Bacteria 7806
251 Ga0436365_0478361 3300039437 Bacteria 2620
252 Ga0436365_0648212 3300039437 Bacteria 4903
253 Ga0439453_0001506 3300041408 Bacteria 3012
254 Ga0439446_0016262 3300042156 Bacteria 2071
255 Ga0439444_0032346 3300042437 Bacteria 989
256 Ga0495592_0101476 3300046454 Bacteria 2050
257 Ga0495590_0020825 3300046457 Bacteria 2328
258 Ga0495629_0094222 3300046459 Bacteria 2089
259 Ga0495638_0018424 3300046460 Bacteria 4636
260 Ga0495638_0065606 3300046460 Bacteria 2234
261 Ga0495641_0087027 3300046461 Bacteria 1398
262 Ga0495653_0117928 3300046463 Bacteria 1896
263 Ga0495582_0010836 3300046473 Bacteria 5018
264 Ga0495596_0033512 3300046500 Bacteria 2044
265 Ga0495608_0015517 3300046511 Bacteria 5283
266 Ga0495616_0047834 3300046513 Bacteria 2152
267 Ga0495631_0032624 3300046518 Bacteria 2347
268 Ga0495666_0067088 3300046526 Bacteria 1710
269 Ga0495666_0100269 3300046526 Bacteria 1365
270 Ga0495665_0099206 3300046531 Bacteria 1529
271 Ga0495598_0026390 3300046537 Bacteria 1592
272 Ga0495667_0075027 3300046559 Bacteria 2201
273 Ga0495656_0066300 3300046615 Bacteria 1590
274 Ga0495635_0204586 3300046663 Bacteria 1338
275 Ga0495657_0054804 3300046675 Bacteria 2662
276 Ga0495599_0084253 3300046678 Bacteria 1985
277 Ga0495623_0028940 3300046679 Bacteria 3565
278 Ga0495647_0008340 3300046681 Bacteria 3482
279 Ga0495624_0060215 3300046690 Bacteria 2380
280 Ga0495600_0127832 3300046809 Bacteria 1652
281 Ga0495581_0175071 3300047315 Bacteria 1255
282 Ga0495674_0283464 3300047319 Bacteria 1357
283 Ga0495676_0169734 3300047321 Bacteria 1536
284 Ga0495675_0046739 3300047444 Bacteria 2755
285 Ga0495684_0222170 3300047471 Bacteria 1384
286 Ga0495602_0098980 3300048088 Bacteria 2398
287 Ga0495614_0066159 3300048089 Bacteria 1555
288 Ga0496100_0013827 3300048903 Bacteria 4669
289 Ga0496100_0030651 3300048903 Bacteria 3337
290 Ga0496101_0087962 3300048904 Bacteria 2307
291 Ga0496102_0014721 3300048905 Bacteria 6799
292 Ga0496102_0018925 3300048905 Bacteria 6059
293 Ga0496103_0003433 3300048906 Bacteria 9686
294 Ga0496104_0008328 3300048907 Bacteria 9209
295 Ga0496104_0031687 3300048907 Bacteria 4918
296 Ga0496105_0005267 3300048908 Bacteria 9802
297 Ga0496105_0013267 3300048908 Bacteria 6538
298 Ga0496106_0022133 3300048909 Bacteria 4720
299 Ga0496106_0036641 3300048909 Bacteria 3668
300 Ga0496107_0031093 3300048910 Bacteria 3807
301 Ga0496107_0043568 3300048910 Bacteria 3224
302 Ga0496107_0239520 3300048910 Bacteria 1350
303 Ga0496108_0297697 3300048911 Bacteria 1405
304 Ga0496109_0005059 3300048912 Bacteria 11014
305 Ga0496109_0456845 3300048912 Bacteria 1206
306 Ga0496110_0007159 3300048913 Bacteria 8883
307 Ga0496110_0037255 3300048913 Bacteria 4227
308 Ga0496111_0002676 3300048914 Bacteria 10824
309 Ga0496112_0053314 3300048915 Bacteria 3971
310 Ga0496112_0059485 3300048915 Bacteria 3765
311 Ga0496112_0093571 3300048915 Bacteria 2976
312 Ga0496112_0164259 3300048915 Bacteria 2186
313 Ga0496112_0284649 3300048915 Bacteria 1599
314 Ga0496113_0031277 3300048916 Bacteria 3861
315 Ga0496113_0166043 3300048916 Bacteria 1746
316 Ga0496114_0014116 3300048917 Bacteria 6404
317 Ga0496114_0044582 3300048917 Bacteria 3680
318 Ga0496115_0149141 3300048918 Bacteria 1930
319 Ga0501031_0011338 3300049568 Bacteria 5805
320 Ga0501031_0030154 3300049568 Bacteria 3537
321 Ga0501031_0171048 3300049568 Bacteria 1420
322 Ga0501032_0001675 3300049569 Bacteria 17609
323 Ga0501032_0035453 3300049569 Bacteria 3410
324 Ga0501032_0049652 3300049569 Bacteria 2831
325 Ga0501032_0078121 3300049569 Bacteria 2203
326 Ga0501032_0079273 3300049569 Bacteria 2186
327 Ga0501033_0011572 3300049570 Bacteria 6751
328 Ga0501033_0119834 3300049570 Bacteria 1910
329 Ga0501034_0002178 3300049571 Bacteria 24260
330 Ga0501034_0003787 3300049571 Bacteria 17067
331 Ga0501034_0027445 3300049571 Bacteria 5791
332 Ga0501034_0034515 3300049571 Bacteria 5128
333 Ga0501034_0054797 3300049571 Bacteria 4013
334 Ga0501034_0060334 3300049571 Bacteria 3810
335 Ga0501034_0061941 3300049571 Bacteria 3756
336 Ga0501034_0068012 3300049571 Bacteria 3573
337 Ga0501034_0069715 3300049571 Bacteria 3527
338 Ga0501034_0136414 3300049571 Bacteria 2434
339 Ga0501036_0001411 3300049572 Bacteria 18465
340 Ga0501036_0002142 3300049572 Bacteria 15409
341 Ga0501036_0047893 3300049572 Bacteria 3619
342 Ga0501036_0052349 3300049572 Bacteria 3458
343 Ga0501036_0148792 3300049572 Bacteria 1975
344 Ga0501036_0261588 3300049572 Bacteria 1449
345 Ga0501036_0263570 3300049572 Bacteria 1443
346 Ga0501036_0294499 3300049572 Bacteria 1357
347 Ga0501037_0006705 3300049573 Bacteria 8420
348 Ga0501037_0011489 3300049573 Bacteria 6520
349 Ga0501037_0016574 3300049573 Bacteria 5422
350 Ga0501037_0017581 3300049573 Bacteria 5263
351 Ga0501037_0040709 3300049573 Bacteria 3418
352 Ga0501038_0009362 3300049574 Bacteria 8985
353 Ga0501038_0034669 3300049574 Bacteria 4436
354 Ga0501038_0044223 3300049574 Bacteria 3871
355 Ga0501039_0013053 3300049575 Bacteria 6351
356 Ga0501039_0013645 3300049575 Bacteria 6212
357 Ga0501039_0033021 3300049575 Bacteria 3992
358 Ga0501039_0048235 3300049575 Bacteria 3292
359 Ga0501042_0036857 3300049578 Bacteria 3470
360 Ga0501042_0209441 3300049578 Bacteria 1406
361 Ga0501043_0004795 3300049579 Bacteria 10958
362 Ga0501043_0011410 3300049579 Bacteria 6957
363 Ga0501043_0014823 3300049579 Bacteria 6103
364 Ga0501043_0071441 3300049579 Bacteria 2726
365 Ga0501046_0000897 3300049580 Bacteria 29016
366 Ga0501046_0009727 3300049580 Bacteria 8292
367 Ga0501046_0021558 3300049580 Bacteria 5317
368 Ga0501046_0031250 3300049580 Bacteria 4319
369 Ga0501047_0000073 3300049581 Bacteria 125990
370 Ga0501047_0003886 3300049581 Bacteria 14045
371 Ga0501047_0028371 3300049581 Bacteria 5395
372 Ga0501047_0043113 3300049581 Bacteria 4358
373 Ga0501047_0057566 3300049581 Bacteria 3758
374 Ga0501047_0081357 3300049581 Bacteria 3113
375 Ga0501047_0087580 3300049581 Bacteria 2991
376 Ga0501048_0001292 3300049582 Bacteria 18991
377 Ga0501048_0002123 3300049582 Bacteria 15116
378 Ga0501048_0044328 3300049582 Bacteria 3181
379 Ga0501048_0076479 3300049582 Bacteria 2362
380 Ga0501068_0025836 3300049584 Bacteria 3456
381 Ga0501068_0129499 3300049584 Bacteria 1577
382 Ga0501069_0002621 3300049585 Bacteria 9176
383 Ga0501069_0017027 3300049585 Bacteria 3907
384 Ga0501069_0032684 3300049585 Bacteria 2864
385 Ga0501070_0010307 3300049586 Bacteria 7901
386 Ga0501070_0028108 3300049586 Bacteria 4716
387 Ga0501070_0033612 3300049586 Bacteria 4292
388 Ga0501070_0038226 3300049586 Bacteria 4004
389 Ga0501070_0114622 3300049586 Bacteria 2226
390 Ga0501071_0014406 3300049587 Bacteria 5408
391 Ga0501071_0066856 3300049587 Bacteria 2613
392 Ga0501073_0015133 3300049589 Bacteria 5596
393 Ga0501073_0018653 3300049589 Bacteria 5014
394 Ga0501073_0028524 3300049589 Bacteria 3989
395 Ga0501073_0048984 3300049589 Bacteria 2963
396 Ga0501073_0130146 3300049589 Bacteria 1744
397 Ga0501074_0004023 3300049590 Bacteria 10483
398 Ga0501074_0036326 3300049590 Bacteria 3569
399 Ga0501074_0071276 3300049590 Bacteria 2498
400 Ga0501074_0093626 3300049590 Bacteria 2152
401 Ga0501074_0099774 3300049590 Bacteria 2078
402 Ga0501074_0135135 3300049590 Bacteria 1764
403 Ga0501079_0029344 3300049741 Bacteria 4223
404 Ga0501080_0000351 3300049742 Bacteria 35352
405 Ga0501080_0044146 3300049742 Bacteria 4150
406 Ga0501080_0047301 3300049742 Bacteria 4004
407 Ga0501080_0063056 3300049742 Bacteria 3449
408 Ga0501080_0081970 3300049742 Bacteria 2997
409 Ga0501080_0104262 3300049742 Bacteria 2630
410 Ga0501080_0243933 3300049742 Bacteria 1639
411 Ga0501083_0028269 3300049744 Bacteria 3866
412 Ga0501083_0107148 3300049744 Bacteria 1839
413 Ga0501035_0026857 3300049822 Bacteria 5264
414 Ga0501035_0044906 3300049822 Bacteria 3976
415 Ga0501035_0092848 3300049822 Bacteria 2655
416 Ga0501035_0099039 3300049822 Bacteria 2559
417 Ga0501044_0002698 3300049823 Bacteria 20171
418 Ga0501044_0003367 3300049823 Bacteria 18021
419 Ga0501044_0031241 3300049823 Bacteria 5606
420 Ga0501044_0048180 3300049823 Bacteria 4403
421 Ga0501044_0096570 3300049823 Bacteria 2976
422 Ga0501044_0138382 3300049823 Bacteria 2424
423 Ga0501045_0019014 3300049824 Bacteria 4893
424 nmdc:mga03683_39912_c1 3300050489 Bacteria 1923
425 nmdc:mga00v17_157860_c1 3300050491 Bacteria 1459
426 nmdc:mga0yw44_35026_c1 3300050492 Bacteria 2947
427 nmdc:mga0k408_166100_c1 3300050493 Bacteria 1315
428 nmdc:mga0k408_17841_c1 3300050493 Bacteria 3956
429 nmdc:mga0k408_61516_c1 3300050493 Bacteria 2183
430 nmdc:mga06z11_25175_c1 3300050494 Bacteria 2817
431 nmdc:mga06z11_6656_c1 3300050494 Bacteria 4722
432 nmdc:mga07m45_164486_c1 3300050496 Bacteria 1289
433 nmdc:mga05p37_467310_c1 3300050507 Bacteria 1456
434 nmdc:mga0qj67_18_c1 3300050509 Bacteria 120268
435 nmdc:mga0qj67_83065_c1 3300050509 Bacteria 2568
436 nmdc:mga0a205_26454_c1 3300050515 Bacteria 5533
437 Ga0495601_0111825 3300053077 Bacteria 1769
438 Ga0495601_0285411 3300053077 Bacteria 1076
439 Ga0495595_0059228 3300053084 Bacteria 1790
440 Ga0495619_0046605 3300053085 Bacteria 2851
441 Ga0495619_0062552 3300053085 Bacteria 2478
442 Ga0500616_0015763 3300053153 Bacteria 4314
443 Ga0501084_0040599 3300054114 Bacteria 3893
444 Ga0501084_0096340 3300054114 Bacteria 2485
445 Ga0501084_0149313 3300054114 Bacteria 1969
446 Ga0501082_0025800 3300060353 Bacteria 5065
447 Ga0070680_100001845
448 JGI24745J21846_1001719
449 JGI24034J26672_10003867
450 JGI24742J22300_10006963
451 JGI24751J29686_10002044
452 Ga0065712_10128185
453 Ga0070676_10010374
454 Ga0070676_10213680
455 Ga0070690_100002267
456 Ga0070690_100019374
457 Ga0070670_100122581
458 Ga0070670_100141718
459 Ga0070670_100156051
460 Ga0070670_100394584
461 Ga0068869_100045941
462 Ga0070666_10023897
463 Ga0070666_10062730
464 Ga0070660_100077539
465 Ga0070689_100007071
466 Ga0070689_100018650
467 Ga0070689_100027892
468 Ga0070691_10018174
469 Ga0070687_100002334
470 Ga0070668_100032486
471 Ga0070668_100115529
472 Ga0070669_100022195
473 Ga0070669_100056941
474 Ga0070675_100139070
475 Ga0070675_100235014
476 Ga0070671_100011200
477 Ga0070671_100049916
478 Ga0070671_100099856
479 Ga0070674_100012783
480 Ga0070674_100068639
481 Ga0070673_100034535
482 Ga0070673_100099870
483 Ga0070673_100218671
484 Ga0070688_100004652
485 Ga0070659_100017490
486 Ga0070709_10066729
487 Ga0070714_100068419
488 Ga0070701_10003124
489 Ga0070711_100055985
490 Ga0070711_100171362
491 Ga0070663_100010765
492 Ga0070678_100013848
493 Ga0070678_100021590
494 Ga0070678_100043220
495 Ga0070662_100045427
496 Ga0070681_10119145
497 Ga0068867_100006416
498 Ga0068867_100193372
499 Ga0070685_10016133
500 Ga0070679_100025568
501 Ga0070679_100066196
502 Ga0070684_100148583
503 Ga0070686_100003323
504 Ga0070686_100110774
505 Ga0070693_100096454
506 Ga0070665_100043288
507 Ga0070704_100250679
508 Ga0068855_100342525
509 Ga0070664_100012300
510 Ga0070664_100211137
511 Ga0068857_100137763
512 Ga0068854_100093388
513 Ga0068856_100067381
514 Ga0068856_100237026
515 Ga0070702_100092027
516 Ga0068852_100188049
517 Ga0068859_100072291
518 Ga0068859_100172654
519 Ga0068864_100011718
520 Ga0068864_100026199
521 Ga0068861_100180283
522 Ga0068870_10001834
523 Ga0068863_100084658
524 Ga0068858_100014197
525 Ga0068860_100266846
526 Ga0081455_10014172
527 Ga0081538_10007225
528 Ga0081540_1000191
529 Ga0081540_1017998
530 Ga0081540_1039505
531 Ga0081539_10001145
532 Ga0070717_10137151
533 Ga0075368_10113004
534 Ga0075363_100008003
535 Ga0075363_100013843
536 Ga0070712_100031204
537 Ga0075362_10007679
538 Ga0075362_10009511
539 Ga0075367_10035642
540 Ga0075367_10061208
541 Ga0075367_10116339
542 Ga0075367_10233029
543 Ga0075366_10050965
544 Ga0075370_10037643
545 Ga0075370_10062852
546 Ga0075430_100001401
547 Ga0075431_100286512
548 Ga0075433_10013568
549 Ga0075434_100335009
550 Ga0068865_100016990
551 Ga0068865_100325653
552 Ga0097620_100072290
553 Ga0097620_100172643
554 Ga0099795_10002657
555 Ga0099795_10060811
556 Ga0111539_10042799
557 Ga0111539_10145709
558 Ga0105245_10043377
559 Ga0105245_10591650
560 Ga0105247_10016131
561 Ga0105247_10021658
562 Ga0114129_10446335
563 Ga0105243_10016572
564 Ga0105241_10067444
565 Ga0105248_10036774
566 Ga0105238_10052333
567 Ga0105249_10028622
568 Ga0105249_10138096
569 Ga0105249_10376401
570 Ga0099796_10001071
571 Ga0105239_10031238
572 Ga0105246_10062223
573 Ga0105246_10082950
574 Ga0163162_10244622
575 Ga0163162_10277983
576 Ga0157375_10615044
577 Ga0163163_10132303
578 Ga0163163_10171558
579 Ga0157380_10092574
580 Ga0157380_10142730
581 Ga0157380_10185708
582 Ga0157380_10192618
583 Ga0157380_10252838
584 Ga0182008_10015688
585 Ga0157377_10012801
586 Ga0157379_10455739
587 Ga0157376_10159862
588 Ga0157376_10274778
589 Ga0163161_10028718
590 Ga0213875_10000345
591 Ga0224572_1021470
592 Ga0209455_1001542
593 Ga0207697_10050043
594 Ga0207656_10090260
595 Ga0207682_10004048
596 Ga0207692_10006819
597 Ga0207642_10008626
598 Ga0207688_10005873
599 Ga0207680_10058924
600 Ga0207699_10005345
601 Ga0207645_10068903
602 Ga0207643_10032894
603 Ga0207693_10006569
604 Ga0207663_10106100
605 Ga0207657_10019804
606 Ga0207657_10057426
607 Ga0207649_10019694
608 Ga0207652_10040054
609 Ga0207681_10038526
610 Ga0207650_10008493
611 Ga0207650_10115303
612 Ga0207650_10189111
613 Ga0207659_10002615
614 Ga0207659_10159087
615 Ga0207687_10025649
616 Ga0207700_10060871
617 Ga0207664_10116490
618 Ga0207644_10030634
619 Ga0207644_10034887
620 Ga0207644_10046422
621 Ga0207644_10142422
622 Ga0207690_10046625
623 Ga0207686_10094168
624 Ga0207686_10145602
625 Ga0207709_10003285
626 Ga0207670_10082715
627 Ga0207670_10161901
628 Ga0207669_10029840
629 Ga0207669_10113742
630 Ga0207704_10289593
631 Ga0207665_10257977
632 Ga0207691_10001529
633 Ga0207691_10005263
634 Ga0207711_10006463
635 Ga0207711_10177119
636 Ga0207689_10018858
637 Ga0207689_10022952
638 Ga0207679_10013484
639 Ga0207679_10169277
640 Ga0207651_10042704
641 Ga0207651_10283887
642 Ga0207712_10006050
643 Ga0207668_10136558
644 Ga0207703_10016489
645 Ga0207678_10006780
646 Ga0207708_10004507
647 Ga0207702_10240835
648 Ga0207648_10004650
649 Ga0207648_10035740
650 Ga0207676_10077148
651 Ga0207676_10292648
652 Ga0207674_10066643
653 Ga0207674_10129660
654 Ga0207675_100010404
655 Ga0207675_100161237
656 Ga0207675_100226510
657 Ga0207675_100278321
658 Ga0207683_10006966
659 Ga0207683_10055130
660 Ga0207683_10083175
661 Ga0207698_10017320
662 Ga0207698_10198910
663 Ga0268266_10033991
664 Ga0268266_10130573
665 Ga0265325_10001803
666 Ga0265325_10047767
667 Ga0265340_10057523
668 Ga0265340_10115846
669 Ga0265339_10040592
670 Ga0265313_10065864
671 Ga0265342_10059480
672 Ga0373959_0003844
673 Ga0373938_0038793
674 Ga0373928_0045918
675 Ga0373929_0005199
676 Ga0373945_0010359
677 Ga0373945_0055875
678 Ga0373945_0097273
679 Ga0373943_0010396
680 Ga0373955_0066596
681 Ga0373961_0007452
682 Ga0373931_0004684
683 Ga0373931_0010376
684 Ga0373931_0037748
685 Ga0373935_0043806
686 Ga0373935_0081769
687 Ga0373935_0082924
688 Ga0373935_0453085
689 Ga0373927_0059125
690 Ga0373927_0071592
691 Ga0373927_0125082
692 Ga0373933_0063558
693 Ga0373925_0253801
694 Ga0373925_0386380
695 Ga0436364_0160704
696 Ga0436365_0263703
697 Ga0436365_0478361
698 Ga0436365_0648212
699 Ga0439453_0001506
700 Ga0439446_0016262
701 Ga0439444_0032346
702 Ga0495592_0101476
703 Ga0495590_0020825
704 Ga0495629_0094222
705 Ga0495638_0018424
706 Ga0495638_0065606
707 Ga0495641_0087027
708 Ga0495653_0117928
709 Ga0495582_0010836
710 Ga0495596_0033512
711 Ga0495608_0015517
712 Ga0495616_0047834
713 Ga0495631_0032624
714 Ga0495666_0067088
715 Ga0495666_0100269
716 Ga0495665_0099206
717 Ga0495598_0026390
718 Ga0495667_0075027
719 Ga0495656_0066300
720 Ga0495635_0204586
721 Ga0495657_0054804
722 Ga0495599_0084253
723 Ga0495623_0028940
724 Ga0495647_0008340
725 Ga0495624_0060215
726 Ga0495600_0127832
727 Ga0495581_0175071
728 Ga0495674_0283464
729 Ga0495676_0169734
730 Ga0495675_0046739
731 Ga0495684_0222170
732 Ga0495602_0098980
733 Ga0495614_0066159
734 Ga0496100_0013827
735 Ga0496100_0030651
736 Ga0496101_0087962
737 Ga0496102_0014721
738 Ga0496102_0018925
739 Ga0496103_0003433
740 Ga0496104_0008328
741 Ga0496104_0031687
742 Ga0496105_0005267
743 Ga0496105_0013267
744 Ga0496106_0022133
745 Ga0496106_0036641
746 Ga0496107_0031093
747 Ga0496107_0043568
748 Ga0496107_0239520
749 Ga0496108_0297697
750 Ga0496109_0005059
751 Ga0496109_0456845
752 Ga0496110_0007159
753 Ga0496110_0037255
754 Ga0496111_0002676
755 Ga0496112_0053314
756 Ga0496112_0059485
757 Ga0496112_0093571
758 Ga0496112_0164259
759 Ga0496112_0284649
760 Ga0496113_0031277
761 Ga0496113_0166043
762 Ga0496114_0014116
763 Ga0496114_0044582
764 Ga0496115_0149141
765 Ga0501031_0011338
766 Ga0501031_0030154
767 Ga0501031_0171048
768 Ga0501032_0001675
769 Ga0501032_0035453
770 Ga0501032_0049652
771 Ga0501032_0078121
772 Ga0501032_0079273
773 Ga0501033_0011572
774 Ga0501033_0119834
775 Ga0501034_0002178
776 Ga0501034_0003787
777 Ga0501034_0027445
778 Ga0501034_0034515
779 Ga0501034_0054797
780 Ga0501034_0060334
781 Ga0501034_0061941
782 Ga0501034_0068012
783 Ga0501034_0069715
784 Ga0501034_0136414
785 Ga0501036_0001411
786 Ga0501036_0002142
787 Ga0501036_0047893
788 Ga0501036_0052349
789 Ga0501036_0148792
790 Ga0501036_0261588
791 Ga0501036_0263570
792 Ga0501036_0294499
793 Ga0501037_0006705
794 Ga0501037_0011489
795 Ga0501037_0016574
796 Ga0501037_0017581
797 Ga0501037_0040709
798 Ga0501038_0009362
799 Ga0501038_0034669
800 Ga0501038_0044223
801 Ga0501039_0013053
802 Ga0501039_0013645
803 Ga0501039_0033021
804 Ga0501039_0048235
805 Ga0501042_0036857
806 Ga0501042_0209441
807 Ga0501043_0004795
808 Ga0501043_0011410
809 Ga0501043_0014823
810 Ga0501043_0071441
811 Ga0501046_0000897
812 Ga0501046_0009727
813 Ga0501046_0021558
814 Ga0501046_0031250
815 Ga0501047_0000073
816 Ga0501047_0003886
817 Ga0501047_0028371
818 Ga0501047_0043113
819 Ga0501047_0057566
820 Ga0501047_0081357
821 Ga0501047_0087580
822 Ga0501048_0001292
823 Ga0501048_0002123
824 Ga0501048_0044328
825 Ga0501048_0076479
826 Ga0501068_0025836
827 Ga0501068_0129499
828 Ga0501069_0002621
829 Ga0501069_0017027
830 Ga0501069_0032684
831 Ga0501070_0010307
832 Ga0501070_0028108
833 Ga0501070_0033612
834 Ga0501070_0038226
835 Ga0501070_0114622
836 Ga0501071_0014406
837 Ga0501071_0066856
838 Ga0501073_0015133
839 Ga0501073_0018653
840 Ga0501073_0028524
841 Ga0501073_0048984
842 Ga0501073_0130146
843 Ga0501074_0004023
844 Ga0501074_0036326
845 Ga0501074_0071276
846 Ga0501074_0093626
847 Ga0501074_0099774
848 Ga0501074_0135135
849 Ga0501079_0029344
850 Ga0501080_0000351
851 Ga0501080_0044146
852 Ga0501080_0047301
853 Ga0501080_0063056
854 Ga0501080_0081970
855 Ga0501080_0104262
856 Ga0501080_0243933
857 Ga0501083_0028269
858 Ga0501083_0107148
859 Ga0501035_0026857
860 Ga0501035_0044906
861 Ga0501035_0092848
862 Ga0501035_0099039
863 Ga0501044_0002698
864 Ga0501044_0003367
865 Ga0501044_0031241
866 Ga0501044_0048180
867 Ga0501044_0096570
868 Ga0501044_0138382
869 Ga0501045_0019014
870 nmdc:mga03683_39912_c1
871 nmdc:mga00v17_157860_c1
872 nmdc:mga0yw44_35026_c1
873 nmdc:mga0k408_166100_c1
874 nmdc:mga0k408_17841_c1
875 nmdc:mga0k408_61516_c1
876 nmdc:mga06z11_25175_c1
877 nmdc:mga06z11_6656_c1
878 nmdc:mga07m45_164486_c1
879 nmdc:mga05p37_467310_c1
880 nmdc:mga0qj67_18_c1
881 nmdc:mga0qj67_83065_c1
882 nmdc:mga0a205_26454_c1
883 Ga0495601_0111825
884 Ga0495601_0285411
885 Ga0495595_0059228
886 Ga0495619_0046605
887 Ga0495619_0062552
888 Ga0500616_0015763
889 Ga0501084_0040599
890 Ga0501084_0096340
891 Ga0501084_0149313
892 Ga0501082_0025800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

153

316

0.91

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

24

112

0.91

Map