F445439

General Info

Members Datasets Scaffolds Average Seq Length
445 229 890 112

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100882960|Ga0070708_1008829602
Length 127
Sequence MTHLKPINQKANRVVDHVTASADPKDDVSRRSESEPAKADVVALQQTPQQPHFPLGCSLVFSPGWEADQNGGTAGLCQPVERDIFDCHIGCFWPAQVPDQLNHAPDWTAKCASAQKDWRKLDLVFPG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
164 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
165 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
166 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
167 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 3.6
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 19.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100882960 3300005445 Unclassified 840
2 Ga0058861_11907508 3300004800 Bacteria 2359
3 Ga0065712_10070134 3300005290 Bacteria 6297
4 Ga0070658_10549523 3300005327 Bacteria 999
5 Ga0070690_100006339 3300005330 Bacteria 6708
6 Ga0070690_100207826 3300005330 Bacteria 1365
7 Ga0070670_100315907 3300005331 Bacteria 1368
8 Ga0070670_100943434 3300005331 Unclassified 783
9 Ga0070677_10137332 3300005333 Bacteria 1123
10 Ga0070666_10003505 3300005335 Bacteria 9510
11 Ga0070666_10290469 3300005335 Bacteria 1163
12 Ga0070680_100172539 3300005336 Bacteria 1820
13 Ga0070680_100439991 3300005336 Bacteria 1113
14 Ga0070680_100616424 3300005336 Bacteria 932
15 Ga0070682_100028968 3300005337 Bacteria 3333
16 Ga0068868_100194954 3300005338 Bacteria 1686
17 Ga0068868_101792943 3300005338 Unclassified 580
18 Ga0070660_100009716 3300005339 Bacteria 6779
19 Ga0070687_100050531 3300005343 Bacteria 2148
20 Ga0070687_100194755 3300005343 Bacteria 1224
21 Ga0070687_101236328 3300005343 Bacteria 552
22 Ga0070661_100605247 3300005344 Unclassified 886
23 Ga0070692_10606293 3300005345 Bacteria 725
24 Ga0070692_11010762 3300005345 Unclassified 582
25 Ga0070675_100028193 3300005354 Bacteria 4518
26 Ga0070675_101678073 3300005354 Bacteria 586
27 Ga0070671_100112681 3300005355 Bacteria 2285
28 Ga0070674_100038046 3300005356 Bacteria 3240
29 Ga0070673_100121065 3300005364 Bacteria 2183
30 Ga0070673_101156263 3300005364 Bacteria 724
31 Ga0070673_101609124 3300005364 Viruses 614
32 Ga0070688_100552389 3300005365 Unclassified 875
33 Ga0070659_100068319 3300005366 Bacteria 2819
34 Ga0070667_100329993 3300005367 Bacteria 1378
35 Ga0070714_100055669 3300005435 Bacteria 3381
36 Ga0070713_101775689 3300005436 Unclassified 599
37 Ga0070710_11252185 3300005437 Unclassified 550
38 Ga0070701_10011047 3300005438 Bacteria 4018
39 Ga0070701_10647566 3300005438 Unclassified 705
40 Ga0070701_11020557 3300005438 Unclassified 578
41 Ga0070701_11127973 3300005438 Bacteria 553
42 Ga0070711_100093055 3300005439 Bacteria 2176
43 Ga0070711_102022334 3300005439 Unclassified 507
44 Ga0070705_100099374 3300005440 Bacteria 1833
45 Ga0070700_100004254 3300005441 Bacteria 7474
46 Ga0070700_100162132 3300005441 Bacteria 1540
47 Ga0070700_101215070 3300005441 Bacteria 630
48 Ga0070694_100051155 3300005444 Bacteria 2787
49 Ga0070694_100584370 3300005444 Bacteria 898
50 Ga0070708_100135730 3300005445 Bacteria 2279
51 Ga0070708_101362795 3300005445 Unclassified 662
52 Ga0070678_100095180 3300005456 Bacteria 2294
53 Ga0070662_100281519 3300005457 Bacteria 1346
54 Ga0070681_10002700 3300005458 Bacteria 16316
55 Ga0070681_10051469 3300005458 Bacteria 4108
56 Ga0070681_10954021 3300005458 Bacteria 777
57 Ga0068867_100013401 3300005459 Bacteria 5809
58 Ga0068867_100277471 3300005459 Bacteria 1373
59 Ga0070685_11265335 3300005466 Bacteria 563
60 Ga0070707_100017125 3300005468 Bacteria 6807
61 Ga0070707_100305939 3300005468 Bacteria 1545
62 Ga0070698_100296041 3300005471 Bacteria 1549
63 Ga0070698_100514107 3300005471 Bacteria 1136
64 Ga0070698_100695081 3300005471 Bacteria 959
65 Ga0070698_101157550 3300005471 Unclassified 722
66 Ga0070699_100004282 3300005518 Bacteria 12617
67 Ga0070699_100006151 3300005518 Bacteria 10490
68 Ga0070699_100038108 3300005518 Unclassified 4163
69 Ga0070699_100439714 3300005518 Bacteria 1182
70 Ga0070699_101585451 3300005518 Bacteria 600
71 Ga0070679_100083180 3300005530 Bacteria 3190
72 Ga0070679_100369867 3300005530 Bacteria 1381
73 Ga0070697_100775673 3300005536 Bacteria 848
74 Ga0070697_101381927 3300005536 Bacteria 629
75 Ga0070697_101716638 3300005536 Bacteria 562
76 Ga0070697_101757179 3300005536 Unclassified 555
77 Ga0070697_102091788 3300005536 Unclassified 507
78 Ga0068853_101221751 3300005539 Bacteria 726
79 Ga0070686_100001298 3300005544 Bacteria 14134
80 Ga0070686_100336061 3300005544 Bacteria 1131
81 Ga0070695_100008954 3300005545 Bacteria 5947
82 Ga0070695_100008966 3300005545 Bacteria 5943
83 Ga0070695_100103265 3300005545 Unclassified 1923
84 Ga0070696_100071577 3300005546 Bacteria 2440
85 Ga0070696_100371884 3300005546 Unclassified 1112
86 Ga0070696_100539704 3300005546 Bacteria 933
87 Ga0070665_100004694 3300005548 Bacteria 14263
88 Ga0070704_100004393 3300005549 Bacteria 8142
89 Ga0070704_100024073 3300005549 Viruses 3990
90 Ga0070704_100111557 3300005549 Bacteria 2082
91 Ga0068855_100444699 3300005563 Bacteria 1415
92 Ga0068855_100676721 3300005563 Bacteria 1106
93 Ga0070664_100352053 3300005564 Bacteria 1340
94 Ga0070664_100622285 3300005564 Bacteria 1002
95 Ga0068857_100023070 3300005577 Bacteria 5473
96 Ga0068857_100143200 3300005577 Bacteria 2162
97 Ga0068854_100009769 3300005578 Bacteria 6204
98 Ga0068854_100017906 3300005578 Bacteria 4749
99 Ga0068854_102166572 3300005578 Bacteria 514
100 Ga0070702_100008508 3300005615 Bacteria 4975
101 Ga0068859_100044821 3300005617 Bacteria 4444
102 Ga0068859_101347714 3300005617 Bacteria 787
103 Ga0068864_100035362 3300005618 Bacteria 4253
104 Ga0068864_100951038 3300005618 Bacteria 850
105 Ga0068866_10507539 3300005718 Bacteria 799
106 Ga0068861_100005897 3300005719 Bacteria 8324
107 Ga0068861_102594769 3300005719 Bacteria 511
108 Ga0068851_10112761 3300005834 Bacteria 1453
109 Ga0068870_11378328 3300005840 Unclassified 516
110 Ga0068863_102240993 3300005841 Bacteria 556
111 Ga0068858_100013542 3300005842 Bacteria 7697
112 Ga0068858_100623581 3300005842 Unclassified 1047
113 Ga0068858_101380743 3300005842 Bacteria 694
114 Ga0068860_100984056 3300005843 Bacteria 861
115 Ga0068860_102205407 3300005843 Bacteria 572
116 Ga0068862_100422506 3300005844 Bacteria 1251
117 Ga0068862_101294358 3300005844 Unclassified 730
118 Ga0068862_101947632 3300005844 Bacteria 598
119 Ga0081455_10333908 3300005937 Bacteria 1075
120 Ga0070717_10360033 3300006028 Bacteria 1302
121 Ga0070716_100321155 3300006173 Bacteria 1085
122 Ga0070716_100768677 3300006173 Bacteria 743
123 Ga0075366_10824984 3300006195 Bacteria 577
124 Ga0097621_100028175 3300006237 Bacteria 4426
125 Ga0097621_100069628 3300006237 Bacteria 2905
126 Ga0068871_100005991 3300006358 Bacteria 8557
127 Ga0068871_100350495 3300006358 Unclassified 1306
128 Ga0075428_100044145 3300006844 Bacteria 4899
129 Ga0075428_100082861 3300006844 Bacteria 3499
130 Ga0075428_100190073 3300006844 Unclassified 2221
131 Ga0075428_100608456 3300006844 Unclassified 1167
132 Ga0075428_101823994 3300006844 Unclassified 633
133 Ga0075430_100068733 3300006846 Unclassified 2972
134 Ga0075430_100440265 3300006846 Unclassified 1076
135 Ga0075431_100002439 3300006847 Bacteria 17891
136 Ga0075431_100039110 3300006847 Unclassified 4885
137 Ga0075431_100573990 3300006847 Bacteria 1114
138 Ga0075431_100720020 3300006847 Bacteria 975
139 Ga0075431_102040080 3300006847 Bacteria 529
140 Ga0075433_10203187 3300006852 Bacteria 1761
141 Ga0075433_10430226 3300006852 Unclassified 1164
142 Ga0075433_10526643 3300006852 Bacteria 1040
143 Ga0075433_10867719 3300006852 Bacteria 788
144 Ga0075434_100000411 3300006871 Bacteria 31670
145 Ga0075434_100016269 3300006871 Bacteria 7150
146 Ga0075434_100259975 3300006871 Bacteria 1755
147 Ga0075434_100700860 3300006871 Bacteria 1030
148 Ga0075434_101161373 3300006871 Unclassified 785
149 Ga0075434_101867101 3300006871 Unclassified 607
150 Ga0075434_102080227 3300006871 Bacteria 572
151 Ga0075429_101130749 3300006880 Unclassified 684
152 Ga0075436_100002726 3300006914 Bacteria 12147
153 Ga0075436_100008331 3300006914 Bacteria 7089
154 Ga0075436_100033528 3300006914 Bacteria 3540
155 Ga0075436_100042847 3300006914 Bacteria 3121
156 Ga0075436_100203786 3300006914 Bacteria 1401
157 Ga0075436_100323811 3300006914 Bacteria 1107
158 Ga0075436_100515302 3300006914 Bacteria 876
159 Ga0075436_100974499 3300006914 Bacteria 636
160 Ga0097620_100044821 3300006931 Bacteria 4444
161 Ga0097620_101347763 3300006931 Bacteria 787
162 Ga0075435_100000026 3300007076 Bacteria 87101
163 Ga0075435_100000288 3300007076 Bacteria 31268
164 Ga0075435_100004007 3300007076 Bacteria 10068
165 Ga0075435_100015737 3300007076 Bacteria 5690
166 Ga0075435_100039238 3300007076 Bacteria 3778
167 Ga0075435_100243969 3300007076 Bacteria 1528
168 Ga0075435_102035791 3300007076 Bacteria 504
169 Ga0105240_10028197 3300009093 Bacteria 7337
170 Ga0105240_10366116 3300009093 Bacteria 1631
171 Ga0105240_11329700 3300009093 Bacteria 757
172 Ga0105240_11507983 3300009093 Bacteria 705
173 Ga0111539_10004053 3300009094 Bacteria 19239
174 Ga0111539_10056933 3300009094 Unclassified 4644
175 Ga0105245_10028713 3300009098 Bacteria 4908
176 Ga0105245_10117999 3300009098 Bacteria 2476
177 Ga0105245_10146708 3300009098 Unclassified 2227
178 Ga0105245_10518361 3300009098 Bacteria 1210
179 Ga0105247_11039567 3300009101 Unclassified 642
180 Ga0114129_10004177 3300009147 Bacteria 20401
181 Ga0114129_10010440 3300009147 Bacteria 13244
182 Ga0114129_10301236 3300009147 Bacteria 2136
183 Ga0114129_10518034 3300009147 Bacteria 1555
184 Ga0114129_11133360 3300009147 Bacteria 978
185 Ga0114129_11355488 3300009147 Bacteria 879
186 Ga0105243_10194318 3300009148 Bacteria 1775
187 Ga0105241_10280221 3300009174 Unclassified 1423
188 Ga0105241_10494039 3300009174 Unclassified 1090
189 Ga0105241_11681497 3300009174 Unclassified 616
190 Ga0105242_10158329 3300009176 Bacteria 1980
191 Ga0105242_10497999 3300009176 Bacteria 1158
192 Ga0105242_10511963 3300009176 Unclassified 1143
193 Ga0105242_12443914 3300009176 Bacteria 570
194 Ga0105248_10002799 3300009177 Bacteria 19392
195 Ga0105248_10087334 3300009177 Bacteria 3510
196 Ga0105248_10136763 3300009177 Bacteria 2764
197 Ga0105248_10212460 3300009177 Bacteria 2180
198 Ga0105237_10146274 3300009545 Bacteria 2358
199 Ga0105238_10649065 3300009551 Bacteria 1065
200 Ga0105249_10964818 3300009553 Bacteria 921
201 Ga0099796_10281930 3300010159 Bacteria 699
202 Ga0105239_10318722 3300010375 Bacteria 1753
203 Ga0157369_12490834 3300013105 Unclassified 524
204 Ga0157374_10022231 3300013296 Bacteria 5656
205 Ga0157378_10130472 3300013297 Bacteria 2326
206 Ga0157378_10818689 3300013297 Bacteria 958
207 Ga0157378_10880544 3300013297 Unclassified 925
208 Ga0163162_10221741 3300013306 Bacteria 2021
209 Ga0163162_10242247 3300013306 Bacteria 1934
210 Ga0157375_10386948 3300013308 Bacteria 1565
211 Ga0163163_10004541 3300014325 Bacteria 11855
212 Ga0163163_10260326 3300014325 Bacteria 1786
213 Ga0163163_10538316 3300014325 Bacteria 1230
214 Ga0157380_10844002 3300014326 Bacteria 937
215 Ga0157380_11706428 3300014326 Bacteria 687
216 Ga0157380_13398760 3300014326 Bacteria 509
217 Ga0182008_10648642 3300014497 Bacteria 598
218 Ga0157379_10044660 3300014968 Bacteria 3956
219 Ga0157376_10119139 3300014969 Bacteria 2336
220 Ga0157376_10248596 3300014969 Bacteria 1660
221 Ga0157376_12156165 3300014969 Bacteria 596
222 Ga0182005_1164803 3300015265 Bacteria 651
223 Ga0207697_10140864 3300025315 Bacteria 1046
224 Ga0207682_10071936 3300025893 Bacteria 1467
225 Ga0207692_10413427 3300025898 Bacteria 843
226 Ga0207692_11030981 3300025898 Unclassified 544
227 Ga0207710_10010585 3300025900 Bacteria 3885
228 Ga0207688_10026949 3300025901 Bacteria 3161
229 Ga0207680_10017930 3300025903 Bacteria 3749
230 Ga0207680_10206772 3300025903 Bacteria 1340
231 Ga0207685_10165162 3300025905 Bacteria 1014
232 Ga0207685_10800864 3300025905 Bacteria 519
233 Ga0207699_10369742 3300025906 Bacteria 1016
234 Ga0207645_10002325 3300025907 Bacteria 15022
235 Ga0207643_10395078 3300025908 Bacteria 873
236 Ga0207684_11202997 3300025910 Bacteria 627
237 Ga0207654_10244452 3300025911 Unclassified 1200
238 Ga0207707_10055731 3300025912 Unclassified 3438
239 Ga0207707_10075460 3300025912 Bacteria 2941
240 Ga0207707_10411968 3300025912 Bacteria 1159
241 Ga0207707_11338100 3300025912 Bacteria 574
242 Ga0207695_10781633 3300025913 Bacteria 835
243 Ga0207695_10955178 3300025913 Bacteria 737
244 Ga0207695_11057338 3300025913 Bacteria 691
245 Ga0207671_10181882 3300025914 Unclassified 1636
246 Ga0207663_11410497 3300025916 Bacteria 561
247 Ga0207660_10158769 3300025917 Bacteria 1743
248 Ga0207662_10271700 3300025918 Bacteria 1119
249 Ga0207662_10905427 3300025918 Bacteria 625
250 Ga0207652_10048602 3300025921 Bacteria 3627
251 Ga0207652_10532720 3300025921 Bacteria 1056
252 Ga0207646_10029624 3300025922 Bacteria 4971
253 Ga0207646_10666155 3300025922 Bacteria 932
254 Ga0207646_11242411 3300025922 Bacteria 652
255 Ga0207646_11288768 3300025922 Unclassified 638
256 Ga0207681_10031975 3300025923 Bacteria 3441
257 Ga0207681_10216336 3300025923 Bacteria 1480
258 Ga0207650_10898655 3300025925 Unclassified 752
259 Ga0207659_10047297 3300025926 Bacteria 3043
260 Ga0207659_11266059 3300025926 Bacteria 633
261 Ga0207687_10040248 3300025927 Bacteria 3203
262 Ga0207687_10044136 3300025927 Bacteria 3074
263 Ga0207687_10164775 3300025927 Unclassified 1704
264 Ga0207700_11303850 3300025928 Bacteria 647
265 Ga0207664_10861626 3300025929 Bacteria 814
266 Ga0207644_10947131 3300025931 Unclassified 722
267 Ga0207690_10087611 3300025932 Bacteria 2191
268 Ga0207706_10151264 3300025933 Bacteria 2041
269 Ga0207706_10289000 3300025933 Bacteria 1429
270 Ga0207686_10100482 3300025934 Bacteria 1930
271 Ga0207686_10641951 3300025934 Bacteria 839
272 Ga0207709_10027780 3300025935 Bacteria 3264
273 Ga0207670_10161436 3300025936 Bacteria 1673
274 Ga0207670_11008170 3300025936 Bacteria 701
275 Ga0207669_10103562 3300025937 Bacteria 1888
276 Ga0207704_10127142 3300025938 Bacteria 1757
277 Ga0207665_10151471 3300025939 Unclassified 1661
278 Ga0207665_10199428 3300025939 Bacteria 1457
279 Ga0207691_10086821 3300025940 Bacteria 2807
280 Ga0207691_10798576 3300025940 Bacteria 793
281 Ga0207711_10031100 3300025941 Bacteria 4505
282 Ga0207711_10109313 3300025941 Bacteria 2457
283 Ga0207711_10116926 3300025941 Bacteria 2378
284 Ga0207711_10124286 3300025941 Bacteria 2306
285 Ga0207667_10408395 3300025949 Bacteria 1382
286 Ga0207651_10401453 3300025960 Bacteria 1166
287 Ga0207651_11034642 3300025960 Viruses 735
288 Ga0207651_11063885 3300025960 Bacteria 724
289 Ga0207640_10016643 3300025981 Bacteria 4283
290 Ga0207640_10040640 3300025981 Bacteria 2952
291 Ga0207640_11172731 3300025981 Bacteria 682
292 Ga0207640_11759082 3300025981 Bacteria 560
293 Ga0207658_10302765 3300025986 Bacteria 1378
294 Ga0207677_10291085 3300026023 Bacteria 1345
295 Ga0207703_10008188 3300026035 Bacteria 8259
296 Ga0207703_11823454 3300026035 Unclassified 584
297 Ga0207639_10478699 3300026041 Bacteria 1134
298 Ga0207708_10009050 3300026075 Bacteria 7366
299 Ga0207641_10120799 3300026088 Bacteria 2338
300 Ga0207641_11125809 3300026088 Unclassified 784
301 Ga0207648_10011601 3300026089 Bacteria 8297
302 Ga0207648_12261354 3300026089 Bacteria 504
303 Ga0207676_10019012 3300026095 Bacteria 5005
304 Ga0207676_10364557 3300026095 Bacteria 1340
305 Ga0207676_10399913 3300026095 Bacteria 1283
306 Ga0207674_10028423 3300026116 Bacteria 5902
307 Ga0207674_10091050 3300026116 Bacteria 3041
308 Ga0207674_10642895 3300026116 Bacteria 1024
309 Ga0207675_100000688 3300026118 Bacteria 33349
310 Ga0207675_100758602 3300026118 Unclassified 982
311 Ga0207675_101583286 3300026118 Bacteria 676
312 Ga0207675_101700171 3300026118 Bacteria 651
313 Ga0207675_102456779 3300026118 Unclassified 533
314 Ga0207683_10121733 3300026121 Bacteria 2343
315 Ga0207683_10620576 3300026121 Bacteria 1001
316 Ga0207698_10282084 3300026142 Bacteria 1537
317 Ga0207698_11467631 3300026142 Bacteria 697
318 Ga0209981_1046859 3300027378 Unclassified 651
319 Ga0209971_1023185 3300027682 Unclassified 1480
320 Ga0207428_10010684 3300027907 Bacteria 8189
321 Ga0207428_10088087 3300027907 Bacteria 2414
322 Ga0268266_10015656 3300028379 Bacteria 6498
323 Ga0268266_11959407 3300028379 Bacteria 559
324 Ga0268265_11845364 3300028380 Bacteria 611
325 Ga0268265_12217690 3300028380 Bacteria 556
326 Ga0268264_10036766 3300028381 Bacteria 4035
327 Ga0265760_10379849 3300031090 Unclassified 508
328 Ga0307416_101022459 3300032002 Bacteria 930
329 Ga0307415_102317154 3300032126 Bacteria 527
330 Ga0373930_0006219 3300034816 Unclassified 2011
331 Ga0373948_0009646 3300034817 Bacteria 1669
332 Ga0373948_0209825 3300034817 Bacteria 511
333 Ga0373950_0107547 3300034818 Bacteria 606
334 Ga0373958_0075387 3300034819 Bacteria 755
335 Ga0373938_0000456 3300034957 Bacteria 6662
336 Ga0373928_0024045 3300035084 Unclassified 1303
337 Ga0373929_0001757 3300035085 Bacteria 4074
338 Ga0373929_0238810 3300035085 Unclassified 523
339 Ga0373940_0266552 3300035088 Bacteria 581
340 Ga0373949_0001859 3300035090 Bacteria 5737
341 Ga0373951_0019245 3300035091 Bacteria 1555
342 Ga0373952_0025703 3300035092 Unclassified 1273
343 Ga0373932_0001302 3300035112 Bacteria 7037
344 Ga0373939_0000266 3300035114 Bacteria 13992
345 Ga0373941_0000432 3300035115 Bacteria 8313
346 Ga0373960_0001938 3300035121 Bacteria 4640
347 Ga0373955_0055297 3300035172 Unclassified 2173
348 Ga0373961_0001103 3300035241 Bacteria 8567
349 Ga0373962_0105226 3300035242 Unclassified 884
350 Ga0373962_0319118 3300035242 Unclassified 555
351 Ga0316574_0260229 3300035398 Bacteria 1108
352 Ga0373931_0003144 3300035691 Bacteria 7369
353 Ga0373937_0245413 3300036401 Unclassified 1688
354 Ga0373937_0406159 3300036401 Unclassified 1292
355 Ga0373937_0817283 3300036401 Unclassified 880
356 Ga0373925_0066484 3300037068 Bacteria 2718
357 Ga0242420_145203 3300038996 Unclassified 530
358 Ga0439433_0003858 3300041999 Bacteria 3224
359 Ga0439435_0073554 3300042436 Bacteria 1015
360 Ga0450916_009954 3300042530 Bacteria 1181
361 Ga0466963_0599978 3300044694 Bacteria 778
362 Ga0466960_0341568 3300044901 Bacteria 852
363 Ga0451576_0019928 3300045051 Bacteria 7311
364 Ga0466967_0481777 3300045976 Unclassified 1216
365 Ga0466967_0521401 3300045976 Bacteria 1168
366 Ga0495651_0347264 3300046462 Bacteria 981
367 Ga0495580_0011743 3300046472 Bacteria 6764
368 Ga0495665_0135766 3300046531 Bacteria 1287
369 Ga0495659_0253556 3300046664 Unclassified 734
370 Ga0495657_0508262 3300046675 Bacteria 702
371 Ga0495669_0146593 3300046684 Bacteria 1116
372 Ga0495669_0425686 3300046684 Bacteria 644
373 Ga0495674_0069900 3300047319 Bacteria 3035
374 Ga0495674_1031513 3300047319 Bacteria 629
375 Ga0495684_1006916 3300047471 Unclassified 529
376 Ga0496102_0246282 3300048905 Bacteria 1685
377 Ga0496102_0780147 3300048905 Bacteria 878
378 Ga0496103_0735868 3300048906 Bacteria 624
379 Ga0496103_0763082 3300048906 Bacteria 611
380 Ga0496104_0135627 3300048907 Bacteria 2365
381 Ga0496106_0197645 3300048909 Bacteria 1600
382 Ga0496106_0225931 3300048909 Bacteria 1494
383 Ga0496106_0538439 3300048909 Bacteria 937
384 Ga0496107_0174885 3300048910 Unclassified 1594
385 Ga0496107_0295600 3300048910 Bacteria 1205
386 Ga0496109_0361863 3300048912 Bacteria 1371
387 Ga0496110_1234795 3300048913 Unclassified 656
388 Ga0496111_0415807 3300048914 Bacteria 993
389 Ga0496112_0764420 3300048915 Bacteria 892
390 Ga0496112_1850523 3300048915 Bacteria 515
391 Ga0496115_0040079 3300048918 Bacteria 3722
392 Ga0501039_0430585 3300049575 Bacteria 1036
393 Ga0501071_0344397 3300049587 Unclassified 1134
394 Ga0501072_1413546 3300049588 Unclassified 538
395 Ga0501075_0324551 3300049591 Bacteria 1173
396 Ga0501075_1458923 3300049591 Unclassified 518
397 Ga0501081_0320503 3300049743 Bacteria 1139
398 Ga0501081_0748461 3300049743 Bacteria 734
399 nmdc:mga06z11_830598_c1 3300050494 Bacteria 563
400 nmdc:mga05p37_10256_c1 3300050507 Bacteria 11126
401 nmdc:mga05p37_1647103_c1 3300050507 Bacteria 629
402 nmdc:mga05p37_224352_c1 3300050507 Bacteria 2266
403 nmdc:mga05p37_480736_c1 3300050507 Unclassified 1431
404 nmdc:mga05p37_75289_c1 3300050507 Bacteria 4155
405 nmdc:mga09592_1500958_c1 3300050508 Bacteria 548
406 nmdc:mga09592_174669_c1 3300050508 Bacteria 1858
407 nmdc:mga0qj67_446362_c1 3300050509 Unclassified 1042
408 nmdc:mga0qj67_60943_c1 3300050509 Unclassified 2995
409 nmdc:mga06r32_261031_c1 3300050510 Unclassified 1720
410 nmdc:mga06r32_42184_c1 3300050510 Bacteria 4337
411 nmdc:mga06r32_639573_c1 3300050510 Bacteria 1032
412 nmdc:mga08y16_11455_c1 3300050511 Bacteria 9318
413 nmdc:mga08y16_8838_c1 3300050511 Bacteria 10573
414 nmdc:mga0n895_106650_c1 3300050512 Bacteria 2815
415 nmdc:mga0n895_1330522_c1 3300050512 Unclassified 688
416 nmdc:mga0n895_1715_c1 3300050512 Bacteria 16545
417 nmdc:mga0n895_321421_c1 3300050512 Bacteria 1568
418 nmdc:mga0n895_368_c1 3300050512 Bacteria 30451
419 nmdc:mga0n895_551396_c1 3300050512 Unclassified 1158
420 nmdc:mga0n895_668459_c1 3300050512 Unclassified 1036
421 nmdc:mga0n895_700419_c1 3300050512 Bacteria 1009
422 nmdc:mga0n895_761097_c1 3300050512 Bacteria 961
423 nmdc:mga0rr50_10_c1 3300050513 Bacteria 218067
424 nmdc:mga0rr50_119246_c1 3300050513 Bacteria 2098
425 nmdc:mga0rr50_13908_c1 3300050513 Bacteria 5257
426 nmdc:mga0rr50_1801366_c1 3300050513 Bacteria 515
427 nmdc:mga0rr50_203313_c1 3300050513 Bacteria 1629
428 nmdc:mga0rr50_274421_c1 3300050513 Unclassified 1406
429 nmdc:mga0rr50_595354_c1 3300050513 Bacteria 942
430 nmdc:mga0rr50_603799_c1 3300050513 Bacteria 936
431 nmdc:mga0rr50_732_c1 3300050513 Bacteria 17703
432 nmdc:mga08x19_117_c1 3300050514 Bacteria 70876
433 nmdc:mga08x19_221300_c1 3300050514 Bacteria 1301
434 nmdc:mga08x19_231398_c1 3300050514 Unclassified 1272
435 nmdc:mga08x19_34863_c1 3300050514 Bacteria 3183
436 nmdc:mga08x19_7087_c1 3300050514 Bacteria 6655
437 nmdc:mga08x19_84392_c1 3300050514 Bacteria 2089
438 nmdc:mga0a205_170067_c1 3300050515 Bacteria 2075
439 nmdc:mga0a205_336924_c1 3300050515 Bacteria 1377
440 nmdc:mga0a205_691916_c1 3300050515 Bacteria 869
441 Ga0495655_0063778 3300053083 Bacteria 1012
442 Ga0495655_0226182 3300053083 Bacteria 621
443 Ga0587079_142028 3300059647 Bacteria 613
444 Ga0501082_1191063 3300060353 Bacteria 666
445 Ga0530510_0241079 3300061734 Bacteria 1346
446 Ga0070708_100882960
447 Ga0058861_11907508
448 Ga0065712_10070134
449 Ga0070658_10549523
450 Ga0070690_100006339
451 Ga0070690_100207826
452 Ga0070670_100315907
453 Ga0070670_100943434
454 Ga0070677_10137332
455 Ga0070666_10003505
456 Ga0070666_10290469
457 Ga0070680_100172539
458 Ga0070680_100439991
459 Ga0070680_100616424
460 Ga0070682_100028968
461 Ga0068868_100194954
462 Ga0068868_101792943
463 Ga0070660_100009716
464 Ga0070687_100050531
465 Ga0070687_100194755
466 Ga0070687_101236328
467 Ga0070661_100605247
468 Ga0070692_10606293
469 Ga0070692_11010762
470 Ga0070675_100028193
471 Ga0070675_101678073
472 Ga0070671_100112681
473 Ga0070674_100038046
474 Ga0070673_100121065
475 Ga0070673_101156263
476 Ga0070673_101609124
477 Ga0070688_100552389
478 Ga0070659_100068319
479 Ga0070667_100329993
480 Ga0070714_100055669
481 Ga0070713_101775689
482 Ga0070710_11252185
483 Ga0070701_10011047
484 Ga0070701_10647566
485 Ga0070701_11020557
486 Ga0070701_11127973
487 Ga0070711_100093055
488 Ga0070711_102022334
489 Ga0070705_100099374
490 Ga0070700_100004254
491 Ga0070700_100162132
492 Ga0070700_101215070
493 Ga0070694_100051155
494 Ga0070694_100584370
495 Ga0070708_100135730
496 Ga0070708_101362795
497 Ga0070678_100095180
498 Ga0070662_100281519
499 Ga0070681_10002700
500 Ga0070681_10051469
501 Ga0070681_10954021
502 Ga0068867_100013401
503 Ga0068867_100277471
504 Ga0070685_11265335
505 Ga0070707_100017125
506 Ga0070707_100305939
507 Ga0070698_100296041
508 Ga0070698_100514107
509 Ga0070698_100695081
510 Ga0070698_101157550
511 Ga0070699_100004282
512 Ga0070699_100006151
513 Ga0070699_100038108
514 Ga0070699_100439714
515 Ga0070699_101585451
516 Ga0070679_100083180
517 Ga0070679_100369867
518 Ga0070697_100775673
519 Ga0070697_101381927
520 Ga0070697_101716638
521 Ga0070697_101757179
522 Ga0070697_102091788
523 Ga0068853_101221751
524 Ga0070686_100001298
525 Ga0070686_100336061
526 Ga0070695_100008954
527 Ga0070695_100008966
528 Ga0070695_100103265
529 Ga0070696_100071577
530 Ga0070696_100371884
531 Ga0070696_100539704
532 Ga0070665_100004694
533 Ga0070704_100004393
534 Ga0070704_100024073
535 Ga0070704_100111557
536 Ga0068855_100444699
537 Ga0068855_100676721
538 Ga0070664_100352053
539 Ga0070664_100622285
540 Ga0068857_100023070
541 Ga0068857_100143200
542 Ga0068854_100009769
543 Ga0068854_100017906
544 Ga0068854_102166572
545 Ga0070702_100008508
546 Ga0068859_100044821
547 Ga0068859_101347714
548 Ga0068864_100035362
549 Ga0068864_100951038
550 Ga0068866_10507539
551 Ga0068861_100005897
552 Ga0068861_102594769
553 Ga0068851_10112761
554 Ga0068870_11378328
555 Ga0068863_102240993
556 Ga0068858_100013542
557 Ga0068858_100623581
558 Ga0068858_101380743
559 Ga0068860_100984056
560 Ga0068860_102205407
561 Ga0068862_100422506
562 Ga0068862_101294358
563 Ga0068862_101947632
564 Ga0081455_10333908
565 Ga0070717_10360033
566 Ga0070716_100321155
567 Ga0070716_100768677
568 Ga0075366_10824984
569 Ga0097621_100028175
570 Ga0097621_100069628
571 Ga0068871_100005991
572 Ga0068871_100350495
573 Ga0075428_100044145
574 Ga0075428_100082861
575 Ga0075428_100190073
576 Ga0075428_100608456
577 Ga0075428_101823994
578 Ga0075430_100068733
579 Ga0075430_100440265
580 Ga0075431_100002439
581 Ga0075431_100039110
582 Ga0075431_100573990
583 Ga0075431_100720020
584 Ga0075431_102040080
585 Ga0075433_10203187
586 Ga0075433_10430226
587 Ga0075433_10526643
588 Ga0075433_10867719
589 Ga0075434_100000411
590 Ga0075434_100016269
591 Ga0075434_100259975
592 Ga0075434_100700860
593 Ga0075434_101161373
594 Ga0075434_101867101
595 Ga0075434_102080227
596 Ga0075429_101130749
597 Ga0075436_100002726
598 Ga0075436_100008331
599 Ga0075436_100033528
600 Ga0075436_100042847
601 Ga0075436_100203786
602 Ga0075436_100323811
603 Ga0075436_100515302
604 Ga0075436_100974499
605 Ga0097620_100044821
606 Ga0097620_101347763
607 Ga0075435_100000026
608 Ga0075435_100000288
609 Ga0075435_100004007
610 Ga0075435_100015737
611 Ga0075435_100039238
612 Ga0075435_100243969
613 Ga0075435_102035791
614 Ga0105240_10028197
615 Ga0105240_10366116
616 Ga0105240_11329700
617 Ga0105240_11507983
618 Ga0111539_10004053
619 Ga0111539_10056933
620 Ga0105245_10028713
621 Ga0105245_10117999
622 Ga0105245_10146708
623 Ga0105245_10518361
624 Ga0105247_11039567
625 Ga0114129_10004177
626 Ga0114129_10010440
627 Ga0114129_10301236
628 Ga0114129_10518034
629 Ga0114129_11133360
630 Ga0114129_11355488
631 Ga0105243_10194318
632 Ga0105241_10280221
633 Ga0105241_10494039
634 Ga0105241_11681497
635 Ga0105242_10158329
636 Ga0105242_10497999
637 Ga0105242_10511963
638 Ga0105242_12443914
639 Ga0105248_10002799
640 Ga0105248_10087334
641 Ga0105248_10136763
642 Ga0105248_10212460
643 Ga0105237_10146274
644 Ga0105238_10649065
645 Ga0105249_10964818
646 Ga0099796_10281930
647 Ga0105239_10318722
648 Ga0157369_12490834
649 Ga0157374_10022231
650 Ga0157378_10130472
651 Ga0157378_10818689
652 Ga0157378_10880544
653 Ga0163162_10221741
654 Ga0163162_10242247
655 Ga0157375_10386948
656 Ga0163163_10004541
657 Ga0163163_10260326
658 Ga0163163_10538316
659 Ga0157380_10844002
660 Ga0157380_11706428
661 Ga0157380_13398760
662 Ga0182008_10648642
663 Ga0157379_10044660
664 Ga0157376_10119139
665 Ga0157376_10248596
666 Ga0157376_12156165
667 Ga0182005_1164803
668 Ga0207697_10140864
669 Ga0207682_10071936
670 Ga0207692_10413427
671 Ga0207692_11030981
672 Ga0207710_10010585
673 Ga0207688_10026949
674 Ga0207680_10017930
675 Ga0207680_10206772
676 Ga0207685_10165162
677 Ga0207685_10800864
678 Ga0207699_10369742
679 Ga0207645_10002325
680 Ga0207643_10395078
681 Ga0207684_11202997
682 Ga0207654_10244452
683 Ga0207707_10055731
684 Ga0207707_10075460
685 Ga0207707_10411968
686 Ga0207707_11338100
687 Ga0207695_10781633
688 Ga0207695_10955178
689 Ga0207695_11057338
690 Ga0207671_10181882
691 Ga0207663_11410497
692 Ga0207660_10158769
693 Ga0207662_10271700
694 Ga0207662_10905427
695 Ga0207652_10048602
696 Ga0207652_10532720
697 Ga0207646_10029624
698 Ga0207646_10666155
699 Ga0207646_11242411
700 Ga0207646_11288768
701 Ga0207681_10031975
702 Ga0207681_10216336
703 Ga0207650_10898655
704 Ga0207659_10047297
705 Ga0207659_11266059
706 Ga0207687_10040248
707 Ga0207687_10044136
708 Ga0207687_10164775
709 Ga0207700_11303850
710 Ga0207664_10861626
711 Ga0207644_10947131
712 Ga0207690_10087611
713 Ga0207706_10151264
714 Ga0207706_10289000
715 Ga0207686_10100482
716 Ga0207686_10641951
717 Ga0207709_10027780
718 Ga0207670_10161436
719 Ga0207670_11008170
720 Ga0207669_10103562
721 Ga0207704_10127142
722 Ga0207665_10151471
723 Ga0207665_10199428
724 Ga0207691_10086821
725 Ga0207691_10798576
726 Ga0207711_10031100
727 Ga0207711_10109313
728 Ga0207711_10116926
729 Ga0207711_10124286
730 Ga0207667_10408395
731 Ga0207651_10401453
732 Ga0207651_11034642
733 Ga0207651_11063885
734 Ga0207640_10016643
735 Ga0207640_10040640
736 Ga0207640_11172731
737 Ga0207640_11759082
738 Ga0207658_10302765
739 Ga0207677_10291085
740 Ga0207703_10008188
741 Ga0207703_11823454
742 Ga0207639_10478699
743 Ga0207708_10009050
744 Ga0207641_10120799
745 Ga0207641_11125809
746 Ga0207648_10011601
747 Ga0207648_12261354
748 Ga0207676_10019012
749 Ga0207676_10364557
750 Ga0207676_10399913
751 Ga0207674_10028423
752 Ga0207674_10091050
753 Ga0207674_10642895
754 Ga0207675_100000688
755 Ga0207675_100758602
756 Ga0207675_101583286
757 Ga0207675_101700171
758 Ga0207675_102456779
759 Ga0207683_10121733
760 Ga0207683_10620576
761 Ga0207698_10282084
762 Ga0207698_11467631
763 Ga0209981_1046859
764 Ga0209971_1023185
765 Ga0207428_10010684
766 Ga0207428_10088087
767 Ga0268266_10015656
768 Ga0268266_11959407
769 Ga0268265_11845364
770 Ga0268265_12217690
771 Ga0268264_10036766
772 Ga0265760_10379849
773 Ga0307416_101022459
774 Ga0307415_102317154
775 Ga0373930_0006219
776 Ga0373948_0009646
777 Ga0373948_0209825
778 Ga0373950_0107547
779 Ga0373958_0075387
780 Ga0373938_0000456
781 Ga0373928_0024045
782 Ga0373929_0001757
783 Ga0373929_0238810
784 Ga0373940_0266552
785 Ga0373949_0001859
786 Ga0373951_0019245
787 Ga0373952_0025703
788 Ga0373932_0001302
789 Ga0373939_0000266
790 Ga0373941_0000432
791 Ga0373960_0001938
792 Ga0373955_0055297
793 Ga0373961_0001103
794 Ga0373962_0105226
795 Ga0373962_0319118
796 Ga0316574_0260229
797 Ga0373931_0003144
798 Ga0373937_0245413
799 Ga0373937_0406159
800 Ga0373937_0817283
801 Ga0373925_0066484
802 Ga0242420_145203
803 Ga0439433_0003858
804 Ga0439435_0073554
805 Ga0450916_009954
806 Ga0466963_0599978
807 Ga0466960_0341568
808 Ga0451576_0019928
809 Ga0466967_0481777
810 Ga0466967_0521401
811 Ga0495651_0347264
812 Ga0495580_0011743
813 Ga0495665_0135766
814 Ga0495659_0253556
815 Ga0495657_0508262
816 Ga0495669_0146593
817 Ga0495669_0425686
818 Ga0495674_0069900
819 Ga0495674_1031513
820 Ga0495684_1006916
821 Ga0496102_0246282
822 Ga0496102_0780147
823 Ga0496103_0735868
824 Ga0496103_0763082
825 Ga0496104_0135627
826 Ga0496106_0197645
827 Ga0496106_0225931
828 Ga0496106_0538439
829 Ga0496107_0174885
830 Ga0496107_0295600
831 Ga0496109_0361863
832 Ga0496110_1234795
833 Ga0496111_0415807
834 Ga0496112_0764420
835 Ga0496112_1850523
836 Ga0496115_0040079
837 Ga0501039_0430585
838 Ga0501071_0344397
839 Ga0501072_1413546
840 Ga0501075_0324551
841 Ga0501075_1458923
842 Ga0501081_0320503
843 Ga0501081_0748461
844 nmdc:mga06z11_830598_c1
845 nmdc:mga05p37_10256_c1
846 nmdc:mga05p37_1647103_c1
847 nmdc:mga05p37_224352_c1
848 nmdc:mga05p37_480736_c1
849 nmdc:mga05p37_75289_c1
850 nmdc:mga09592_1500958_c1
851 nmdc:mga09592_174669_c1
852 nmdc:mga0qj67_446362_c1
853 nmdc:mga0qj67_60943_c1
854 nmdc:mga06r32_261031_c1
855 nmdc:mga06r32_42184_c1
856 nmdc:mga06r32_639573_c1
857 nmdc:mga08y16_11455_c1
858 nmdc:mga08y16_8838_c1
859 nmdc:mga0n895_106650_c1
860 nmdc:mga0n895_1330522_c1
861 nmdc:mga0n895_1715_c1
862 nmdc:mga0n895_321421_c1
863 nmdc:mga0n895_368_c1
864 nmdc:mga0n895_551396_c1
865 nmdc:mga0n895_668459_c1
866 nmdc:mga0n895_700419_c1
867 nmdc:mga0n895_761097_c1
868 nmdc:mga0rr50_10_c1
869 nmdc:mga0rr50_119246_c1
870 nmdc:mga0rr50_13908_c1
871 nmdc:mga0rr50_1801366_c1
872 nmdc:mga0rr50_203313_c1
873 nmdc:mga0rr50_274421_c1
874 nmdc:mga0rr50_595354_c1
875 nmdc:mga0rr50_603799_c1
876 nmdc:mga0rr50_732_c1
877 nmdc:mga08x19_117_c1
878 nmdc:mga08x19_221300_c1
879 nmdc:mga08x19_231398_c1
880 nmdc:mga08x19_34863_c1
881 nmdc:mga08x19_7087_c1
882 nmdc:mga08x19_84392_c1
883 nmdc:mga0a205_170067_c1
884 nmdc:mga0a205_336924_c1
885 nmdc:mga0a205_691916_c1
886 Ga0495655_0063778
887 Ga0495655_0226182
888 Ga0587079_142028
889 Ga0501082_1191063
890 Ga0530510_0241079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08992

QH-AmDH_gamma

Quinohemoprotein amine dehydrogenase, gamma subunit

54

127

0.98

Map