F445364

General Info

Members Datasets Scaffolds Average Seq Length
444 240 442 80

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0150590|Ga0501072_0150590_1406_1690
Length 94
Sequence LGRLRFNARAQTHGAVMADPKQLLHLVFGGELESADEVTFKDLGKLDFVGMYPNFAEAKKAWAAKAQATVDNAQMRYFVVHIHRLIEPEADREH

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
232 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
238 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.11
Nodule 0.23
Rhizoplane 6.31
Rhizosphere 82.88
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10047147 3300001979 Bacteria 1260
2 JGI24740J21852_10057839 3300001979 Bacteria 1081
3 JGI25153J46596_10001205 3300003215 Bacteria 15650
4 rootH2_10061914 3300003320 Bacteria 1768
5 Ga0070658_10639595 3300005327 Bacteria 923
6 Ga0070658_10656471 3300005327 Bacteria 910
7 Ga0070676_11293561 3300005328 Bacteria 557
8 Ga0068869_100546569 3300005334 Bacteria 972
9 Ga0068869_100722388 3300005334 Bacteria 851
10 Ga0070680_101837543 3300005336 Bacteria 525
11 Ga0070680_101988721 3300005336 Unclassified 504
12 Ga0070660_100102026 3300005339 Bacteria 2274
13 Ga0070660_100794413 3300005339 Unclassified 796
14 Ga0070691_10318947 3300005341 Unclassified 854
15 Ga0070661_100211452 3300005344 Bacteria 1485
16 Ga0070668_100365960 3300005347 Unclassified 1224
17 Ga0070668_101051283 3300005347 Bacteria 733
18 Ga0070671_101807047 3300005355 Bacteria 543
19 Ga0070674_100240911 3300005356 Bacteria 1416
20 Ga0070659_100004063 3300005366 Bacteria 10436
21 Ga0070659_101897609 3300005366 Bacteria 534
22 Ga0070714_100017309 3300005435 Bacteria 5837
23 Ga0070714_100827875 3300005435 Unclassified 897
24 Ga0070713_100000004 3300005436 Bacteria 220768
25 Ga0070713_101052020 3300005436 Bacteria 786
26 Ga0070710_10223193 3300005437 Bacteria 1200
27 Ga0070710_10318076 3300005437 Unclassified 1021
28 Ga0070711_100020746 3300005439 Bacteria 4240
29 Ga0070711_100037853 3300005439 Bacteria 3239
30 Ga0070711_100143292 3300005439 Bacteria 1794
31 Ga0070705_101844807 3300005440 Unclassified 513
32 Ga0070700_101674234 3300005441 Bacteria 545
33 Ga0070678_100151084 3300005456 Bacteria 1871
34 Ga0070662_100762702 3300005457 Bacteria 821
35 Ga0070681_11360957 3300005458 Bacteria 633
36 Ga0068867_100452341 3300005459 Bacteria 1094
37 Ga0070679_101249174 3300005530 Unclassified 688
38 Ga0070684_100127100 3300005535 Bacteria 2297
39 Ga0068853_100427305 3300005539 Bacteria 1243
40 Ga0068853_100499512 3300005539 Bacteria 1148
41 Ga0068853_101026890 3300005539 Bacteria 794
42 Ga0068853_101627552 3300005539 Bacteria 626
43 Ga0070672_101620306 3300005543 Bacteria 581
44 Ga0070695_100407964 3300005545 Bacteria 1032
45 Ga0070696_100122022 3300005546 Bacteria 1887
46 Ga0070696_100205986 3300005546 Unclassified 1470
47 Ga0070693_100032622 3300005547 Bacteria 2866
48 Ga0068855_100098101 3300005563 Bacteria 3376
49 Ga0070664_102079056 3300005564 Unclassified 539
50 Ga0068857_100127398 3300005577 Bacteria 2294
51 Ga0068857_100187531 3300005577 Bacteria 1883
52 Ga0068857_100278608 3300005577 Bacteria 1538
53 Ga0068857_100458087 3300005577 Bacteria 1193
54 Ga0068856_100000474 3300005614 Bacteria 44385
55 Ga0068856_101146976 3300005614 Bacteria 794
56 Ga0068856_102273629 3300005614 Unclassified 551
57 Ga0070702_100528236 3300005615 Bacteria 872
58 Ga0068852_101249613 3300005616 Unclassified 764
59 Ga0068864_100101336 3300005618 Bacteria 2554
60 Ga0068864_100351210 3300005618 Unclassified 1391
61 Ga0068858_100068155 3300005842 Bacteria 3297
62 Ga0068858_102021961 3300005842 Bacteria 570
63 Ga0068862_100222302 3300005844 Unclassified 1710
64 Ga0081455_10000894 3300005937 Bacteria 38467
65 Ga0075363_100014511 3300006048 Bacteria 3852
66 Ga0075364_10113108 3300006051 Bacteria 1813
67 Ga0075432_10055236 3300006058 Bacteria 1407
68 Ga0075432_10588603 3300006058 Bacteria 507
69 Ga0070712_100000396 3300006175 Bacteria 24801
70 Ga0070712_100002805 3300006175 Bacteria 10774
71 Ga0070712_100183789 3300006175 Bacteria 1631
72 Ga0070712_100501648 3300006175 Bacteria 1017
73 Ga0070712_101128814 3300006175 Unclassified 681
74 Ga0075362_10035266 3300006177 Bacteria 2183
75 Ga0075362_10192949 3300006177 Bacteria 990
76 Ga0075367_10499047 3300006178 Bacteria 772
77 Ga0075369_10003492 3300006186 Bacteria 5725
78 Ga0075369_10303906 3300006186 Bacteria 745
79 Ga0075366_10000662 3300006195 Bacteria 16222
80 Ga0097621_100016270 3300006237 Bacteria 5617
81 Ga0097621_100270811 3300006237 Unclassified 1492
82 Ga0075370_11029773 3300006353 Bacteria 505
83 Ga0075428_100770768 3300006844 Bacteria 1023
84 Ga0075433_10004023 3300006852 Bacteria 11369
85 Ga0075434_100196460 3300006871 Unclassified 2037
86 Ga0075434_100274825 3300006871 Bacteria 1704
87 Ga0068865_100179506 3300006881 Bacteria 1629
88 Ga0075436_100000187 3300006914 Bacteria 38576
89 Ga0075436_101012469 3300006914 Unclassified 624
90 Ga0075435_100004990 3300007076 Bacteria 9212
91 Ga0075435_100986422 3300007076 Unclassified 735
92 Ga0105240_10583318 3300009093 Bacteria 1233
93 Ga0105240_11342014 3300009093 Bacteria 753
94 Ga0111539_10052846 3300009094 Bacteria 4836
95 Ga0111539_10065100 3300009094 Bacteria 4310
96 Ga0105245_11108921 3300009098 Bacteria 838
97 Ga0105247_11427314 3300009101 Bacteria 561
98 Ga0114129_10136747 3300009147 Bacteria 3362
99 Ga0105241_10523832 3300009174 Unclassified 1060
100 Ga0105241_10940425 3300009174 Bacteria 805
101 Ga0105242_10015932 3300009176 Bacteria 5841
102 Ga0105242_12494787 3300009176 Bacteria 565
103 Ga0105237_10363969 3300009545 Bacteria 1450
104 Ga0105237_12113592 3300009545 Bacteria 572
105 Ga0105238_10319394 3300009551 Bacteria 1539
106 Ga0105238_10777513 3300009551 Bacteria 972
107 Ga0105238_11225461 3300009551 Unclassified 775
108 Ga0105238_11521734 3300009551 Bacteria 698
109 Ga0105238_11757286 3300009551 Bacteria 652
110 Ga0105238_12473537 3300009551 Bacteria 555
111 Ga0105249_10512607 3300009553 Bacteria 1246
112 Ga0105239_10008191 3300010375 Bacteria 11924
113 Ga0105239_10675538 3300010375 Bacteria 1180
114 Ga0105239_11694145 3300010375 Unclassified 732
115 Ga0157370_10123840 3300013104 Bacteria 2414
116 Ga0157374_10484065 3300013296 Bacteria 1241
117 Ga0157374_12197873 3300013296 Bacteria 579
118 Ga0157378_10325535 3300013297 Unclassified 1494
119 Ga0157378_10493084 3300013297 Bacteria 1222
120 Ga0163162_10160816 3300013306 Bacteria 2367
121 Ga0163162_10185765 3300013306 Bacteria 2206
122 Ga0157372_11143460 3300013307 Bacteria 900
123 Ga0157375_10044238 3300013308 Bacteria 4324
124 Ga0163163_10002034 3300014325 Bacteria 17099
125 Ga0163163_10936025 3300014325 Bacteria 930
126 Ga0163163_12835803 3300014325 Bacteria 541
127 Ga0182008_10121636 3300014497 Bacteria 1298
128 Ga0157379_10001633 3300014968 Bacteria 18510
129 Ga0157379_10139787 3300014968 Bacteria 2183
130 Ga0157376_10457216 3300014969 Unclassified 1247
131 Ga0213873_10029598 3300021358 Bacteria 1351
132 Ga0213876_10051604 3300021384 Bacteria 2174
133 Ga0209563_111525 3300025230 Unclassified 1245
134 Ga0209455_1023947 3300025272 Bacteria 1135
135 Ga0209758_1000013 3300025297 Bacteria 873003
136 Ga0209758_1160721 3300025297 Bacteria 559
137 Ga0207692_10067664 3300025898 Unclassified 1871
138 Ga0207647_10149245 3300025904 Unclassified 1367
139 Ga0207699_10000307 3300025906 Bacteria 26162
140 Ga0207645_10505879 3300025907 Bacteria 818
141 Ga0207705_11403370 3300025909 Bacteria 531
142 Ga0207654_10391422 3300025911 Bacteria 965
143 Ga0207707_11092387 3300025912 Bacteria 650
144 Ga0207695_10109081 3300025913 Bacteria 2751
145 Ga0207695_10271190 3300025913 Bacteria 1592
146 Ga0207695_11560689 3300025913 Bacteria 541
147 Ga0207671_10034474 3300025914 Bacteria 3760
148 Ga0207671_10273222 3300025914 Bacteria 1332
149 Ga0207671_11170163 3300025914 Unclassified 602
150 Ga0207693_10001040 3300025915 Bacteria 24829
151 Ga0207693_10001139 3300025915 Bacteria 23823
152 Ga0207663_10015612 3300025916 Bacteria 4194
153 Ga0207663_10046901 3300025916 Bacteria 2665
154 Ga0207663_10208637 3300025916 Bacteria 1414
155 Ga0207660_11466738 3300025917 Bacteria 552
156 Ga0207657_10205788 3300025919 Bacteria 1581
157 Ga0207652_10418580 3300025921 Bacteria 1208
158 Ga0207652_11791104 3300025921 Unclassified 519
159 Ga0207694_10274826 3300025924 Bacteria 1382
160 Ga0207694_10597556 3300025924 Unclassified 928
161 Ga0207694_10982101 3300025924 Bacteria 714
162 Ga0207687_10147104 3300025927 Bacteria 1793
163 Ga0207700_10000011 3300025928 Bacteria 266323
164 Ga0207700_10067079 3300025928 Bacteria 2745
165 Ga0207700_10896107 3300025928 Bacteria 794
166 Ga0207664_10453297 3300025929 Unclassified 1145
167 Ga0207664_10654136 3300025929 Unclassified 945
168 Ga0207690_10021630 3300025932 Bacteria 3991
169 Ga0207690_11418894 3300025932 Bacteria 581
170 Ga0207706_10329898 3300025933 Bacteria 1327
171 Ga0207686_10037336 3300025934 Bacteria 2930
172 Ga0207669_10759472 3300025937 Bacteria 801
173 Ga0207704_10018343 3300025938 Bacteria 3650
174 Ga0207691_10295538 3300025940 Bacteria 1392
175 Ga0207689_10544177 3300025942 Bacteria 975
176 Ga0207689_10662965 3300025942 Bacteria 879
177 Ga0207667_10177316 3300025949 Bacteria 2189
178 Ga0207667_10257002 3300025949 Bacteria 1787
179 Ga0207667_10588114 3300025949 Bacteria 1123
180 Ga0207668_10639140 3300025972 Bacteria 930
181 Ga0207668_11249225 3300025972 Bacteria 668
182 Ga0207677_10554888 3300026023 Bacteria 1002
183 Ga0207703_10012743 3300026035 Bacteria 6557
184 Ga0207703_10509008 3300026035 Bacteria 1131
185 Ga0207639_10719367 3300026041 Bacteria 927
186 Ga0207639_10760722 3300026041 Bacteria 901
187 Ga0207639_10859354 3300026041 Unclassified 847
188 Ga0207708_11407312 3300026075 Bacteria 612
189 Ga0207702_10000164 3300026078 Bacteria 79231
190 Ga0207648_10033844 3300026089 Bacteria 4506
191 Ga0207676_10406777 3300026095 Bacteria 1273
192 Ga0207676_10456842 3300026095 Unclassified 1205
193 Ga0207674_10032889 3300026116 Bacteria 5436
194 Ga0207674_10268307 3300026116 Bacteria 1654
195 Ga0207674_10586937 3300026116 Bacteria 1076
196 Ga0207674_11094597 3300026116 Bacteria 766
197 Ga0207683_10082893 3300026121 Bacteria 2849
198 Ga0207428_10757509 3300027907 Unclassified 692
199 Ga0265338_10030421 3300028800 Bacteria 5319
200 Ga0265338_10117477 3300028800 Bacteria 2128
201 Ga0265338_10176621 3300028800 Bacteria 1632
202 Ga0265338_10802023 3300028800 Bacteria 645
203 Ga0265328_10008779 3300031239 Bacteria 4147
204 Ga0265320_10462232 3300031240 Bacteria 560
205 Ga0265325_10000226 3300031241 Bacteria 40024
206 Ga0265325_10001389 3300031241 Bacteria 17088
207 Ga0265325_10012432 3300031241 Bacteria 4867
208 Ga0265325_10094772 3300031241 Bacteria 1468
209 Ga0265329_10037307 3300031242 Bacteria 1566
210 Ga0265329_10043579 3300031242 Bacteria 1435
211 Ga0265340_10106638 3300031247 Bacteria 1298
212 Ga0265340_10116156 3300031247 Bacteria 1233
213 Ga0265340_10158648 3300031247 Bacteria 1029
214 Ga0265340_10436649 3300031247 Bacteria 577
215 Ga0265339_10008903 3300031249 Bacteria 6353
216 Ga0265339_10009252 3300031249 Bacteria 6209
217 Ga0265339_10034416 3300031249 Bacteria 2846
218 Ga0265339_10066400 3300031249 Bacteria 1931
219 Ga0265331_10001773 3300031250 Bacteria 15456
220 Ga0265331_10041343 3300031250 Bacteria 2240
221 Ga0265331_10165339 3300031250 Bacteria 1002
222 Ga0265331_10325440 3300031250 Bacteria 688
223 Ga0265327_10000786 3300031251 Bacteria 48928
224 Ga0265316_10024821 3300031344 Bacteria 5011
225 Ga0265316_10109035 3300031344 Bacteria 2098
226 Ga0265316_10193797 3300031344 Bacteria 1508
227 Ga0265316_10388875 3300031344 Unclassified 1006
228 Ga0265316_10538233 3300031344 Bacteria 832
229 Ga0265313_10001780 3300031595 Bacteria 19683
230 Ga0265313_10004746 3300031595 Bacteria 10246
231 Ga0265313_10011451 3300031595 Bacteria 5512
232 Ga0265313_10045520 3300031595 Bacteria 2136
233 Ga0265313_10268791 3300031595 Bacteria 691
234 Ga0265314_10001422 3300031711 Bacteria 26799
235 Ga0265314_10051599 3300031711 Bacteria 2864
236 Ga0265314_10244084 3300031711 Bacteria 1034
237 Ga0265342_10014297 3300031712 Bacteria 5272
238 Ga0265342_10183913 3300031712 Bacteria 1143
239 Ga0265342_10201123 3300031712 Bacteria 1082
240 Ga0265342_10237812 3300031712 Bacteria 976
241 Ga0307516_10389376 3300031730 Bacteria 1054
242 Ga0373938_0064443 3300034957 Bacteria 863
243 Ga0373949_0003686 3300035090 Bacteria 3595
244 Ga0373936_0082509 3300035113 Bacteria 1340
245 Ga0373945_0167938 3300035116 Bacteria 898
246 Ga0373954_0686515 3300035118 Bacteria 508
247 Ga0373946_0196796 3300035171 Unclassified 964
248 Ga0373955_0749008 3300035172 Unclassified 600
249 Ga0373935_0073645 3300035692 Bacteria 2207
250 Ga0373927_0013349 3300035695 Bacteria 5462
251 Ga0373927_0817882 3300035695 Unclassified 615
252 Ga0373927_1187565 3300035695 Unclassified 503
253 Ga0373933_0221742 3300035724 Bacteria 1213
254 Ga0373937_0002421 3300036401 Bacteria 15515
255 Ga0373937_0894000 3300036401 Bacteria 837
256 Ga0373937_1218018 3300036401 Bacteria 701
257 Ga0373925_0004099 3300037068 Bacteria 11057
258 Ga0373925_0360605 3300037068 Bacteria 1181
259 Ga0373925_0669700 3300037068 Bacteria 855
260 Ga0436364_1090100 3300037853 Unclassified 1760
261 Ga0436365_1044769 3300039437 Bacteria 997
262 Ga0436365_1412951 3300039437 Bacteria 3416
263 Ga0436365_1523797 3300039437 Bacteria 885
264 Ga0436360_1208071 3300039438 Bacteria 2349
265 Ga0436363_0903664 3300039450 Bacteria 9295
266 Ga0436363_1053521 3300039450 Bacteria 833
267 Ga0436363_1092418 3300039450 Bacteria 929
268 Ga0436362_0058847 3300039453 Bacteria 2438
269 Ga0436362_1077531 3300039453 Bacteria 874
270 Ga0451795_1143706 3300041456 Bacteria 507
271 Ga0439445_0068769 3300042004 Bacteria 977
272 Ga0439432_135879 3300042006 Bacteria 724
273 Ga0439462_0152991 3300042015 Bacteria 649
274 Ga0466968_0342618 3300044735 Bacteria 725
275 Ga0466957_0194324 3300044842 Bacteria 1331
276 Ga0466958_0582041 3300045836 Bacteria 728
277 Ga0495651_0548292 3300046462 Bacteria 735
278 Ga0495653_0374193 3300046463 Bacteria 911
279 Ga0495582_0300871 3300046473 Bacteria 922
280 Ga0495608_0410399 3300046511 Bacteria 827
281 Ga0495654_0070905 3300046530 Bacteria 1652
282 Ga0495587_0103774 3300046536 Bacteria 1637
283 Ga0495625_0033974 3300046660 Bacteria 3766
284 Ga0495599_0462340 3300046678 Bacteria 750
285 Ga0495613_0889128 3300046689 Bacteria 577
286 Ga0495581_0435685 3300047315 Unclassified 764
287 Ga0495674_0688806 3300047319 Bacteria 803
288 Ga0495676_0484343 3300047321 Bacteria 813
289 Ga0495676_0602384 3300047321 Bacteria 715
290 Ga0496100_0210277 3300048903 Bacteria 1423
291 Ga0496100_0229697 3300048903 Bacteria 1365
292 Ga0496100_0800997 3300048903 Bacteria 738
293 Ga0496101_0497685 3300048904 Bacteria 963
294 Ga0496101_0730691 3300048904 Bacteria 781
295 Ga0496101_0862410 3300048904 Bacteria 713
296 Ga0496102_0249270 3300048905 Bacteria 1674
297 Ga0496104_0000637 3300048907 Bacteria 30053
298 Ga0496104_0284902 3300048907 Bacteria 1565
299 Ga0496105_0004043 3300048908 Bacteria 10978
300 Ga0496105_0512750 3300048908 Bacteria 940
301 Ga0496106_0846491 3300048909 Unclassified 724
302 Ga0496106_1021312 3300048909 Unclassified 650
303 Ga0496107_0265906 3300048910 Bacteria 1276
304 Ga0496108_0171425 3300048911 Bacteria 1877
305 Ga0496109_0000908 3300048912 Bacteria 24650
306 Ga0496110_0050875 3300048913 Bacteria 3639
307 Ga0496110_0220046 3300048913 Bacteria 1726
308 Ga0496111_0002002 3300048914 Bacteria 12119
309 Ga0496111_0581996 3300048914 Unclassified 820
310 Ga0496111_0623275 3300048914 Bacteria 788
311 Ga0496112_0001429 3300048915 Bacteria 18305
312 Ga0496112_1192654 3300048915 Bacteria 678
313 Ga0496113_0002544 3300048916 Bacteria 10638
314 Ga0496113_0714378 3300048916 Bacteria 799
315 Ga0496114_1778271 3300048917 Bacteria 504
316 Ga0496115_0001958 3300048918 Bacteria 14699
317 Ga0496126_0203907 3300048929 Bacteria 1668
318 Ga0501031_0004390 3300049568 Bacteria 9141
319 Ga0501031_0944145 3300049568 Bacteria 552
320 Ga0501032_0003552 3300049569 Bacteria 11895
321 Ga0501032_0106633 3300049569 Unclassified 1856
322 Ga0501032_0282243 3300049569 Bacteria 1075
323 Ga0501032_0406433 3300049569 Unclassified 874
324 Ga0501032_0544295 3300049569 Bacteria 740
325 Ga0501032_0796598 3300049569 Bacteria 597
326 Ga0501033_0020735 3300049570 Bacteria 4965
327 Ga0501033_0035315 3300049570 Bacteria 3748
328 Ga0501033_0087516 3300049570 Bacteria 2280
329 Ga0501033_0199279 3300049570 Bacteria 1430
330 Ga0501033_0425442 3300049570 Unclassified 924
331 Ga0501034_0028181 3300049571 Bacteria 5714
332 Ga0501034_0348214 3300049571 Bacteria 1410
333 Ga0501034_0652347 3300049571 Bacteria 954
334 Ga0501034_0767982 3300049571 Bacteria 858
335 Ga0501034_1144397 3300049571 Unclassified 658
336 Ga0501036_0004514 3300049572 Bacteria 11237
337 Ga0501036_0063170 3300049572 Bacteria 3136
338 Ga0501036_0436089 3300049572 Unclassified 1092
339 Ga0501036_0663299 3300049572 Bacteria 863
340 Ga0501037_0015642 3300049573 Bacteria 5585
341 Ga0501037_0108952 3300049573 Bacteria 1996
342 Ga0501037_0236034 3300049573 Bacteria 1283
343 Ga0501037_0397131 3300049573 Unclassified 946
344 Ga0501038_0017647 3300049574 Bacteria 6450
345 Ga0501038_0079878 3300049574 Bacteria 2758
346 Ga0501038_0159536 3300049574 Bacteria 1834
347 Ga0501038_0283238 3300049574 Bacteria 1304
348 Ga0501039_0034497 3300049575 Bacteria 3904
349 Ga0501042_0022418 3300049578 Bacteria 4410
350 Ga0501043_0050071 3300049579 Bacteria 3284
351 Ga0501043_0136462 3300049579 Bacteria 1921
352 Ga0501043_0510367 3300049579 Bacteria 897
353 Ga0501043_1002848 3300049579 Bacteria 594
354 Ga0501046_0005260 3300049580 Bacteria 11574
355 Ga0501047_0006154 3300049581 Bacteria 11284
356 Ga0501047_0049262 3300049581 Bacteria 4068
357 Ga0501047_0060218 3300049581 Bacteria 3664
358 Ga0501047_0134096 3300049581 Bacteria 2356
359 Ga0501047_0176148 3300049581 Bacteria 2006
360 Ga0501047_0205578 3300049581 Bacteria 1828
361 Ga0501047_0284305 3300049581 Bacteria 1498
362 Ga0501047_0385111 3300049581 Bacteria 1236
363 Ga0501048_0028328 3300049582 Bacteria 4065
364 Ga0501067_0000868 3300049583 Bacteria 16256
365 Ga0501067_0002226 3300049583 Bacteria 10728
366 Ga0501069_0023961 3300049585 Bacteria 3328
367 Ga0501070_0021750 3300049586 Bacteria 5375
368 Ga0501070_0147472 3300049586 Bacteria 1942
369 Ga0501071_0496778 3300049587 Bacteria 936
370 Ga0501072_0031707 3300049588 Bacteria 4139
371 Ga0501072_0150590 3300049588 Bacteria 1855
372 Ga0501073_0002413 3300049589 Bacteria 13988
373 Ga0501073_0003832 3300049589 Bacteria 11282
374 Ga0501073_0831491 3300049589 Bacteria 636
375 Ga0501073_0831714 3300049589 Bacteria 636
376 Ga0501074_0002268 3300049590 Bacteria 13376
377 Ga0501074_1201185 3300049590 Unclassified 532
378 Ga0501075_0828067 3300049591 Bacteria 704
379 Ga0501252_006551 3300049682 Bacteria 1298
380 Ga0501079_0011714 3300049741 Bacteria 6697
381 Ga0501079_0048653 3300049741 Bacteria 3272
382 Ga0501080_0002279 3300049742 Bacteria 16702
383 Ga0501080_0071045 3300049742 Bacteria 3237
384 Ga0501080_0105291 3300049742 Bacteria 2615
385 Ga0501080_0107972 3300049742 Bacteria 2579
386 Ga0501080_0248497 3300049742 Bacteria 1622
387 Ga0501083_0009752 3300049744 Bacteria 6781
388 Ga0501083_0032436 3300049744 Bacteria 3580
389 Ga0501083_0068906 3300049744 Bacteria 2354
390 Ga0501083_0646578 3300049744 Bacteria 688
391 Ga0501035_0010177 3300049822 Bacteria 8729
392 Ga0501035_0042026 3300049822 Bacteria 4124
393 Ga0501035_0064773 3300049822 Bacteria 3247
394 Ga0501035_0455032 3300049822 Bacteria 1058
395 Ga0501035_0783364 3300049822 Bacteria 763
396 Ga0501035_0798053 3300049822 Bacteria 754
397 Ga0501044_0006189 3300049823 Bacteria 13226
398 Ga0501044_0039531 3300049823 Bacteria 4921
399 Ga0501044_0055333 3300049823 Bacteria 4075
400 Ga0501044_0090498 3300049823 Bacteria 3087
401 Ga0501044_0162414 3300049823 Bacteria 2209
402 Ga0501044_0263771 3300049823 Bacteria 1660
403 Ga0501044_0391234 3300049823 Bacteria 1304
404 Ga0501044_0628696 3300049823 Unclassified 964
405 Ga0501045_1366563 3300049824 Unclassified 515
406 nmdc:mga03683_632871_c1 3300050489 Bacteria 526
407 nmdc:mga03n38_198185_c1 3300050490 Bacteria 1038
408 nmdc:mga00v17_273944_c1 3300050491 Bacteria 1095
409 nmdc:mga0k408_701396_c1 3300050493 Bacteria 593
410 nmdc:mga0k408_805_c1 3300050493 Bacteria 7039
411 nmdc:mga0k408_866010_c1 3300050493 Bacteria 525
412 nmdc:mga06z11_347581_c1 3300050494 Bacteria 887
413 nmdc:mga06z11_989018_c1 3300050494 Bacteria 513
414 nmdc:mga07m45_465284_c1 3300050496 Bacteria 733
415 nmdc:mga08y16_186915_c1 3300050511 Bacteria 2150
416 nmdc:mga0n895_176978_c1 3300050512 Bacteria 2164
417 nmdc:mga0n895_189316_c1 3300050512 Unclassified 2089
418 nmdc:mga0n895_40096_c1 3300050512 Bacteria 4548
419 nmdc:mga0rr50_32397_c1 3300050513 Bacteria 1144
420 nmdc:mga0rr50_3430_c1 3300050513 Bacteria 9119
421 nmdc:mga08x19_155_c1 3300050514 Bacteria 56249
422 nmdc:mga08x19_271306_c1 3300050514 Unclassified 1174
423 nmdc:mga0a205_36333_c1 3300050515 Bacteria 4733
424 nmdc:mga0sz30_10581_c1 3300050516 Bacteria 2009
425 Ga0500643_000003 3300053087 Bacteria 876659
426 Ga0500646_0312113 3300053090 Bacteria 566
427 Ga0500554_132659 3300053102 Bacteria 842
428 Ga0500555_095781 3300053103 Bacteria 758
429 Ga0500555_104674 3300053103 Bacteria 716
430 Ga0500593_000075 3300053117 Bacteria 37303
431 Ga0500594_0174892 3300053118 Bacteria 699
432 Ga0500595_152361 3300053119 Unclassified 646
433 Ga0500568_0000002 3300053139 Bacteria 880601
434 Ga0500568_0035568 3300053139 Bacteria 2032
435 Ga0500588_0298049 3300053146 Unclassified 610
436 Ga0500587_036174 3300053739 Bacteria 694
437 Ga0501084_0009855 3300054114 Bacteria 7895
438 Ga0501084_0950463 3300054114 Bacteria 722
439 Ga0501082_0008955 3300060353 Bacteria 8638
440 Ga0501082_0065737 3300060353 Bacteria 3123
441 Ga0501082_0607119 3300060353 Bacteria 957
442 Ga0501082_1558962 3300060353 Bacteria 577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10656471 Ga0070658_106564712 74
2 3300005355 Ga0070671_101807047 Ga0070671_1018070472 74
3 3300005436 Ga0070713_101052020 Ga0070713_1010520201 74
4 3300005457 Ga0070662_100762702 Ga0070662_1007627022 74
5 3300005535 Ga0070684_100127100 Ga0070684_1001271003 74
6 3300005539 Ga0068853_100427305 Ga0068853_1004273053 74
7 3300005539 Ga0068853_101026890 Ga0068853_1010268902 74
8 3300005577 Ga0068857_100187531 Ga0068857_1001875313 74
9 3300005614 Ga0068856_101146976 Ga0068856_1011469762 74
10 3300005618 Ga0068864_100101336 Ga0068864_1001013362 74
11 3300006175 Ga0070712_101128814 Ga0070712_1011288141 74
12 3300009101 Ga0105247_11427314 Ga0105247_114273142 74
13 3300009551 Ga0105238_10777513 Ga0105238_107775132 74
14 3300013296 Ga0157374_10484065 Ga0157374_104840652 74
15 3300013296 Ga0157374_12197873 Ga0157374_121978732 74
16 3300013306 Ga0163162_10185765 Ga0163162_101857653 74
17 3300014325 Ga0163163_10002034 Ga0163163_100020345 74
18 3300014325 Ga0163163_10936025 Ga0163163_109360252 74
19 3300025921 Ga0207652_11791104 Ga0207652_117911042 74
20 3300025928 Ga0207700_10896107 Ga0207700_108961072 74
21 3300025933 Ga0207706_10329898 Ga0207706_103298982 74
22 3300026095 Ga0207676_10406777 Ga0207676_104067772 74
23 3300026116 Ga0207674_11094597 Ga0207674_110945971 74
24 3300031711 Ga0265314_10244084 Ga0265314_102440842 74
25 3300035113 Ga0373936_0082509 Ga0373936_0082509_518_754 74
26 3300037068 Ga0373925_0669700 Ga0373925_0669700_323_559 74
27 3300037853 Ga0436364_1090100 Ga0436364_1090100_1492_1728 74
28 3300047321 Ga0495676_0484343 Ga0495676_0484343_123_359 74
29 3300048903 Ga0496100_0800997 Ga0496100_0800997_487_723 74
30 3300048904 Ga0496101_0730691 Ga0496101_0730691_331_567 74
31 3300048904 Ga0496101_0862410 Ga0496101_0862410_174_410 74
32 3300048905 Ga0496102_0249270 Ga0496102_0249270_866_1102 74
33 3300048907 Ga0496104_0000637 Ga0496104_0000637_13457_13693 74
34 3300048907 Ga0496104_0284902 Ga0496104_0284902_1308_1538 74
35 3300048908 Ga0496105_0004043 Ga0496105_0004043_1501_1737 74
36 3300048908 Ga0496105_0512750 Ga0496105_0512750_326_562 74
37 3300048911 Ga0496108_0171425 Ga0496108_0171425_1209_1445 74
38 3300048912 Ga0496109_0000908 Ga0496109_0000908_22331_22567 74
39 3300048913 Ga0496110_0050875 Ga0496110_0050875_2655_2891 74
40 3300048913 Ga0496110_0220046 Ga0496110_0220046_714_950 74
41 3300048914 Ga0496111_0002002 Ga0496111_0002002_6830_7066 74
42 3300048914 Ga0496111_0623275 Ga0496111_0623275_169_405 74
43 3300048915 Ga0496112_0001429 Ga0496112_0001429_15500_15736 74
44 3300048915 Ga0496112_1192654 Ga0496112_1192654_381_617 74
45 3300048916 Ga0496113_0002544 Ga0496113_0002544_9240_9476 74
46 3300048916 Ga0496113_0714378 Ga0496113_0714378_407_643 74
47 3300048918 Ga0496115_0001958 Ga0496115_0001958_11711_11947 74
48 3300049569 Ga0501032_0406433 Ga0501032_0406433_26_256 74
49 3300049570 Ga0501033_0035315 Ga0501033_0035315_3026_3256 74
50 3300049572 Ga0501036_0663299 Ga0501036_0663299_459_689 74
51 3300049573 Ga0501037_0236034 Ga0501037_0236034_409_639 74
52 3300049574 Ga0501038_0283238 Ga0501038_0283238_598_828 74
53 3300049579 Ga0501043_0510367 Ga0501043_0510367_122_352 74
54 3300049581 Ga0501047_0205578 Ga0501047_0205578_29_259 74
55 3300049682 Ga0501252_006551 Ga0501252_006551_79_309 74
56 3300049742 Ga0501080_0002279 Ga0501080_0002279_3697_3927 74
57 3300049742 Ga0501080_0105291 Ga0501080_0105291_708_938 74
58 3300049822 Ga0501035_0010177 Ga0501035_0010177_6474_6704 74
59 3300049823 Ga0501044_0055333 Ga0501044_0055333_798_1028 74
60 3300049824 Ga0501045_1366563 Ga0501045_1366563_128_358 74
61 3300005347 Ga0070668_101051283 Ga0070668_1010512831 75
62 3300005545 Ga0070695_100407964 Ga0070695_1004079642 75
63 3300005546 Ga0070696_100122022 Ga0070696_1001220223 75
64 3300005615 Ga0070702_100528236 Ga0070702_1005282361 75
65 3300009553 Ga0105249_10512607 Ga0105249_105126071 75
66 3300021358 Ga0213873_10029598 Ga0213873_100295983 75
67 3300021384 Ga0213876_10051604 Ga0213876_100516043 75
68 3300025972 Ga0207668_11249225 Ga0207668_112492252 75
69 3300028800 Ga0265338_10030421 Ga0265338_100304215 75
70 3300031239 Ga0265328_10008779 Ga0265328_100087792 75
71 3300031241 Ga0265325_10001389 Ga0265325_100013898 75
72 3300031247 Ga0265340_10116156 Ga0265340_101161562 75
73 3300031247 Ga0265340_10158648 Ga0265340_101586482 75
74 3300031249 Ga0265339_10008903 Ga0265339_100089033 75
75 3300031249 Ga0265339_10009252 Ga0265339_100092523 75
76 3300031250 Ga0265331_10165339 Ga0265331_101653392 75
77 3300031344 Ga0265316_10388875 Ga0265316_103888752 75
78 3300031344 Ga0265316_10538233 Ga0265316_105382332 75
79 3300031595 Ga0265313_10045520 Ga0265313_100455203 75
80 3300031711 Ga0265314_10001422 Ga0265314_100014225 75
81 3300031711 Ga0265314_10051599 Ga0265314_100515992 75
82 3300031712 Ga0265342_10014297 Ga0265342_100142973 75
83 3300031712 Ga0265342_10201123 Ga0265342_102011232 75
84 3300035118 Ga0373954_0686515 Ga0373954_0686515_155_388 75
85 3300039437 Ga0436365_1412951 Ga0436365_1412951_496_729 75
86 3300039450 Ga0436363_1053521 Ga0436363_1053521_181_423 75
87 3300039453 Ga0436362_0058847 Ga0436362_0058847_340_573 75
88 3300046462 Ga0495651_0548292 Ga0495651_0548292_235_468 75
89 3300047319 Ga0495674_0688806 Ga0495674_0688806_508_741 75
90 3300005435 Ga0070714_100017309 Ga0070714_1000173092 76
91 3300005436 Ga0070713_100000004 Ga0070713_10000000491 76
92 3300005437 Ga0070710_10223193 Ga0070710_102231932 76
93 3300005437 Ga0070710_10318076 Ga0070710_103180762 76
94 3300005439 Ga0070711_100020746 Ga0070711_1000207463 76
95 3300005439 Ga0070711_100037853 Ga0070711_1000378532 76
96 3300005439 Ga0070711_100143292 Ga0070711_1001432921 76
97 3300005440 Ga0070705_101844807 Ga0070705_1018448071 76
98 3300005441 Ga0070700_101674234 Ga0070700_1016742341 76
99 3300005546 Ga0070696_100205986 Ga0070696_1002059862 76
100 3300005547 Ga0070693_100032622 Ga0070693_1000326224 76
101 3300005577 Ga0068857_100127398 Ga0068857_1001273982 76
102 3300005614 Ga0068856_100000474 Ga0068856_10000047410 76
103 3300005614 Ga0068856_102273629 Ga0068856_1022736292 76
104 3300005618 Ga0068864_100351210 Ga0068864_1003512102 76
105 3300006058 Ga0075432_10588603 Ga0075432_105886031 76
106 3300006175 Ga0070712_100000396 Ga0070712_10000039610 76
107 3300006175 Ga0070712_100002805 Ga0070712_1000028052 76
108 3300006175 Ga0070712_100501648 Ga0070712_1005016482 76
109 3300006237 Ga0097621_100270811 Ga0097621_1002708112 76
110 3300006844 Ga0075428_100770768 Ga0075428_1007707682 76
111 3300006871 Ga0075434_100196460 Ga0075434_1001964602 76
112 3300006871 Ga0075434_100274825 Ga0075434_1002748252 76
113 3300006914 Ga0075436_100000187 Ga0075436_10000018729 76
114 3300006914 Ga0075436_101012469 Ga0075436_1010124692 76
115 3300007076 Ga0075435_100004990 Ga0075435_1000049905 76
116 3300009094 Ga0111539_10052846 Ga0111539_100528466 76
117 3300009147 Ga0114129_10136747 Ga0114129_101367474 76
118 3300009174 Ga0105241_10523832 Ga0105241_105238322 76
119 3300009174 Ga0105241_10940425 Ga0105241_109404252 76
120 3300009545 Ga0105237_10363969 Ga0105237_103639692 76
121 3300009551 Ga0105238_10319394 Ga0105238_103193942 76
122 3300010375 Ga0105239_11694145 Ga0105239_116941452 76
123 3300013297 Ga0157378_10325535 Ga0157378_103255352 76
124 3300013297 Ga0157378_10493084 Ga0157378_104930842 76
125 3300014497 Ga0182008_10121636 Ga0182008_101216362 76
126 3300014968 Ga0157379_10001633 Ga0157379_100016339 76
127 3300014968 Ga0157379_10139787 Ga0157379_101397872 76
128 3300025898 Ga0207692_10067664 Ga0207692_100676642 76
129 3300025906 Ga0207699_10000307 Ga0207699_1000030723 76
130 3300025911 Ga0207654_10391422 Ga0207654_103914222 76
131 3300025914 Ga0207671_10273222 Ga0207671_102732222 76
132 3300025915 Ga0207693_10001040 Ga0207693_1000104017 76
133 3300025915 Ga0207693_10001139 Ga0207693_100011396 76
134 3300025916 Ga0207663_10015612 Ga0207663_100156123 76
135 3300025916 Ga0207663_10046901 Ga0207663_100469012 76
136 3300025916 Ga0207663_10208637 Ga0207663_102086372 76
137 3300025924 Ga0207694_10982101 Ga0207694_109821011 76
138 3300025928 Ga0207700_10000011 Ga0207700_10000011214 76
139 3300025928 Ga0207700_10067079 Ga0207700_100670792 76
140 3300025929 Ga0207664_10453297 Ga0207664_104532972 76
141 3300026075 Ga0207708_11407312 Ga0207708_114073122 76
142 3300026078 Ga0207702_10000164 Ga0207702_1000016456 76
143 3300026095 Ga0207676_10456842 Ga0207676_104568422 76
144 3300026116 Ga0207674_10032889 Ga0207674_100328896 76
145 3300028800 Ga0265338_10117477 Ga0265338_101174774 76
146 3300028800 Ga0265338_10176621 Ga0265338_101766212 76
147 3300031240 Ga0265320_10462232 Ga0265320_104622321 76
148 3300031241 Ga0265325_10000226 Ga0265325_1000022645 76
149 3300031241 Ga0265325_10094772 Ga0265325_100947722 76
150 3300031242 Ga0265329_10043579 Ga0265329_100435793 76
151 3300031247 Ga0265340_10106638 Ga0265340_101066382 76
152 3300031249 Ga0265339_10066400 Ga0265339_100664002 76
153 3300031250 Ga0265331_10041343 Ga0265331_100413433 76
154 3300031344 Ga0265316_10109035 Ga0265316_101090353 76
155 3300031344 Ga0265316_10193797 Ga0265316_101937972 76
156 3300031595 Ga0265313_10001780 Ga0265313_100017804 76
157 3300031595 Ga0265313_10011451 Ga0265313_100114515 76
158 3300031595 Ga0265313_10268791 Ga0265313_102687911 76
159 3300031712 Ga0265342_10183913 Ga0265342_101839132 76
160 3300031712 Ga0265342_10237812 Ga0265342_102378122 76
161 3300035171 Ga0373946_0196796 Ga0373946_0196796_376_612 76
162 3300035172 Ga0373955_0749008 Ga0373955_0749008_121_357 76
163 3300035692 Ga0373935_0073645 Ga0373935_0073645_1945_2181 76
164 3300035695 Ga0373927_0817882 Ga0373927_0817882_96_332 76
165 3300035695 Ga0373927_1187565 Ga0373927_1187565_166_402 76
166 3300035724 Ga0373933_0221742 Ga0373933_0221742_648_884 76
167 3300036401 Ga0373937_0002421 Ga0373937_0002421_12673_12909 76
168 3300036401 Ga0373937_0894000 Ga0373937_0894000_369_605 76
169 3300036401 Ga0373937_1218018 Ga0373937_1218018_142_378 76
170 3300037068 Ga0373925_0004099 Ga0373925_0004099_2957_3193 76
171 3300039450 Ga0436363_0903664 Ga0436363_0903664_8528_8764 76
172 3300048903 Ga0496100_0210277 Ga0496100_0210277_515_751 76
173 3300048909 Ga0496106_0846491 Ga0496106_0846491_189_425 76
174 3300048909 Ga0496106_1021312 Ga0496106_1021312_404_640 76
175 3300048914 Ga0496111_0581996 Ga0496111_0581996_48_284 76
176 3300049571 Ga0501034_0348214 Ga0501034_0348214_1054_1290 76
177 3300049571 Ga0501034_1144397 Ga0501034_1144397_255_491 76
178 3300049574 Ga0501038_0159536 Ga0501038_0159536_1011_1247 76
179 3300049581 Ga0501047_0049262 Ga0501047_0049262_2189_2425 76
180 3300049581 Ga0501047_0134096 Ga0501047_0134096_1521_1757 76
181 3300049583 Ga0501067_0000868 Ga0501067_0000868_13164_13400 76
182 3300049588 Ga0501072_0031707 Ga0501072_0031707_2345_2581 76
183 3300049589 Ga0501073_0003832 Ga0501073_0003832_10713_10949 76
184 3300049589 Ga0501073_0831491 Ga0501073_0831491_278_514 76
185 3300049589 Ga0501073_0831714 Ga0501073_0831714_213_449 76
186 3300049590 Ga0501074_1201185 Ga0501074_1201185_238_474 76
187 3300049741 Ga0501079_0048653 Ga0501079_0048653_1930_2166 76
188 3300049742 Ga0501080_0071045 Ga0501080_0071045_2541_2777 76
189 3300049742 Ga0501080_0248497 Ga0501080_0248497_21_257 76
190 3300049744 Ga0501083_0646578 Ga0501083_0646578_241_477 76
191 3300049823 Ga0501044_0263771 Ga0501044_0263771_818_1054 76
192 3300050512 nmdc:mga0n895_176978_c1 nmdc:mga0n895_176978_c1_815_1051 76
193 3300050512 nmdc:mga0n895_189316_c1 nmdc:mga0n895_189316_c1_899_1135 76
194 3300050513 nmdc:mga0rr50_3430_c1 nmdc:mga0rr50_3430_c1_5772_6008 76
195 3300050514 nmdc:mga08x19_155_c1 nmdc:mga08x19_155_c1_24963_25199 76
196 3300050514 nmdc:mga08x19_271306_c1 nmdc:mga08x19_271306_c1_815_1051 76
197 3300005334 Ga0068869_100546569 Ga0068869_1005465692 77
198 3300005336 Ga0070680_101988721 Ga0070680_1019887212 77
199 3300005344 Ga0070661_100211452 Ga0070661_1002114521 77
200 3300005366 Ga0070659_101897609 Ga0070659_1018976092 77
201 3300005435 Ga0070714_100827875 Ga0070714_1008278751 77
202 3300005539 Ga0068853_100499512 Ga0068853_1004995122 77
203 3300005577 Ga0068857_100458087 Ga0068857_1004580872 77
204 3300013307 Ga0157372_11143460 Ga0157372_111434602 77
205 3300025904 Ga0207647_10149245 Ga0207647_101492452 77
206 3300025913 Ga0207695_10109081 Ga0207695_101090811 77
207 3300025914 Ga0207671_10034474 Ga0207671_100344742 77
208 3300025924 Ga0207694_10274826 Ga0207694_102748262 77
209 3300025929 Ga0207664_10654136 Ga0207664_106541362 77
210 3300025932 Ga0207690_11418894 Ga0207690_114188942 77
211 3300025942 Ga0207689_10544177 Ga0207689_105441772 77
212 3300025949 Ga0207667_10257002 Ga0207667_102570022 77
213 3300025949 Ga0207667_10588114 Ga0207667_105881142 77
214 3300026041 Ga0207639_10760722 Ga0207639_107607222 77
215 3300026116 Ga0207674_10586937 Ga0207674_105869372 77
216 3300042004 Ga0439445_0068769 Ga0439445_0068769_627_869 77
217 3300042006 Ga0439432_135879 Ga0439432_135879_74_316 77
218 3300042015 Ga0439462_0152991 Ga0439462_0152991_115_357 77
219 3300060353 Ga0501082_0607119 Ga0501082_0607119_243_482 77
220 iso_pu_bacteria 2919450847 2919451632 77
221 3300003215 JGI25153J46596_10001205 JGI25153J46596_1000120511 78
222 3300003320 rootH2_10061914 rootH2_100619142 78
223 3300005327 Ga0070658_10639595 Ga0070658_106395952 78
224 3300005336 Ga0070680_101837543 Ga0070680_1018375431 78
225 3300005339 Ga0070660_100102026 Ga0070660_1001020262 78
226 3300005339 Ga0070660_100794413 Ga0070660_1007944132 78
227 3300005341 Ga0070691_10318947 Ga0070691_103189472 78
228 3300005347 Ga0070668_100365960 Ga0070668_1003659602 78
229 3300005366 Ga0070659_100004063 Ga0070659_1000040635 78
230 3300005458 Ga0070681_11360957 Ga0070681_113609572 78
231 3300005530 Ga0070679_101249174 Ga0070679_1012491742 78
232 3300005563 Ga0068855_100098101 Ga0068855_1000981013 78
233 3300005564 Ga0070664_102079056 Ga0070664_1020790562 78
234 3300005577 Ga0068857_100278608 Ga0068857_1002786082 78
235 3300005616 Ga0068852_101249613 Ga0068852_1012496131 78
236 3300005842 Ga0068858_100068155 Ga0068858_1000681553 78
237 3300005844 Ga0068862_100222302 Ga0068862_1002223022 78
238 3300009093 Ga0105240_10583318 Ga0105240_105833181 78
239 3300009093 Ga0105240_11342014 Ga0105240_113420142 78
240 3300009098 Ga0105245_11108921 Ga0105245_111089212 78
241 3300009176 Ga0105242_12494787 Ga0105242_124947872 78
242 3300009545 Ga0105237_12113592 Ga0105237_121135922 78
243 3300009551 Ga0105238_11225461 Ga0105238_112254612 78
244 3300009551 Ga0105238_11521734 Ga0105238_115217342 78
245 3300009551 Ga0105238_11757286 Ga0105238_117572862 78
246 3300010375 Ga0105239_10008191 Ga0105239_1000819112 78
247 3300013104 Ga0157370_10123840 Ga0157370_101238402 78
248 3300014325 Ga0163163_12835803 Ga0163163_128358031 78
249 3300014969 Ga0157376_10457216 Ga0157376_104572163 78
250 3300025230 Ga0209563_111525 Ga0209563_1115252 78
251 3300025272 Ga0209455_1023947 Ga0209455_10239472 78
252 3300025297 Ga0209758_1000013 Ga0209758_1000013230 78
253 3300025297 Ga0209758_1160721 Ga0209758_11607211 78
254 3300025909 Ga0207705_11403370 Ga0207705_114033702 78
255 3300025912 Ga0207707_11092387 Ga0207707_110923872 78
256 3300025913 Ga0207695_10271190 Ga0207695_102711903 78
257 3300025913 Ga0207695_11560689 Ga0207695_115606892 78
258 3300025914 Ga0207671_11170163 Ga0207671_111701632 78
259 3300025917 Ga0207660_11466738 Ga0207660_114667382 78
260 3300025919 Ga0207657_10205788 Ga0207657_102057882 78
261 3300025921 Ga0207652_10418580 Ga0207652_104185801 78
262 3300025924 Ga0207694_10597556 Ga0207694_105975562 78
263 3300025927 Ga0207687_10147104 Ga0207687_101471042 78
264 3300025932 Ga0207690_10021630 Ga0207690_100216302 78
265 3300025949 Ga0207667_10177316 Ga0207667_101773162 78
266 3300025972 Ga0207668_10639140 Ga0207668_106391402 78
267 3300026035 Ga0207703_10012743 Ga0207703_100127437 78
268 3300026041 Ga0207639_10859354 Ga0207639_108593541 78
269 3300026116 Ga0207674_10268307 Ga0207674_102683072 78
270 3300031250 Ga0265331_10001773 Ga0265331_100017734 78
271 3300031251 Ga0265327_10000786 Ga0265327_1000078648 78
272 3300031730 Ga0307516_10389376 Ga0307516_103893762 78
273 3300039437 Ga0436365_1044769 Ga0436365_1044769_673_909 78
274 3300039437 Ga0436365_1523797 Ga0436365_1523797_618_854 78
275 3300039438 Ga0436360_1208071 Ga0436360_1208071_1867_2109 78
276 3300039450 Ga0436363_1092418 Ga0436363_1092418_640_915 78
277 3300039453 Ga0436362_1077531 Ga0436362_1077531_169_444 78
278 3300041456 Ga0451795_1143706 Ga0451795_1143706_247_489 78
279 3300044842 Ga0466957_0194324 Ga0466957_0194324_757_1005 78
280 3300045836 Ga0466958_0582041 Ga0466958_0582041_12_260 78
281 3300046463 Ga0495653_0374193 Ga0495653_0374193_616_882 78
282 3300046473 Ga0495582_0300871 Ga0495582_0300871_643_885 78
283 3300046511 Ga0495608_0410399 Ga0495608_0410399_68_334 78
284 3300046530 Ga0495654_0070905 Ga0495654_0070905_1054_1320 78
285 3300046536 Ga0495587_0103774 Ga0495587_0103774_210_476 78
286 3300046660 Ga0495625_0033974 Ga0495625_0033974_1605_1877 78
287 3300046678 Ga0495599_0462340 Ga0495599_0462340_54_320 78
288 3300046689 Ga0495613_0889128 Ga0495613_0889128_299_565 78
289 3300047315 Ga0495581_0435685 Ga0495581_0435685_156_392 78
290 3300048929 Ga0496126_0203907 Ga0496126_0203907_967_1203 78
291 3300049568 Ga0501031_0004390 Ga0501031_0004390_4159_4404 78
292 3300049568 Ga0501031_0944145 Ga0501031_0944145_147_383 78
293 3300049569 Ga0501032_0003552 Ga0501032_0003552_9097_9342 78
294 3300049569 Ga0501032_0106633 Ga0501032_0106633_992_1258 78
295 3300049569 Ga0501032_0282243 Ga0501032_0282243_58_294 78
296 3300049569 Ga0501032_0544295 Ga0501032_0544295_161_403 78
297 3300049569 Ga0501032_0796598 Ga0501032_0796598_150_392 78
298 3300049570 Ga0501033_0020735 Ga0501033_0020735_2418_2663 78
299 3300049570 Ga0501033_0087516 Ga0501033_0087516_1156_1392 78
300 3300049570 Ga0501033_0199279 Ga0501033_0199279_767_1003 78
301 3300049570 Ga0501033_0425442 Ga0501033_0425442_535_801 78
302 3300049571 Ga0501034_0028181 Ga0501034_0028181_1951_2196 78
303 3300049571 Ga0501034_0652347 Ga0501034_0652347_604_876 78
304 3300049572 Ga0501036_0004514 Ga0501036_0004514_4203_4448 78
305 3300049572 Ga0501036_0063170 Ga0501036_0063170_1303_1578 78
306 3300049572 Ga0501036_0436089 Ga0501036_0436089_309_575 78
307 3300049573 Ga0501037_0015642 Ga0501037_0015642_3518_3763 78
308 3300049573 Ga0501037_0108952 Ga0501037_0108952_707_949 78
309 3300049573 Ga0501037_0397131 Ga0501037_0397131_697_933 78
310 3300049574 Ga0501038_0017647 Ga0501038_0017647_1218_1463 78
311 3300049574 Ga0501038_0079878 Ga0501038_0079878_658_933 78
312 3300049575 Ga0501039_0034497 Ga0501039_0034497_2111_2356 78
313 3300049578 Ga0501042_0022418 Ga0501042_0022418_2160_2405 78
314 3300049579 Ga0501043_0050071 Ga0501043_0050071_1753_2028 78
315 3300049579 Ga0501043_0136462 Ga0501043_0136462_757_1002 78
316 3300049579 Ga0501043_1002848 Ga0501043_1002848_86_328 78
317 3300049580 Ga0501046_0005260 Ga0501046_0005260_7347_7592 78
318 3300049581 Ga0501047_0006154 Ga0501047_0006154_2353_2595 78
319 3300049581 Ga0501047_0060218 Ga0501047_0060218_2033_2278 78
320 3300049581 Ga0501047_0176148 Ga0501047_0176148_1313_1555 78
321 3300049581 Ga0501047_0284305 Ga0501047_0284305_506_781 78
322 3300049581 Ga0501047_0385111 Ga0501047_0385111_143_379 78
323 3300049582 Ga0501048_0028328 Ga0501048_0028328_3259_3504 78
324 3300049583 Ga0501067_0002226 Ga0501067_0002226_9097_9342 78
325 3300049585 Ga0501069_0023961 Ga0501069_0023961_1697_1942 78
326 3300049586 Ga0501070_0021750 Ga0501070_0021750_143_388 78
327 3300049587 Ga0501071_0496778 Ga0501071_0496778_116_361 78
328 3300049588 Ga0501072_0150590 Ga0501072_0150590_1406_1690 78
329 3300049589 Ga0501073_0002413 Ga0501073_0002413_12357_12602 78
330 3300049590 Ga0501074_0002268 Ga0501074_0002268_9445_9690 78
331 3300049591 Ga0501075_0828067 Ga0501075_0828067_314_559 78
332 3300049741 Ga0501079_0011714 Ga0501079_0011714_6117_6362 78
333 3300049742 Ga0501080_0107972 Ga0501080_0107972_801_1046 78
334 3300049744 Ga0501083_0032436 Ga0501083_0032436_921_1166 78
335 3300049744 Ga0501083_0068906 Ga0501083_0068906_1006_1278 78
336 3300049822 Ga0501035_0042026 Ga0501035_0042026_1929_2174 78
337 3300049822 Ga0501035_0064773 Ga0501035_0064773_2545_2787 78
338 3300049822 Ga0501035_0455032 Ga0501035_0455032_163_438 78
339 3300049822 Ga0501035_0783364 Ga0501035_0783364_401_643 78
340 3300049822 Ga0501035_0798053 Ga0501035_0798053_30_296 78
341 3300049823 Ga0501044_0006189 Ga0501044_0006189_3848_4093 78
342 3300049823 Ga0501044_0039531 Ga0501044_0039531_1566_1808 78
343 3300049823 Ga0501044_0162414 Ga0501044_0162414_1645_1881 78
344 3300049823 Ga0501044_0391234 Ga0501044_0391234_577_813 78
345 3300049823 Ga0501044_0628696 Ga0501044_0628696_82_348 78
346 3300053087 Ga0500643_000003 Ga0500643_000003_648547_648819 78
347 3300053090 Ga0500646_0312113 Ga0500646_0312113_139_381 78
348 3300053102 Ga0500554_132659 Ga0500554_132659_27_269 78
349 3300053103 Ga0500555_095781 Ga0500555_095781_244_516 78
350 3300053103 Ga0500555_104674 Ga0500555_104674_427_663 78
351 3300053117 Ga0500593_000075 Ga0500593_000075_13668_13910 78
352 3300053118 Ga0500594_0174892 Ga0500594_0174892_155_427 78
353 3300053119 Ga0500595_152361 Ga0500595_152361_226_462 78
354 3300053139 Ga0500568_0000002 Ga0500568_0000002_458853_459095 78
355 3300053139 Ga0500568_0035568 Ga0500568_0035568_1160_1432 78
356 3300053146 Ga0500588_0298049 Ga0500588_0298049_193_459 78
357 3300053739 Ga0500587_036174 Ga0500587_036174_328_564 78
358 3300054114 Ga0501084_0009855 Ga0501084_0009855_4746_4991 78
359 3300060353 Ga0501082_0008955 Ga0501082_0008955_4077_4322 78
360 3300060353 Ga0501082_0065737 Ga0501082_0065737_1117_1389 78
361 iso_pu_bacteria 2513237141 2513887850 78
362 3300005328 Ga0070676_11293561 Ga0070676_112935612 79
363 3300005334 Ga0068869_100722388 Ga0068869_1007223881 79
364 3300005356 Ga0070674_100240911 Ga0070674_1002409112 79
365 3300005456 Ga0070678_100151084 Ga0070678_1001510842 79
366 3300005459 Ga0068867_100452341 Ga0068867_1004523411 79
367 3300005539 Ga0068853_101627552 Ga0068853_1016275522 79
368 3300005543 Ga0070672_101620306 Ga0070672_1016203062 79
369 3300005842 Ga0068858_102021961 Ga0068858_1020219611 79
370 3300005937 Ga0081455_10000894 Ga0081455_1000089419 79
371 3300006175 Ga0070712_100183789 Ga0070712_1001837892 79
372 3300006237 Ga0097621_100016270 Ga0097621_1000162704 79
373 3300006881 Ga0068865_100179506 Ga0068865_1001795063 79
374 3300009176 Ga0105242_10015932 Ga0105242_100159323 79
375 3300009551 Ga0105238_12473537 Ga0105238_124735372 79
376 3300013306 Ga0163162_10160816 Ga0163162_101608162 79
377 3300013308 Ga0157375_10044238 Ga0157375_100442384 79
378 3300025907 Ga0207645_10505879 Ga0207645_105058791 79
379 3300025934 Ga0207686_10037336 Ga0207686_100373363 79
380 3300025937 Ga0207669_10759472 Ga0207669_107594721 79
381 3300025938 Ga0207704_10018343 Ga0207704_100183434 79
382 3300025942 Ga0207689_10662965 Ga0207689_106629652 79
383 3300026023 Ga0207677_10554888 Ga0207677_105548882 79
384 3300026035 Ga0207703_10509008 Ga0207703_105090082 79
385 3300026041 Ga0207639_10719367 Ga0207639_107193672 79
386 3300026089 Ga0207648_10033844 Ga0207648_100338443 79
387 3300026121 Ga0207683_10082893 Ga0207683_100828934 79
388 3300044735 Ga0466968_0342618 Ga0466968_0342618_456_704 79
389 3300048903 Ga0496100_0229697 Ga0496100_0229697_879_1127 79
390 3300048904 Ga0496101_0497685 Ga0496101_0497685_573_821 79
391 3300048910 Ga0496107_0265906 Ga0496107_0265906_660_908 79
392 3300048917 Ga0496114_1778271 Ga0496114_1778271_211_459 79
393 3300001979 JGI24740J21852_10047147 JGI24740J21852_100471472 80
394 3300001979 JGI24740J21852_10057839 JGI24740J21852_100578392 80
395 3300006048 Ga0075363_100014511 Ga0075363_1000145113 80
396 3300006051 Ga0075364_10113108 Ga0075364_101131082 80
397 3300006058 Ga0075432_10055236 Ga0075432_100552362 80
398 3300006177 Ga0075362_10035266 Ga0075362_100352663 80
399 3300006177 Ga0075362_10192949 Ga0075362_101929492 80
400 3300006178 Ga0075367_10499047 Ga0075367_104990472 80
401 3300006186 Ga0075369_10003492 Ga0075369_100034924 80
402 3300006186 Ga0075369_10303906 Ga0075369_103039062 80
403 3300006195 Ga0075366_10000662 Ga0075366_1000066218 80
404 3300006353 Ga0075370_11029773 Ga0075370_110297731 80
405 3300006852 Ga0075433_10004023 Ga0075433_100040231 80
406 3300007076 Ga0075435_100986422 Ga0075435_1009864221 80
407 3300009094 Ga0111539_10065100 Ga0111539_100651002 80
408 3300010375 Ga0105239_10675538 Ga0105239_106755383 80
409 3300025940 Ga0207691_10295538 Ga0207691_102955383 80
410 3300027907 Ga0207428_10757509 Ga0207428_107575091 80
411 3300028800 Ga0265338_10802023 Ga0265338_108020232 80
412 3300031241 Ga0265325_10012432 Ga0265325_100124323 80
413 3300031242 Ga0265329_10037307 Ga0265329_100373073 80
414 3300031247 Ga0265340_10436649 Ga0265340_104366491 80
415 3300031249 Ga0265339_10034416 Ga0265339_100344164 80
416 3300031250 Ga0265331_10325440 Ga0265331_103254402 80
417 3300031344 Ga0265316_10024821 Ga0265316_100248212 80
418 3300031595 Ga0265313_10004746 Ga0265313_100047468 80
419 3300034957 Ga0373938_0064443 Ga0373938_0064443_467_730 80
420 3300035090 Ga0373949_0003686 Ga0373949_0003686_1725_1988 80
421 3300035116 Ga0373945_0167938 Ga0373945_0167938_548_799 80
422 3300035695 Ga0373927_0013349 Ga0373927_0013349_3349_3600 80
423 3300037068 Ga0373925_0360605 Ga0373925_0360605_147_398 80
424 3300047321 Ga0495676_0602384 Ga0495676_0602384_170_421 80
425 3300049571 Ga0501034_0767982 Ga0501034_0767982_103_363 80
426 3300049586 Ga0501070_0147472 Ga0501070_0147472_487_747 80
427 3300049744 Ga0501083_0009752 Ga0501083_0009752_2965_3216 80
428 3300049823 Ga0501044_0090498 Ga0501044_0090498_36_296 80
429 3300050489 nmdc:mga03683_632871_c1 nmdc:mga03683_632871_c1_39_290 80
430 3300050490 nmdc:mga03n38_198185_c1 nmdc:mga03n38_198185_c1_598_849 80
431 3300050491 nmdc:mga00v17_273944_c1 nmdc:mga00v17_273944_c1_730_981 80
432 3300050493 nmdc:mga0k408_701396_c1 nmdc:mga0k408_701396_c1_207_461 80
433 3300050493 nmdc:mga0k408_805_c1 nmdc:mga0k408_805_c1_2154_2405 80
434 3300050493 nmdc:mga0k408_866010_c1 nmdc:mga0k408_866010_c1_32_286 80
435 3300050494 nmdc:mga06z11_347581_c1 nmdc:mga06z11_347581_c1_277_531 80
436 3300050494 nmdc:mga06z11_989018_c1 nmdc:mga06z11_989018_c1_24_275 80
437 3300050496 nmdc:mga07m45_465284_c1 nmdc:mga07m45_465284_c1_92_343 80
438 3300050511 nmdc:mga08y16_186915_c1 nmdc:mga08y16_186915_c1_91_354 80
439 3300050512 nmdc:mga0n895_40096_c1 nmdc:mga0n895_40096_c1_3739_4002 80
440 3300050513 nmdc:mga0rr50_32397_c1 nmdc:mga0rr50_32397_c1_854_1117 80
441 3300050515 nmdc:mga0a205_36333_c1 nmdc:mga0a205_36333_c1_4310_4573 80
442 3300050516 nmdc:mga0sz30_10581_c1 nmdc:mga0sz30_10581_c1_782_1024 80
443 3300054114 Ga0501084_0950463 Ga0501084_0950463_318_569 80
444 3300060353 Ga0501082_1558962 Ga0501082_1558962_180_431 80

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

23

82

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7784 3 74
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7526 3 74
3o2h-assembly1.cif.gz_A e. coli clps in complex with a leu n-end rule peptide 0.6401 4 67
3gq1-assembly2.cif.gz_B the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide 0.6315 5 67
2wa8-assembly2.cif.gz_C structural basis of n-end rule substrate recognition in escherichia coli by the clpap adaptor protein clps - the phe peptide structure 0.6312 5 67
ID Description Score Start End Superfamily
af_K7UQ19_118_172_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8341 28 56 3.30.730.10
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7784 3 74 3.30.70.2400
af_B4FET9_33_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7774 31 59 3.30.730.10
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7526 3 74 3.30.70.2400
af_K7KMY2_15_72_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7462 22 53 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A2E1RWQ1-F1-model_v4 Inositol monophosphatase 1 6 67
AF-A0A7Y4TAE6-F1-model_v4 DUF4170 domain-containing protein 0.9957 5 68
AF-A0A3D4F2C3-F1-model_v4 deleted 0.9906 9 65
AF-A0A2A8HQB2-F1-model_v4 Inositol monophosphatase 0.9718 7 69
AF-A0A3B1A9C7-F1-model_v4 Uncharacterized protein, Bsl7517 homolog 0.9691 11 69

Feature Viewer

pLDDT pTM Quality
83.44 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map