F445242

General Info

Members Datasets Scaffolds Average Seq Length
444 263 888 435

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100000702|Ga0070698_10000070225
Length 493
Sequence MLTGVSRRLLAGASALATSLLVASSITGAAGIGAASACTSDDVFRIYRQQLERDPESDGAVAGRVGRPCDQVEDEIASSAEARALRAGMVDDLLRQGRHIFRFDTFGDEAFWGDVLGLHRAIIGAKNGGVGPGVSPKTALAVGLKVDVDALPNSVRTALARGEVNLDDPATTVALLKLNAVVGVKAFTNPDGSVRSMGIQCALCHSTVDNSFAPGIGHRLDGWPNRDLNVGAIVSLAPNLKAVAEALGVDVDTVKKVLAAWGPGKFDAELFLDGKGFRPDGKSAATLIPPAYGLAGVNLHTYTGWGSVPYWNAFVANLEMHGVGNFYDPRLDDASKFPIAARSRLGHTQVSLEKDQITAKLAALHFYQLALAAPKPTPGSFDAAAAARGRALFAGSAGCASCHIPPLYTEPGWNLHTPAEVGIDSFQSDRSPDGRYRTTPLGGLGQRSMQQGGFFHDGRFPTLLDVVNHYDGFQHLGLSDAQKRDLVEFLKSL

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.05
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100000702 3300005471 Bacteria 35811
2 JGI24752J21851_1002476 3300001976 Bacteria 2458
3 Ga0007410J51695_1025075 3300003574 Bacteria 1599
4 Ga0065712_10092396 3300005290 Unclassified 2333
5 Ga0070676_10010885 3300005328 Unclassified 4939
6 Ga0070683_100045193 3300005329 Bacteria 4065
7 Ga0070690_100011192 3300005330 Bacteria 5242
8 Ga0070670_100030819 3300005331 Bacteria 4619
9 Ga0070670_100123335 3300005331 Bacteria 2235
10 Ga0068869_100074296 3300005334 Bacteria 2523
11 Ga0070680_100024451 3300005336 Bacteria 4825
12 Ga0070680_100039142 3300005336 Bacteria 3837
13 Ga0070682_100127297 3300005337 Bacteria 1719
14 Ga0068868_100006266 3300005338 Bacteria 8414
15 Ga0068868_100059095 3300005338 Bacteria 3032
16 Ga0068868_100254222 3300005338 Bacteria 1479
17 Ga0070660_100051325 3300005339 Bacteria 3176
18 Ga0070689_100000508 3300005340 Bacteria 22987
19 Ga0070689_100089975 3300005340 Bacteria 2418
20 Ga0070691_10030120 3300005341 Bacteria 2542
21 Ga0070687_100013465 3300005343 Bacteria 3647
22 Ga0070692_10001910 3300005345 Bacteria 7866
23 Ga0070675_100043878 3300005354 Bacteria 3657
24 Ga0070671_100047087 3300005355 Bacteria 3587
25 Ga0070671_100098188 3300005355 Bacteria 2456
26 Ga0070688_100071938 3300005365 Bacteria 2215
27 Ga0070659_100186150 3300005366 Bacteria 1705
28 Ga0070667_100068820 3300005367 Unclassified 3012
29 Ga0070710_10051245 3300005437 Bacteria 2317
30 Ga0070711_100005004 3300005439 Bacteria 7876
31 Ga0070678_100001939 3300005456 Bacteria 11162
32 Ga0070662_100012564 3300005457 Bacteria 5617
33 Ga0070681_10017963 3300005458 Bacteria 7069
34 Ga0068867_100008288 3300005459 Bacteria 7336
35 Ga0068867_100012963 3300005459 Bacteria 5899
36 Ga0070685_10078601 3300005466 Bacteria 1973
37 Ga0070706_100003130 3300005467 Bacteria 16362
38 Ga0070706_100013567 3300005467 Bacteria 7533
39 Ga0070707_100034997 3300005468 Bacteria 4789
40 Ga0070707_100117493 3300005468 Bacteria 2581
41 Ga0070698_100013731 3300005471 Bacteria 8571
42 Ga0070699_100019190 3300005518 Bacteria 5883
43 Ga0070679_100055279 3300005530 Bacteria 3953
44 Ga0070679_100104032 3300005530 Bacteria 2826
45 Ga0070684_100077229 3300005535 Bacteria 2941
46 Ga0070697_100034461 3300005536 Bacteria 4082
47 Ga0070672_100010495 3300005543 Bacteria 6426
48 Ga0070686_100034258 3300005544 Unclassified 3128
49 Ga0070693_100003430 3300005547 Bacteria 7395
50 Ga0070693_100157486 3300005547 Bacteria 1444
51 Ga0068855_100077353 3300005563 Bacteria 3861
52 Ga0068854_100130525 3300005578 Unclassified 1918
53 Ga0068856_100082042 3300005614 Bacteria 3199
54 Ga0068856_100128074 3300005614 Bacteria 2542
55 Ga0070702_100003665 3300005615 Bacteria 6918
56 Ga0068852_100033432 3300005616 Bacteria 4269
57 Ga0068859_100165078 3300005617 Unclassified 2294
58 Ga0068864_100171411 3300005618 Bacteria 1979
59 Ga0068866_10029649 3300005718 Unclassified 2619
60 Ga0068866_10054270 3300005718 Bacteria 2053
61 Ga0068861_100014699 3300005719 Bacteria 5497
62 Ga0068861_100109262 3300005719 Unclassified 2213
63 Ga0068851_10013032 3300005834 Bacteria 3931
64 Ga0068870_10003688 3300005840 Bacteria 6509
65 Ga0068870_10052741 3300005840 Bacteria 2157
66 Ga0068863_100017233 3300005841 Bacteria 6927
67 Ga0068863_100055752 3300005841 Bacteria 3742
68 Ga0068858_100042291 3300005842 Bacteria 4225
69 Ga0081455_10008848 3300005937 Bacteria 10415
70 Ga0081455_10029746 3300005937 Bacteria 4975
71 Ga0081455_10062565 3300005937 Bacteria 3127
72 Ga0081455_10083567 3300005937 Bacteria 2609
73 Ga0081538_10004216 3300005981 Bacteria 13341
74 Ga0081538_10005169 3300005981 Bacteria 11815
75 Ga0081538_10006677 3300005981 Bacteria 10109
76 Ga0081540_1001146 3300005983 Bacteria 23395
77 Ga0081539_10004220 3300005985 Bacteria 16190
78 Ga0081539_10017794 3300005985 Bacteria 4966
79 Ga0075432_10011805 3300006058 Bacteria 2969
80 Ga0070715_10027382 3300006163 Unclassified 2277
81 Ga0097621_100005834 3300006237 Bacteria 8698
82 Ga0097621_100023539 3300006237 Unclassified 4797
83 Ga0097621_100026036 3300006237 Bacteria 4584
84 Ga0075428_100013628 3300006844 Bacteria 9053
85 Ga0075428_100014007 3300006844 Bacteria 8926
86 Ga0075428_100095221 3300006844 Bacteria 3245
87 Ga0075428_100122156 3300006844 Bacteria 2835
88 Ga0075430_100017105 3300006846 Bacteria 6176
89 Ga0075430_100045352 3300006846 Bacteria 3714
90 Ga0075431_100014855 3300006847 Bacteria 7882
91 Ga0075431_100050719 3300006847 Bacteria 4278
92 Ga0075431_100260245 3300006847 Bacteria 1761
93 Ga0075433_10001542 3300006852 Bacteria 17029
94 Ga0075433_10003154 3300006852 Bacteria 12695
95 Ga0075433_10005973 3300006852 Bacteria 9586
96 Ga0075433_10031675 3300006852 Bacteria 4522
97 Ga0075433_10041369 3300006852 Bacteria 3992
98 Ga0075433_10184952 3300006852 Bacteria 1854
99 Ga0075434_100005473 3300006871 Bacteria 11567
100 Ga0075434_100012228 3300006871 Bacteria 8133
101 Ga0075434_100041177 3300006871 Bacteria 4576
102 Ga0075434_100051360 3300006871 Bacteria 4098
103 Ga0075429_100057011 3300006880 Bacteria 3401
104 Ga0075436_100001498 3300006914 Bacteria 15931
105 Ga0097620_100165071 3300006931 Unclassified 2294
106 Ga0075435_100002451 3300007076 Bacteria 12316
107 Ga0075435_100004507 3300007076 Bacteria 9575
108 Ga0105240_10061109 3300009093 Bacteria 4696
109 Ga0105240_10077605 3300009093 Bacteria 4091
110 Ga0105240_10081239 3300009093 Unclassified 3984
111 Ga0105240_10091823 3300009093 Bacteria 3708
112 Ga0111539_10224320 3300009094 Bacteria 2189
113 Ga0111539_10344421 3300009094 Bacteria 1735
114 Ga0111539_10371993 3300009094 Bacteria 1663
115 Ga0105245_10080706 3300009098 Bacteria 2972
116 Ga0114129_10012163 3300009147 Bacteria 12246
117 Ga0114129_10017594 3300009147 Bacteria 10175
118 Ga0114129_10018386 3300009147 Bacteria 9954
119 Ga0114129_10039820 3300009147 Bacteria 6629
120 Ga0114129_10072258 3300009147 Bacteria 4809
121 Ga0114129_10096837 3300009147 Bacteria 4085
122 Ga0114129_10147643 3300009147 Bacteria 3220
123 Ga0114129_10301825 3300009147 Bacteria 2134
124 Ga0105243_10005332 3300009148 Bacteria 10044
125 Ga0105243_10054511 3300009148 Bacteria 3175
126 Ga0105243_10095058 3300009148 Bacteria 2462
127 Ga0105241_10050227 3300009174 Bacteria 3178
128 Ga0105242_10075291 3300009176 Bacteria 2810
129 Ga0105248_10068075 3300009177 Bacteria 3998
130 Ga0105248_10340898 3300009177 Bacteria 1687
131 Ga0105249_10082270 3300009553 Bacteria 2996
132 Ga0105239_10165070 3300010375 Bacteria 2476
133 Ga0105239_10331626 3300010375 Bacteria 1716
134 Ga0105246_10005079 3300011119 Bacteria 8008
135 Ga0157371_10045092 3300013102 Bacteria 3138
136 Ga0157371_10088508 3300013102 Bacteria 2192
137 Ga0157369_10094656 3300013105 Bacteria 3188
138 Ga0157374_10011117 3300013296 Bacteria 7782
139 Ga0157374_10014897 3300013296 Bacteria 6814
140 Ga0157374_10021623 3300013296 Bacteria 5728
141 Ga0157374_10166357 3300013296 Bacteria 2149
142 Ga0157378_10104504 3300013297 Bacteria 2589
143 Ga0163162_10002247 3300013306 Bacteria 18141
144 Ga0163162_10059211 3300013306 Bacteria 3862
145 Ga0157372_10111082 3300013307 Bacteria 3140
146 Ga0157372_10207406 3300013307 Bacteria 2271
147 Ga0157372_10216282 3300013307 Bacteria 2221
148 Ga0157375_10011282 3300013308 Bacteria 7889
149 Ga0157375_10019172 3300013308 Bacteria 6215
150 Ga0163163_10075824 3300014325 Bacteria 3357
151 Ga0182008_10010794 3300014497 Bacteria 4881
152 Ga0157377_10005697 3300014745 Bacteria 5873
153 Ga0157377_10006768 3300014745 Bacteria 5491
154 Ga0157379_10049916 3300014968 Bacteria 3736
155 Ga0157376_10004423 3300014969 Bacteria 9789
156 Ga0206356_11363696 3300020070 Bacteria 2016
157 Ga0206350_11347913 3300020080 Bacteria 2599
158 Ga0224712_10072856 3300022467 Unclassified 1400
159 Ga0207697_10072436 3300025315 Bacteria 1445
160 Ga0207656_10001992 3300025321 Bacteria 6803
161 Ga0207692_10044377 3300025898 Bacteria 2218
162 Ga0207688_10002460 3300025901 Bacteria 9960
163 Ga0207680_10006348 3300025903 Bacteria 5709
164 Ga0207647_10049214 3300025904 Bacteria 2615
165 Ga0207643_10000212 3300025908 Bacteria 40664
166 Ga0207684_10000024 3300025910 Bacteria 322180
167 Ga0207684_10031148 3300025910 Bacteria 4540
168 Ga0207654_10002657 3300025911 Bacteria 9075
169 Ga0207707_10014013 3300025912 Bacteria 6990
170 Ga0207695_10007189 3300025913 Bacteria 14236
171 Ga0207695_10009967 3300025913 Bacteria 11671
172 Ga0207695_10126970 3300025913 Bacteria 2511
173 Ga0207663_10004398 3300025916 Bacteria 6996
174 Ga0207660_10008531 3300025917 Bacteria 6628
175 Ga0207660_10083206 3300025917 Bacteria 2356
176 Ga0207662_10024648 3300025918 Bacteria 3462
177 Ga0207649_10005112 3300025920 Bacteria 7089
178 Ga0207652_10042730 3300025921 Bacteria 3859
179 Ga0207646_10004031 3300025922 Bacteria 16228
180 Ga0207650_10001716 3300025925 Bacteria 15557
181 Ga0207650_10018023 3300025925 Bacteria 4949
182 Ga0207650_10227019 3300025925 Bacteria 1505
183 Ga0207659_10008568 3300025926 Bacteria 6357
184 Ga0207664_10000234 3300025929 Bacteria 41968
185 Ga0207644_10033927 3300025931 Bacteria 3570
186 Ga0207706_10014603 3300025933 Bacteria 7113
187 Ga0207706_10016520 3300025933 Bacteria 6661
188 Ga0207706_10042931 3300025933 Bacteria 4007
189 Ga0207709_10172079 3300025935 Bacteria 1521
190 Ga0207670_10000512 3300025936 Bacteria 21354
191 Ga0207691_10021433 3300025940 Bacteria 6101
192 Ga0207691_10028669 3300025940 Bacteria 5210
193 Ga0207689_10058772 3300025942 Bacteria 3163
194 Ga0207689_10075353 3300025942 Bacteria 2773
195 Ga0207689_10175210 3300025942 Bacteria 1768
196 Ga0207661_10005677 3300025944 Bacteria 8806
197 Ga0207679_10003344 3300025945 Bacteria 9906
198 Ga0207651_10095411 3300025960 Bacteria 2190
199 Ga0207712_10142094 3300025961 Bacteria 1843
200 Ga0207677_10030299 3300026023 Bacteria 3451
201 Ga0207677_10062210 3300026023 Unclassified 2588
202 Ga0207703_10029831 3300026035 Bacteria 4306
203 Ga0207678_10001541 3300026067 Bacteria 21152
204 Ga0207708_10105421 3300026075 Bacteria 2185
205 Ga0207641_10005790 3300026088 Bacteria 10495
206 Ga0207641_10024746 3300026088 Bacteria 4948
207 Ga0207641_10231394 3300026088 Bacteria 1718
208 Ga0207648_10007321 3300026089 Bacteria 10875
209 Ga0207648_10021477 3300026089 Bacteria 5802
210 Ga0207676_10010451 3300026095 Bacteria 6610
211 Ga0207675_100333496 3300026118 Bacteria 1483
212 Ga0207683_10003605 3300026121 Bacteria 13489
213 Ga0207683_10009824 3300026121 Bacteria 8163
214 Ga0207698_10005270 3300026142 Bacteria 7954
215 Ga0207698_10022690 3300026142 Bacteria 4369
216 Ga0207428_10017143 3300027907 Bacteria 6224
217 Ga0307509_10110182 3300031507 Bacteria 2759
218 Ga0307408_100087069 3300031548 Bacteria 2349
219 Ga0307405_10007567 3300031731 Bacteria 5444
220 Ga0307405_10018991 3300031731 Bacteria 3807
221 Ga0307410_10006062 3300031852 Bacteria 6482
222 Ga0307406_10006160 3300031901 Bacteria 6598
223 Ga0307406_10026467 3300031901 Bacteria 3484
224 Ga0307409_100007867 3300031995 Bacteria 6416
225 Ga0307416_100002183 3300032002 Bacteria 11105
226 Ga0307416_100081782 3300032002 Bacteria 2733
227 Ga0307411_10205167 3300032005 Bacteria 1517
228 Ga0307415_100002473 3300032126 Bacteria 9230
229 Ga0307415_100016500 3300032126 Bacteria 4406
230 Ga0373923_0001655 3300035111 Bacteria 6510
231 Ga0373936_0001116 3300035113 Bacteria 9626
232 Ga0373954_0016751 3300035118 Bacteria 3285
233 Ga0373957_0025793 3300035120 Unclassified 2122
234 Ga0373943_0008248 3300035170 Bacteria 4675
235 Ga0373943_0011831 3300035170 Bacteria 3926
236 Ga0373946_0000239 3300035171 Bacteria 17240
237 Ga0373955_0000199 3300035172 Bacteria 24890
238 Ga0373955_0071430 3300035172 Bacteria 1942
239 Ga0373935_0000054 3300035692 Bacteria 46833
240 Ga0373927_0079011 3300035695 Bacteria 2131
241 Ga0373933_0001735 3300035724 Bacteria 12656
242 Ga0373933_0016541 3300035724 Bacteria 4127
243 Ga0373933_0025169 3300035724 Bacteria 3411
244 Ga0373947_0001754 3300035725 Bacteria 13269
245 Ga0373937_0000593 3300036401 Bacteria 32100
246 Ga0373937_0031830 3300036401 Bacteria 4781
247 Ga0373937_0048292 3300036401 Bacteria 3896
248 Ga0373937_0103625 3300036401 Bacteria 2643
249 Ga0395899_0027609 3300037312 Bacteria 4277
250 Ga0395899_0039715 3300037312 Bacteria 3521
251 Ga0395900_0001640 3300037418 Bacteria 26256
252 Ga0395900_0012215 3300037418 Bacteria 8779
253 Ga0395900_0096520 3300037418 Bacteria 3037
254 Ga0395900_0307762 3300037418 Bacteria 1569
255 Ga0395898_0002031 3300037466 Bacteria 25359
256 Ga0395898_0055083 3300037466 Bacteria 3879
257 Ga0395898_0119948 3300037466 Bacteria 2520
258 Ga0395905_0008944 3300037471 Bacteria 9833
259 Ga0395905_0011917 3300037471 Bacteria 8383
260 Ga0395905_0160760 3300037471 Bacteria 2111
261 Ga0395901_0001363 3300038443 Bacteria 25559
262 Ga0395901_0016787 3300038443 Bacteria 7460
263 Ga0395901_0067303 3300038443 Bacteria 3730
264 Ga0395901_0168582 3300038443 Bacteria 2298
265 Ga0395901_0245182 3300038443 Bacteria 1868
266 Ga0395901_0299039 3300038443 Bacteria 1669
267 Ga0439448_0005552 3300042005 Bacteria 3598
268 Ga0450900_006858 3300042136 Bacteria 1389
269 Ga0439460_0007161 3300042461 Bacteria 2783
270 Ga0451577_0121291 3300042876 Bacteria 2342
271 Ga0466963_0110775 3300044694 Bacteria 1884
272 Ga0451576_0021129 3300045051 Bacteria 7075
273 Ga0466967_0146866 3300045976 Bacteria 2200
274 Ga0495592_0000031 3300046454 Bacteria 128596
275 Ga0495629_0030134 3300046459 Bacteria 3847
276 Ga0495651_0002254 3300046462 Bacteria 14903
277 Ga0495651_0036357 3300046462 Bacteria 3834
278 Ga0495653_0000063 3300046463 Bacteria 93232
279 Ga0495653_0024405 3300046463 Bacteria 4873
280 Ga0495582_0046960 3300046473 Bacteria 2378
281 Ga0495662_0000791 3300046476 Bacteria 15347
282 Ga0495664_0000004 3300046477 Bacteria 489411
283 Ga0495664_0009188 3300046477 Bacteria 5527
284 Ga0495608_0000005 3300046511 Bacteria 350726
285 Ga0495608_0067279 3300046511 Unclassified 2343
286 Ga0495618_0000095 3300046514 Bacteria 63583
287 Ga0495618_0016796 3300046514 Unclassified 4482
288 Ga0495618_0017159 3300046514 Unclassified 4437
289 Ga0495628_0000001 3300046516 Bacteria 917742
290 Ga0495628_0013300 3300046516 Bacteria 6924
291 Ga0495628_0123390 3300046516 Bacteria 1985
292 Ga0495630_0001436 3300046517 Bacteria 16507
293 Ga0495666_0080562 3300046526 Bacteria 1541
294 Ga0495652_0000002 3300046529 Bacteria 946606
295 Ga0495652_0152357 3300046529 Bacteria 1805
296 Ga0495640_0000001 3300046533 Bacteria 853827
297 Ga0495586_0057596 3300046535 Unclassified 2109
298 Ga0495587_0000016 3300046536 Bacteria 185585
299 Ga0495587_0021176 3300046536 Unclassified 4009
300 Ga0495645_0000002 3300046543 Bacteria 651644
301 Ga0495667_0000007 3300046559 Bacteria 234736
302 Ga0495634_0000591 3300046642 Bacteria 35197
303 Ga0495634_0040689 3300046642 Unclassified 3159
304 Ga0495635_0000002 3300046663 Bacteria 490490
305 Ga0495657_0000668 3300046675 Bacteria 31053
306 Ga0495599_0000005 3300046678 Bacteria 300169
307 Ga0495599_0014327 3300046678 Bacteria 4910
308 Ga0495623_0000016 3300046679 Bacteria 113454
309 Ga0495646_0000002 3300046680 Bacteria 310568
310 Ga0495646_0118563 3300046680 Bacteria 1499
311 Ga0495658_0009247 3300046683 Bacteria 4902
312 Ga0495658_0030132 3300046683 Unclassified 2944
313 Ga0495624_0030711 3300046690 Bacteria 3497
314 Ga0495670_0101993 3300046691 Bacteria 1478
315 Ga0495600_0000018 3300046809 Bacteria 102683
316 Ga0495600_0025021 3300046809 Unclassified 3845
317 Ga0495604_0000020 3300047317 Bacteria 171989
318 Ga0495674_0000002 3300047319 Bacteria 642785
319 Ga0495674_0030090 3300047319 Bacteria 4940
320 Ga0495674_0126606 3300047319 Bacteria 2154
321 Ga0495676_0170537 3300047321 Bacteria 1532
322 Ga0495680_0000419 3300047322 Bacteria 47547
323 Ga0495680_0031683 3300047322 Bacteria 4299
324 Ga0495675_0000120 3300047444 Bacteria 57071
325 Ga0495675_0020272 3300047444 Unclassified 4227
326 Ga0495684_0000016 3300047471 Bacteria 169338
327 Ga0495684_0011029 3300047471 Bacteria 6989
328 Ga0495593_0005685 3300047673 Bacteria 7356
329 Ga0495602_0000040 3300048088 Bacteria 127280
330 Ga0495614_0044076 3300048089 Bacteria 1914
331 Ga0496100_0016345 3300048903 Bacteria 4356
332 Ga0496101_0006880 3300048904 Bacteria 7340
333 Ga0496101_0010412 3300048904 Bacteria 6140
334 Ga0496101_0041129 3300048904 Bacteria 3294
335 Ga0496102_0005985 3300048905 Bacteria 10358
336 Ga0496104_0017075 3300048907 Bacteria 6604
337 Ga0496104_0061982 3300048907 Bacteria 3546
338 Ga0496105_0003495 3300048908 Bacteria 11636
339 Ga0496106_0001105 3300048909 Bacteria 19947
340 Ga0496106_0014150 3300048909 Bacteria 5894
341 Ga0496106_0182452 3300048909 Bacteria 1666
342 Ga0496107_0000600 3300048910 Bacteria 20105
343 Ga0496109_0038872 3300048912 Bacteria 4304
344 Ga0496110_0059005 3300048913 Bacteria 3380
345 Ga0496112_0016729 3300048915 Bacteria 6877
346 Ga0496113_0003773 3300048916 Bacteria 9147
347 Ga0496114_0140746 3300048917 Bacteria 2089
348 Ga0496115_0022664 3300048918 Bacteria 4869
349 Ga0501031_0001762 3300049568 Bacteria 13581
350 Ga0501032_0061539 3300049569 Bacteria 2516
351 Ga0501033_0013024 3300049570 Bacteria 6342
352 Ga0501034_0180642 3300049571 Bacteria 2075
353 Ga0501036_0001400 3300049572 Bacteria 18538
354 Ga0501036_0005742 3300049572 Bacteria 10067
355 Ga0501037_0008315 3300049573 Bacteria 7605
356 Ga0501038_0002493 3300049574 Bacteria 17137
357 Ga0501039_0000933 3300049575 Bacteria 21329
358 Ga0501039_0052107 3300049575 Bacteria 3166
359 Ga0501039_0072775 3300049575 Unclassified 2671
360 Ga0501040_0000509 3300049576 Bacteria 23290
361 Ga0501040_0002062 3300049576 Bacteria 12958
362 Ga0501040_0023565 3300049576 Bacteria 4128
363 Ga0501041_0003509 3300049577 Bacteria 9025
364 Ga0501042_0000191 3300049578 Bacteria 28771
365 Ga0501042_0002181 3300049578 Bacteria 11936
366 Ga0501042_0008865 3300049578 Bacteria 6670
367 Ga0501042_0133309 3300049578 Bacteria 1791
368 Ga0501046_0001599 3300049580 Bacteria 21651
369 Ga0501048_0003453 3300049582 Bacteria 12015
370 Ga0501068_0048469 3300049584 Bacteria 2565
371 Ga0501071_0001093 3300049587 Bacteria 15081
372 Ga0501071_0006242 3300049587 Bacteria 7733
373 Ga0501071_0049557 3300049587 Bacteria 3024
374 Ga0501071_0134239 3300049587 Bacteria 1841
375 Ga0501072_0000210 3300049588 Bacteria 42511
376 Ga0501072_0000724 3300049588 Bacteria 24019
377 Ga0501072_0006351 3300049588 Bacteria 8997
378 Ga0501072_0074055 3300049588 Bacteria 2693
379 Ga0501073_0164012 3300049589 Bacteria 1539
380 Ga0501074_0028917 3300049590 Bacteria 4015
381 Ga0501075_0000368 3300049591 Bacteria 25845
382 Ga0501075_0003038 3300049591 Bacteria 11207
383 Ga0501075_0019826 3300049591 Bacteria 4882
384 Ga0501075_0118239 3300049591 Bacteria 2015
385 Ga0501076_0000102 3300049592 Bacteria 46456
386 Ga0501076_0001417 3300049592 Bacteria 16062
387 Ga0501076_0030047 3300049592 Bacteria 4231
388 Ga0501077_0002376 3300049593 Bacteria 11298
389 Ga0501077_0006617 3300049593 Bacteria 7116
390 Ga0501077_0022685 3300049593 Bacteria 3978
391 Ga0501250_000045 3300049680 Bacteria 6025
392 Ga0501079_0003019 3300049741 Bacteria 12307
393 Ga0501079_0003297 3300049741 Bacteria 11829
394 Ga0501079_0073541 3300049741 Unclassified 2642
395 Ga0501080_0000517 3300049742 Bacteria 30417
396 Ga0501080_0013578 3300049742 Bacteria 7499
397 Ga0501081_0000114 3300049743 Bacteria 34717
398 Ga0501081_0001774 3300049743 Bacteria 13376
399 Ga0501081_0008894 3300049743 Bacteria 6525
400 Ga0501083_0105843 3300049744 Bacteria 1852
401 Ga0501035_0016487 3300049822 Bacteria 6814
402 Ga0501045_0000058 3300049824 Bacteria 50547
403 Ga0501045_0000103 3300049824 Bacteria 41796
404 Ga0501045_0041241 3300049824 Unclassified 3359
405 Ga0501045_0232848 3300049824 Bacteria 1371
406 nmdc:mga05p37_10503_c1 3300050507 Bacteria 10983
407 nmdc:mga05p37_4148_c2 3300050507 Bacteria 15287
408 nmdc:mga05p37_47744_c1 3300050507 Bacteria 5265
409 nmdc:mga05p37_7734_c1 3300050507 Bacteria 12686
410 nmdc:mga09592_65897_c1 3300050508 Bacteria 3069
411 nmdc:mga0qj67_13468_c1 3300050509 Bacteria 6167
412 nmdc:mga06r32_109327_c1 3300050510 Bacteria 2719
413 nmdc:mga06r32_14926_c1 3300050510 Bacteria 7051
414 nmdc:mga06r32_76003_c1 3300050510 Unclassified 3261
415 nmdc:mga08y16_184952_c1 3300050511 Bacteria 2163
416 nmdc:mga08y16_243491_c1 3300050511 Bacteria 1859
417 nmdc:mga0n895_19071_c1 3300050512 Bacteria 6367
418 nmdc:mga0n895_60919_c1 3300050512 Bacteria 3725
419 nmdc:mga0n895_969_c1 3300050512 Bacteria 13990
420 nmdc:mga0rr50_3178_c1 3300050513 Bacteria 9383
421 nmdc:mga0rr50_46821_c1 3300050513 Bacteria 3186
422 nmdc:mga08x19_6981_c1 3300050514 Bacteria 6708
423 nmdc:mga0a205_19632_c1 3300050515 Bacteria 6375
424 nmdc:mga0a205_65679_c1 3300050515 Bacteria 3506
425 nmdc:mga0a205_7986_c1 3300050515 Bacteria 9611
426 Ga0495601_0000018 3300053077 Bacteria 171665
427 Ga0495601_0009639 3300053077 Bacteria 5716
428 Ga0495612_0000011 3300053078 Bacteria 224729
429 Ga0495612_0001888 3300053078 Bacteria 8616
430 Ga0495595_0000043 3300053084 Bacteria 63655
431 Ga0495595_0030600 3300053084 Unclassified 2415
432 Ga0495619_0000014 3300053085 Bacteria 261449
433 Ga0495619_0001136 3300053085 Bacteria 17480
434 Ga0501084_0001928 3300054114 Bacteria 16546
435 Ga0501084_0003859 3300054114 Bacteria 12203
436 Ga0501084_0036462 3300054114 Bacteria 4107
437 Ga0590075_001768 3300059424 Bacteria 5301
438 Ga0590077_001691 3300059426 Bacteria 5037
439 Ga0501082_0000237 3300060353 Bacteria 48294
440 Ga0501082_0002377 3300060353 Bacteria 16484
441 Ga0501082_0035950 3300060353 Bacteria 4268
442 Ga0530510_0001369 3300061734 Bacteria 16306
443 Ga0530510_0002029 3300061734 Bacteria 13911
444 Ga0530510_0003765 3300061734 Bacteria 10446
445 Ga0070698_100000702
446 JGI24752J21851_1002476
447 Ga0007410J51695_1025075
448 Ga0065712_10092396
449 Ga0070676_10010885
450 Ga0070683_100045193
451 Ga0070690_100011192
452 Ga0070670_100030819
453 Ga0070670_100123335
454 Ga0068869_100074296
455 Ga0070680_100024451
456 Ga0070680_100039142
457 Ga0070682_100127297
458 Ga0068868_100006266
459 Ga0068868_100059095
460 Ga0068868_100254222
461 Ga0070660_100051325
462 Ga0070689_100000508
463 Ga0070689_100089975
464 Ga0070691_10030120
465 Ga0070687_100013465
466 Ga0070692_10001910
467 Ga0070675_100043878
468 Ga0070671_100047087
469 Ga0070671_100098188
470 Ga0070688_100071938
471 Ga0070659_100186150
472 Ga0070667_100068820
473 Ga0070710_10051245
474 Ga0070711_100005004
475 Ga0070678_100001939
476 Ga0070662_100012564
477 Ga0070681_10017963
478 Ga0068867_100008288
479 Ga0068867_100012963
480 Ga0070685_10078601
481 Ga0070706_100003130
482 Ga0070706_100013567
483 Ga0070707_100034997
484 Ga0070707_100117493
485 Ga0070698_100013731
486 Ga0070699_100019190
487 Ga0070679_100055279
488 Ga0070679_100104032
489 Ga0070684_100077229
490 Ga0070697_100034461
491 Ga0070672_100010495
492 Ga0070686_100034258
493 Ga0070693_100003430
494 Ga0070693_100157486
495 Ga0068855_100077353
496 Ga0068854_100130525
497 Ga0068856_100082042
498 Ga0068856_100128074
499 Ga0070702_100003665
500 Ga0068852_100033432
501 Ga0068859_100165078
502 Ga0068864_100171411
503 Ga0068866_10029649
504 Ga0068866_10054270
505 Ga0068861_100014699
506 Ga0068861_100109262
507 Ga0068851_10013032
508 Ga0068870_10003688
509 Ga0068870_10052741
510 Ga0068863_100017233
511 Ga0068863_100055752
512 Ga0068858_100042291
513 Ga0081455_10008848
514 Ga0081455_10029746
515 Ga0081455_10062565
516 Ga0081455_10083567
517 Ga0081538_10004216
518 Ga0081538_10005169
519 Ga0081538_10006677
520 Ga0081540_1001146
521 Ga0081539_10004220
522 Ga0081539_10017794
523 Ga0075432_10011805
524 Ga0070715_10027382
525 Ga0097621_100005834
526 Ga0097621_100023539
527 Ga0097621_100026036
528 Ga0075428_100013628
529 Ga0075428_100014007
530 Ga0075428_100095221
531 Ga0075428_100122156
532 Ga0075430_100017105
533 Ga0075430_100045352
534 Ga0075431_100014855
535 Ga0075431_100050719
536 Ga0075431_100260245
537 Ga0075433_10001542
538 Ga0075433_10003154
539 Ga0075433_10005973
540 Ga0075433_10031675
541 Ga0075433_10041369
542 Ga0075433_10184952
543 Ga0075434_100005473
544 Ga0075434_100012228
545 Ga0075434_100041177
546 Ga0075434_100051360
547 Ga0075429_100057011
548 Ga0075436_100001498
549 Ga0097620_100165071
550 Ga0075435_100002451
551 Ga0075435_100004507
552 Ga0105240_10061109
553 Ga0105240_10077605
554 Ga0105240_10081239
555 Ga0105240_10091823
556 Ga0111539_10224320
557 Ga0111539_10344421
558 Ga0111539_10371993
559 Ga0105245_10080706
560 Ga0114129_10012163
561 Ga0114129_10017594
562 Ga0114129_10018386
563 Ga0114129_10039820
564 Ga0114129_10072258
565 Ga0114129_10096837
566 Ga0114129_10147643
567 Ga0114129_10301825
568 Ga0105243_10005332
569 Ga0105243_10054511
570 Ga0105243_10095058
571 Ga0105241_10050227
572 Ga0105242_10075291
573 Ga0105248_10068075
574 Ga0105248_10340898
575 Ga0105249_10082270
576 Ga0105239_10165070
577 Ga0105239_10331626
578 Ga0105246_10005079
579 Ga0157371_10045092
580 Ga0157371_10088508
581 Ga0157369_10094656
582 Ga0157374_10011117
583 Ga0157374_10014897
584 Ga0157374_10021623
585 Ga0157374_10166357
586 Ga0157378_10104504
587 Ga0163162_10002247
588 Ga0163162_10059211
589 Ga0157372_10111082
590 Ga0157372_10207406
591 Ga0157372_10216282
592 Ga0157375_10011282
593 Ga0157375_10019172
594 Ga0163163_10075824
595 Ga0182008_10010794
596 Ga0157377_10005697
597 Ga0157377_10006768
598 Ga0157379_10049916
599 Ga0157376_10004423
600 Ga0206356_11363696
601 Ga0206350_11347913
602 Ga0224712_10072856
603 Ga0207697_10072436
604 Ga0207656_10001992
605 Ga0207692_10044377
606 Ga0207688_10002460
607 Ga0207680_10006348
608 Ga0207647_10049214
609 Ga0207643_10000212
610 Ga0207684_10000024
611 Ga0207684_10031148
612 Ga0207654_10002657
613 Ga0207707_10014013
614 Ga0207695_10007189
615 Ga0207695_10009967
616 Ga0207695_10126970
617 Ga0207663_10004398
618 Ga0207660_10008531
619 Ga0207660_10083206
620 Ga0207662_10024648
621 Ga0207649_10005112
622 Ga0207652_10042730
623 Ga0207646_10004031
624 Ga0207650_10001716
625 Ga0207650_10018023
626 Ga0207650_10227019
627 Ga0207659_10008568
628 Ga0207664_10000234
629 Ga0207644_10033927
630 Ga0207706_10014603
631 Ga0207706_10016520
632 Ga0207706_10042931
633 Ga0207709_10172079
634 Ga0207670_10000512
635 Ga0207691_10021433
636 Ga0207691_10028669
637 Ga0207689_10058772
638 Ga0207689_10075353
639 Ga0207689_10175210
640 Ga0207661_10005677
641 Ga0207679_10003344
642 Ga0207651_10095411
643 Ga0207712_10142094
644 Ga0207677_10030299
645 Ga0207677_10062210
646 Ga0207703_10029831
647 Ga0207678_10001541
648 Ga0207708_10105421
649 Ga0207641_10005790
650 Ga0207641_10024746
651 Ga0207641_10231394
652 Ga0207648_10007321
653 Ga0207648_10021477
654 Ga0207676_10010451
655 Ga0207675_100333496
656 Ga0207683_10003605
657 Ga0207683_10009824
658 Ga0207698_10005270
659 Ga0207698_10022690
660 Ga0207428_10017143
661 Ga0307509_10110182
662 Ga0307408_100087069
663 Ga0307405_10007567
664 Ga0307405_10018991
665 Ga0307410_10006062
666 Ga0307406_10006160
667 Ga0307406_10026467
668 Ga0307409_100007867
669 Ga0307416_100002183
670 Ga0307416_100081782
671 Ga0307411_10205167
672 Ga0307415_100002473
673 Ga0307415_100016500
674 Ga0373923_0001655
675 Ga0373936_0001116
676 Ga0373954_0016751
677 Ga0373957_0025793
678 Ga0373943_0008248
679 Ga0373943_0011831
680 Ga0373946_0000239
681 Ga0373955_0000199
682 Ga0373955_0071430
683 Ga0373935_0000054
684 Ga0373927_0079011
685 Ga0373933_0001735
686 Ga0373933_0016541
687 Ga0373933_0025169
688 Ga0373947_0001754
689 Ga0373937_0000593
690 Ga0373937_0031830
691 Ga0373937_0048292
692 Ga0373937_0103625
693 Ga0395899_0027609
694 Ga0395899_0039715
695 Ga0395900_0001640
696 Ga0395900_0012215
697 Ga0395900_0096520
698 Ga0395900_0307762
699 Ga0395898_0002031
700 Ga0395898_0055083
701 Ga0395898_0119948
702 Ga0395905_0008944
703 Ga0395905_0011917
704 Ga0395905_0160760
705 Ga0395901_0001363
706 Ga0395901_0016787
707 Ga0395901_0067303
708 Ga0395901_0168582
709 Ga0395901_0245182
710 Ga0395901_0299039
711 Ga0439448_0005552
712 Ga0450900_006858
713 Ga0439460_0007161
714 Ga0451577_0121291
715 Ga0466963_0110775
716 Ga0451576_0021129
717 Ga0466967_0146866
718 Ga0495592_0000031
719 Ga0495629_0030134
720 Ga0495651_0002254
721 Ga0495651_0036357
722 Ga0495653_0000063
723 Ga0495653_0024405
724 Ga0495582_0046960
725 Ga0495662_0000791
726 Ga0495664_0000004
727 Ga0495664_0009188
728 Ga0495608_0000005
729 Ga0495608_0067279
730 Ga0495618_0000095
731 Ga0495618_0016796
732 Ga0495618_0017159
733 Ga0495628_0000001
734 Ga0495628_0013300
735 Ga0495628_0123390
736 Ga0495630_0001436
737 Ga0495666_0080562
738 Ga0495652_0000002
739 Ga0495652_0152357
740 Ga0495640_0000001
741 Ga0495586_0057596
742 Ga0495587_0000016
743 Ga0495587_0021176
744 Ga0495645_0000002
745 Ga0495667_0000007
746 Ga0495634_0000591
747 Ga0495634_0040689
748 Ga0495635_0000002
749 Ga0495657_0000668
750 Ga0495599_0000005
751 Ga0495599_0014327
752 Ga0495623_0000016
753 Ga0495646_0000002
754 Ga0495646_0118563
755 Ga0495658_0009247
756 Ga0495658_0030132
757 Ga0495624_0030711
758 Ga0495670_0101993
759 Ga0495600_0000018
760 Ga0495600_0025021
761 Ga0495604_0000020
762 Ga0495674_0000002
763 Ga0495674_0030090
764 Ga0495674_0126606
765 Ga0495676_0170537
766 Ga0495680_0000419
767 Ga0495680_0031683
768 Ga0495675_0000120
769 Ga0495675_0020272
770 Ga0495684_0000016
771 Ga0495684_0011029
772 Ga0495593_0005685
773 Ga0495602_0000040
774 Ga0495614_0044076
775 Ga0496100_0016345
776 Ga0496101_0006880
777 Ga0496101_0010412
778 Ga0496101_0041129
779 Ga0496102_0005985
780 Ga0496104_0017075
781 Ga0496104_0061982
782 Ga0496105_0003495
783 Ga0496106_0001105
784 Ga0496106_0014150
785 Ga0496106_0182452
786 Ga0496107_0000600
787 Ga0496109_0038872
788 Ga0496110_0059005
789 Ga0496112_0016729
790 Ga0496113_0003773
791 Ga0496114_0140746
792 Ga0496115_0022664
793 Ga0501031_0001762
794 Ga0501032_0061539
795 Ga0501033_0013024
796 Ga0501034_0180642
797 Ga0501036_0001400
798 Ga0501036_0005742
799 Ga0501037_0008315
800 Ga0501038_0002493
801 Ga0501039_0000933
802 Ga0501039_0052107
803 Ga0501039_0072775
804 Ga0501040_0000509
805 Ga0501040_0002062
806 Ga0501040_0023565
807 Ga0501041_0003509
808 Ga0501042_0000191
809 Ga0501042_0002181
810 Ga0501042_0008865
811 Ga0501042_0133309
812 Ga0501046_0001599
813 Ga0501048_0003453
814 Ga0501068_0048469
815 Ga0501071_0001093
816 Ga0501071_0006242
817 Ga0501071_0049557
818 Ga0501071_0134239
819 Ga0501072_0000210
820 Ga0501072_0000724
821 Ga0501072_0006351
822 Ga0501072_0074055
823 Ga0501073_0164012
824 Ga0501074_0028917
825 Ga0501075_0000368
826 Ga0501075_0003038
827 Ga0501075_0019826
828 Ga0501075_0118239
829 Ga0501076_0000102
830 Ga0501076_0001417
831 Ga0501076_0030047
832 Ga0501077_0002376
833 Ga0501077_0006617
834 Ga0501077_0022685
835 Ga0501250_000045
836 Ga0501079_0003019
837 Ga0501079_0003297
838 Ga0501079_0073541
839 Ga0501080_0000517
840 Ga0501080_0013578
841 Ga0501081_0000114
842 Ga0501081_0001774
843 Ga0501081_0008894
844 Ga0501083_0105843
845 Ga0501035_0016487
846 Ga0501045_0000058
847 Ga0501045_0000103
848 Ga0501045_0041241
849 Ga0501045_0232848
850 nmdc:mga05p37_10503_c1
851 nmdc:mga05p37_4148_c2
852 nmdc:mga05p37_47744_c1
853 nmdc:mga05p37_7734_c1
854 nmdc:mga09592_65897_c1
855 nmdc:mga0qj67_13468_c1
856 nmdc:mga06r32_109327_c1
857 nmdc:mga06r32_14926_c1
858 nmdc:mga06r32_76003_c1
859 nmdc:mga08y16_184952_c1
860 nmdc:mga08y16_243491_c1
861 nmdc:mga0n895_19071_c1
862 nmdc:mga0n895_60919_c1
863 nmdc:mga0n895_969_c1
864 nmdc:mga0rr50_3178_c1
865 nmdc:mga0rr50_46821_c1
866 nmdc:mga08x19_6981_c1
867 nmdc:mga0a205_19632_c1
868 nmdc:mga0a205_65679_c1
869 nmdc:mga0a205_7986_c1
870 Ga0495601_0000018
871 Ga0495601_0009639
872 Ga0495612_0000011
873 Ga0495612_0001888
874 Ga0495595_0000043
875 Ga0495595_0030600
876 Ga0495619_0000014
877 Ga0495619_0001136
878 Ga0501084_0001928
879 Ga0501084_0003859
880 Ga0501084_0036462
881 Ga0590075_001768
882 Ga0590077_001691
883 Ga0501082_0000237
884 Ga0501082_0002377
885 Ga0501082_0035950
886 Ga0530510_0001369
887 Ga0530510_0002029
888 Ga0530510_0003765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c2w-assembly1.cif.gz_F kuenenia stuttgartiensis hydrazine synthase pressurized with 20 bar xenon 0.6653 298 429
3o5c-assembly2.cif.gz_D cytochrome c peroxidase bccp of shewanella oneidensis 0.6079 215 428
2vhd-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form 0.599 195 429
6fu3-assembly1.cif.gz_B structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae 0.5907 199 428
2c1v-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - mixed valence form 0.5821 215 428
ID Description Score Start End Superfamily
3o5cD02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.4697 215 315 1.10.760.10
6cunA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.392 315 426 1.10.760.10
af_Q9SX38_416_510_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.3804 93 140 1.10.10.10
af_F1Q4P2_655_778_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.3351 94 139 1.10.10.10
3o5cD02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.3196 215 315 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A525VJ72-F1-model_v4 Cytochrome c 0.9919 354 429 GO:0009055
GO:0020037
AF-A0A534XWJ1-F1-model_v4 Cytochrome c domain-containing protein 0.9858 108 429 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A3N5VX08-F1-model_v4 Cytochrome c domain-containing protein 0.9854 38 429 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A536W948-F1-model_v4 Cytochrome c domain-containing protein 0.985 186 429 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A2V9HHE6-F1-model_v4 Cytochrome c domain-containing protein 0.9845 311 429 GO:0004130
GO:0009055
GO:0020037
GO:0046872

Map