F445199

General Info

Members Datasets Scaffolds Average Seq Length
444 171 445 363

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10003765|JGI24740J21852_100037654
Length 383
Sequence MNTAVSPLEGKVFMDSSFRWNDGLRIDRRTFAAGSAALLGGCATMSGRHYSGCTPLAPVIVDESRIIRTVAGLRPYRKQGFVVRAEALGEKRLVHNYGHGGGGITMSWGTSKLATELGLQGHSGPVAVIGSGAVGLATARLVQEAGFPVTIYAAALPPDTTSNIAGGQFHPFAVFREGFVTPVFMEQFARALDYSWRRYQIMVGDDYGVHWLPTYVKDGSPEAKTIATFPPINRMVSQAEHPFPDVTVFRYDTMYVETGRYLRQMTHDVQIAGGKIEVRKFATPADIGALPESLVFNCTGLGSHDLFGDSDLHPIRGQLAILEPQPEVRYAYLGDGYMFPRADGIVLGGTFERDVWDPTPQPDDIARILAAHKRLFSAFRCTA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.08
Rhizosphere 93.69
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003765 3300001979 Bacteria 6605
2 JGI24739J22299_10001694 3300001989 Bacteria 8375
3 JGI24739J22299_10002905 3300001989 Bacteria 6578
4 JGI24739J22299_10043942 3300001989 Bacteria 1474
5 JGI24737J22298_10001287 3300001990 Bacteria 8888
6 JGI24737J22298_10001625 3300001990 Bacteria 8011
7 JGI24738J21930_10000781 3300002075 Bacteria 9114
8 JGI24738J21930_10006098 3300002075 Bacteria 2849
9 rootH1_10097014 3300003316 Bacteria 2131
10 rootH1_10097014 3300003323 Bacteria 1491
11 Ga0070658_10002938 3300005327 Bacteria 14131
12 Ga0070658_10015564 3300005327 Bacteria 6082
13 Ga0070658_10082471 3300005327 Bacteria 2642
14 Ga0070658_10098452 3300005327 Bacteria 2416
15 Ga0070658_10342195 3300005327 Bacteria 1279
16 Ga0070676_10055469 3300005328 Bacteria 2338
17 Ga0070683_100003546 3300005329 Bacteria 12697
18 Ga0070690_100041991 3300005330 Bacteria 2896
19 Ga0070690_100167455 3300005330 Bacteria 1510
20 Ga0070670_100003150 3300005331 Bacteria 13638
21 Ga0070670_100222296 3300005331 Bacteria 1643
22 Ga0070670_100264266 3300005331 Bacteria 1501
23 Ga0068869_100000074 3300005334 Bacteria 45153
24 Ga0068869_100067933 3300005334 Bacteria 2631
25 Ga0070666_10000216 3300005335 Bacteria 39574
26 Ga0070666_10005022 3300005335 Bacteria 8091
27 Ga0070680_100034949 3300005336 Bacteria 4055
28 Ga0070680_100146338 3300005336 Bacteria 1982
29 Ga0068868_100000398 3300005338 Bacteria 29556
30 Ga0068868_100127427 3300005338 Bacteria 2081
31 Ga0068868_100223524 3300005338 Bacteria 1577
32 Ga0070660_100002994 3300005339 Bacteria 11634
33 Ga0070660_100032392 3300005339 Bacteria 3932
34 Ga0070660_100092393 3300005339 Bacteria 2388
35 Ga0070660_100134383 3300005339 Bacteria 1981
36 Ga0070660_100212848 3300005339 Bacteria 1569
37 Ga0070661_100000213 3300005344 Bacteria 48218
38 Ga0070661_100017719 3300005344 Bacteria 5056
39 Ga0070661_100092249 3300005344 Bacteria 2244
40 Ga0070661_100123656 3300005344 Bacteria 1939
41 Ga0070668_100001938 3300005347 Bacteria 15107
42 Ga0070668_100096848 3300005347 Bacteria 2332
43 Ga0070669_100000197 3300005353 Bacteria 52472
44 Ga0070669_100059729 3300005353 Bacteria 2800
45 Ga0070669_100059738 3300005353 Bacteria 2799
46 Ga0070669_100176470 3300005353 Bacteria 1669
47 Ga0070671_100001167 3300005355 Bacteria 19610
48 Ga0070671_100004477 3300005355 Bacteria 11059
49 Ga0070671_100005453 3300005355 Bacteria 10154
50 Ga0070671_100009404 3300005355 Bacteria 7847
51 Ga0070671_100010389 3300005355 Bacteria 7467
52 Ga0070671_100016925 3300005355 Bacteria 5897
53 Ga0070671_100018198 3300005355 Bacteria 5704
54 Ga0070671_100222180 3300005355 Bacteria 1602
55 Ga0070674_100007352 3300005356 Bacteria 6495
56 Ga0070674_100266042 3300005356 Bacteria 1353
57 Ga0070673_100001014 3300005364 Bacteria 15911
58 Ga0070673_100006553 3300005364 Bacteria 7575
59 Ga0070673_100052701 3300005364 Bacteria 3193
60 Ga0070688_100218717 3300005365 Bacteria 1341
61 Ga0070659_100000123 3300005366 Bacteria 58613
62 Ga0070659_100003440 3300005366 Bacteria 11273
63 Ga0070659_100009065 3300005366 Bacteria 7301
64 Ga0070659_100040512 3300005366 Bacteria 3640
65 Ga0070659_100221479 3300005366 Bacteria 1562
66 Ga0070667_100000876 3300005367 Bacteria 27838
67 Ga0070667_100025508 3300005367 Bacteria 4914
68 Ga0070667_100050262 3300005367 Bacteria 3513
69 Ga0070667_100182761 3300005367 Bacteria 1855
70 Ga0070667_100383178 3300005367 Bacteria 1277
71 Ga0070709_10010270 3300005434 Bacteria 5176
72 Ga0070714_100012303 3300005435 Bacteria 6828
73 Ga0070714_100021305 3300005435 Bacteria 5303
74 Ga0070713_100003850 3300005436 Bacteria 9935
75 Ga0070713_100004402 3300005436 Bacteria 9455
76 Ga0070713_100039471 3300005436 Bacteria 3832
77 Ga0070694_100122394 3300005444 Bacteria 1868
78 Ga0070663_100018088 3300005455 Bacteria 4613
79 Ga0070663_100035538 3300005455 Bacteria 3457
80 Ga0070663_100054453 3300005455 Bacteria 2859
81 Ga0070678_100004420 3300005456 Bacteria 7971
82 Ga0070678_100184663 3300005456 Bacteria 1710
83 Ga0070662_100000060 3300005457 Bacteria 59430
84 Ga0070662_100000334 3300005457 Bacteria 28255
85 Ga0070662_100010116 3300005457 Bacteria 6180
86 Ga0070662_100017671 3300005457 Bacteria 4811
87 Ga0070662_100272986 3300005457 Bacteria 1366
88 Ga0070681_10209105 3300005458 Bacteria 1868
89 Ga0068867_100001586 3300005459 Bacteria 15805
90 Ga0068867_100013770 3300005459 Bacteria 5727
91 Ga0070684_100009933 3300005535 Bacteria 7523
92 Ga0068853_100000277 3300005539 Bacteria 36116
93 Ga0068853_100001079 3300005539 Bacteria 19279
94 Ga0070672_100000227 3300005543 Bacteria 31347
95 Ga0070672_100081491 3300005543 Bacteria 2594
96 Ga0070672_100085121 3300005543 Bacteria 2540
97 Ga0070672_100094636 3300005543 Bacteria 2415
98 Ga0070696_100055399 3300005546 Bacteria 2765
99 Ga0070693_100014272 3300005547 Bacteria 4067
100 Ga0070665_100003965 3300005548 Bacteria 15603
101 Ga0070665_100084749 3300005548 Bacteria 3174
102 Ga0070704_100063516 3300005549 Bacteria 2650
103 Ga0068855_100000705 3300005563 Bacteria 40925
104 Ga0068855_100000877 3300005563 Bacteria 37389
105 Ga0068855_100001413 3300005563 Bacteria 29812
106 Ga0068855_100113986 3300005563 Bacteria 3100
107 Ga0068855_100164777 3300005563 Bacteria 2513
108 Ga0070664_100002327 3300005564 Bacteria 15263
109 Ga0070664_100007035 3300005564 Bacteria 9080
110 Ga0070664_100087436 3300005564 Bacteria 2694
111 Ga0070664_100188790 3300005564 Bacteria 1835
112 Ga0070664_100303992 3300005564 Bacteria 1442
113 Ga0068857_100004019 3300005577 Bacteria 12387
114 Ga0068857_100117979 3300005577 Bacteria 2388
115 Ga0068857_100263061 3300005577 Bacteria 1584
116 Ga0068857_100459117 3300005577 Bacteria 1192
117 Ga0068854_100000548 3300005578 Bacteria 22657
118 Ga0068856_100002727 3300005614 Bacteria 18077
119 Ga0068856_100064544 3300005614 Bacteria 3618
120 Ga0068852_100001013 3300005616 Bacteria 18541
121 Ga0068852_100001371 3300005616 Bacteria 16359
122 Ga0068852_100062533 3300005616 Bacteria 3238
123 Ga0068852_100149314 3300005616 Bacteria 2172
124 Ga0068859_100001673 3300005617 Bacteria 22582
125 Ga0068859_100002802 3300005617 Bacteria 17661
126 Ga0068859_100003879 3300005617 Bacteria 15277
127 Ga0068859_100022761 3300005617 Bacteria 6283
128 Ga0068859_100060051 3300005617 Bacteria 3831
129 Ga0068864_100000393 3300005618 Bacteria 38029
130 Ga0068864_100014126 3300005618 Bacteria 6625
131 Ga0068864_100021643 3300005618 Bacteria 5384
132 Ga0068864_100036295 3300005618 Bacteria 4201
133 Ga0068864_100281298 3300005618 Bacteria 1553
134 Ga0068864_100407927 3300005618 Bacteria 1292
135 Ga0068851_10078434 3300005834 Bacteria 1721
136 Ga0068851_10110001 3300005834 Bacteria 1470
137 Ga0068863_100001851 3300005841 Bacteria 21022
138 Ga0068863_100002359 3300005841 Bacteria 18786
139 Ga0068863_100009718 3300005841 Bacteria 9383
140 Ga0068863_100010630 3300005841 Bacteria 8934
141 Ga0068863_100015109 3300005841 Bacteria 7416
142 Ga0068863_100124244 3300005841 Bacteria 2462
143 Ga0068858_100004688 3300005842 Bacteria 13400
144 Ga0068858_100116314 3300005842 Bacteria 2499
145 Ga0068860_100006230 3300005843 Bacteria 11985
146 Ga0068860_100010609 3300005843 Bacteria 9098
147 Ga0068860_100098294 3300005843 Bacteria 2791
148 Ga0068860_100115201 3300005843 Bacteria 2570
149 Ga0068862_100018564 3300005844 Bacteria 5793
150 Ga0068862_100415991 3300005844 Bacteria 1260
151 Ga0070717_10019745 3300006028 Bacteria 5290
152 Ga0070717_10073806 3300006028 Bacteria 2852
153 Ga0070716_100056963 3300006173 Bacteria 2244
154 Ga0070712_100020872 3300006175 Bacteria 4292
155 Ga0097621_100032300 3300006237 Bacteria 4160
156 Ga0097621_100100771 3300006237 Bacteria 2430
157 Ga0068871_100013930 3300006358 Bacteria 5978
158 Ga0075428_100138133 3300006844 Bacteria 2650
159 Ga0075433_10036603 3300006852 Bacteria 4228
160 Ga0097620_100001673 3300006931 Bacteria 22582
161 Ga0097620_100002802 3300006931 Bacteria 17661
162 Ga0097620_100003878 3300006931 Bacteria 15277
163 Ga0097620_100022761 3300006931 Bacteria 6283
164 Ga0097620_100060051 3300006931 Bacteria 3831
165 Ga0105240_10015761 3300009093 Bacteria 10256
166 Ga0105240_10243413 3300009093 Bacteria 2084
167 Ga0105245_10000068 3300009098 Bacteria 106973
168 Ga0105245_10028980 3300009098 Bacteria 4888
169 Ga0105242_10043502 3300009176 Bacteria 3633
170 Ga0105248_10000278 3300009177 Bacteria 60305
171 Ga0105248_10000621 3300009177 Bacteria 40351
172 Ga0105248_10001005 3300009177 Bacteria 31178
173 Ga0105248_10002609 3300009177 Bacteria 20051
174 Ga0105248_10009936 3300009177 Bacteria 10474
175 Ga0105248_10028305 3300009177 Bacteria 6243
176 Ga0105248_10113693 3300009177 Bacteria 3053
177 Ga0105248_10310044 3300009177 Bacteria 1777
178 Ga0105248_10551040 3300009177 Bacteria 1301
179 Ga0105238_10026977 3300009551 Bacteria 5855
180 Ga0105249_10015159 3300009553 Bacteria 6821
181 Ga0105249_10048532 3300009553 Bacteria 3870
182 Ga0105249_10426533 3300009553 Bacteria 1361
183 Ga0157373_10055900 3300013100 Bacteria 2803
184 Ga0157373_10106994 3300013100 Bacteria 1966
185 Ga0157371_10003436 3300013102 Bacteria 14369
186 Ga0157371_10026974 3300013102 Bacteria 4169
187 Ga0157370_10160438 3300013104 Bacteria 2092
188 Ga0157370_10331666 3300013104 Bacteria 1403
189 Ga0157369_10135099 3300013105 Bacteria 2612
190 Ga0157369_10159746 3300013105 Bacteria 2379
191 Ga0157369_10212333 3300013105 Bacteria 2028
192 Ga0157369_10355269 3300013105 Bacteria 1522
193 Ga0157369_10466951 3300013105 Bacteria 1307
194 Ga0157378_10003316 3300013297 Bacteria 14317
195 Ga0157378_10194262 3300013297 Bacteria 1916
196 Ga0163162_10051233 3300013306 Bacteria 4141
197 Ga0163162_10097547 3300013306 Bacteria 3028
198 Ga0163162_10250162 3300013306 Bacteria 1904
199 Ga0163162_10367957 3300013306 Bacteria 1571
200 Ga0157372_10117072 3300013307 Bacteria 3056
201 Ga0157372_10453247 3300013307 Bacteria 1495
202 Ga0163163_10000849 3300014325 Bacteria 25987
203 Ga0163163_10001741 3300014325 Bacteria 18337
204 Ga0163163_10001932 3300014325 Bacteria 17554
205 Ga0157377_10020085 3300014745 Bacteria 3495
206 Ga0157377_10136627 3300014745 Bacteria 1503
207 Ga0157379_10031672 3300014968 Bacteria 4712
208 Ga0157376_10017763 3300014969 Bacteria 5436
209 Ga0207697_10000007 3300025315 Bacteria 81785
210 Ga0207656_10045546 3300025321 Bacteria 1878
211 Ga0207642_10037774 3300025899 Bacteria 2084
212 Ga0207688_10016176 3300025901 Bacteria 4044
213 Ga0207680_10000727 3300025903 Bacteria 15483
214 Ga0207680_10043249 3300025903 Bacteria 2641
215 Ga0207680_10049247 3300025903 Bacteria 2507
216 Ga0207647_10003698 3300025904 Bacteria 11434
217 Ga0207647_10011268 3300025904 Bacteria 6275
218 Ga0207647_10019874 3300025904 Bacteria 4510
219 Ga0207647_10136203 3300025904 Bacteria 1441
220 Ga0207699_10016710 3300025906 Bacteria 3845
221 Ga0207645_10001287 3300025907 Bacteria 20599
222 Ga0207645_10121022 3300025907 Bacteria 1699
223 Ga0207705_10000535 3300025909 Bacteria 32032
224 Ga0207705_10149745 3300025909 Bacteria 1748
225 Ga0207705_10325694 3300025909 Bacteria 1181
226 Ga0207707_10024394 3300025912 Bacteria 5292
227 Ga0207695_10112967 3300025913 Bacteria 2693
228 Ga0207693_10027098 3300025915 Bacteria 4531
229 Ga0207660_10024950 3300025917 Bacteria 4052
230 Ga0207657_10000334 3300025919 Bacteria 49890
231 Ga0207657_10003513 3300025919 Bacteria 16740
232 Ga0207657_10019090 3300025919 Bacteria 6522
233 Ga0207657_10035241 3300025919 Bacteria 4489
234 Ga0207657_10035380 3300025919 Bacteria 4479
235 Ga0207657_10069814 3300025919 Bacteria 2979
236 Ga0207657_10121671 3300025919 Bacteria 2147
237 Ga0207657_10161624 3300025919 Bacteria 1819
238 Ga0207657_10165127 3300025919 Bacteria 1796
239 Ga0207657_10195809 3300025919 Bacteria 1628
240 Ga0207649_10000211 3300025920 Bacteria 48545
241 Ga0207649_10021297 3300025920 Bacteria 3730
242 Ga0207649_10023512 3300025920 Bacteria 3570
243 Ga0207649_10024523 3300025920 Bacteria 3507
244 Ga0207681_10000695 3300025923 Bacteria 22118
245 Ga0207681_10072692 3300025923 Bacteria 2403
246 Ga0207650_10013538 3300025925 Bacteria 5649
247 Ga0207650_10085720 3300025925 Bacteria 2397
248 Ga0207650_10151475 3300025925 Bacteria 1830
249 Ga0207687_10000584 3300025927 Bacteria 24620
250 Ga0207700_10017605 3300025928 Bacteria 4777
251 Ga0207644_10000244 3300025931 Bacteria 37269
252 Ga0207644_10006478 3300025931 Bacteria 7630
253 Ga0207644_10011189 3300025931 Bacteria 5930
254 Ga0207644_10018544 3300025931 Bacteria 4709
255 Ga0207644_10054471 3300025931 Bacteria 2881
256 Ga0207644_10093915 3300025931 Bacteria 2240
257 Ga0207690_10000182 3300025932 Bacteria 48302
258 Ga0207690_10002867 3300025932 Bacteria 10388
259 Ga0207690_10179521 3300025932 Bacteria 1593
260 Ga0207690_10202289 3300025932 Bacteria 1509
261 Ga0207706_10001196 3300025933 Bacteria 26205
262 Ga0207706_10002875 3300025933 Bacteria 16686
263 Ga0207706_10003720 3300025933 Bacteria 14552
264 Ga0207706_10010064 3300025933 Bacteria 8661
265 Ga0207706_10017943 3300025933 Bacteria 6370
266 Ga0207706_10026532 3300025933 Bacteria 5185
267 Ga0207706_10100757 3300025933 Bacteria 2541
268 Ga0207706_10301566 3300025933 Bacteria 1396
269 Ga0207669_10003636 3300025937 Bacteria 6693
270 Ga0207669_10014612 3300025937 Bacteria 3940
271 Ga0207704_10296111 3300025938 Bacteria 1237
272 Ga0207665_10063497 3300025939 Bacteria 2508
273 Ga0207691_10007439 3300025940 Bacteria 10545
274 Ga0207691_10032298 3300025940 Bacteria 4881
275 Ga0207691_10047964 3300025940 Bacteria 3917
276 Ga0207691_10134312 3300025940 Bacteria 2184
277 Ga0207691_10140433 3300025940 Bacteria 2129
278 Ga0207711_10000591 3300025941 Bacteria 36753
279 Ga0207711_10000719 3300025941 Bacteria 32614
280 Ga0207711_10001268 3300025941 Bacteria 23928
281 Ga0207711_10005183 3300025941 Bacteria 11043
282 Ga0207711_10007235 3300025941 Bacteria 9303
283 Ga0207711_10015273 3300025941 Bacteria 6374
284 Ga0207711_10026112 3300025941 Bacteria 4899
285 Ga0207689_10002604 3300025942 Bacteria 16686
286 Ga0207689_10013214 3300025942 Bacteria 7046
287 Ga0207661_10001052 3300025944 Bacteria 18329
288 Ga0207679_10000293 3300025945 Bacteria 37744
289 Ga0207679_10004030 3300025945 Bacteria 9121
290 Ga0207679_10014258 3300025945 Bacteria 5221
291 Ga0207679_10057127 3300025945 Bacteria 2885
292 Ga0207679_10235003 3300025945 Bacteria 1550
293 Ga0207667_10001522 3300025949 Bacteria 29145
294 Ga0207667_10001551 3300025949 Bacteria 28908
295 Ga0207667_10001632 3300025949 Bacteria 28244
296 Ga0207667_10014480 3300025949 Bacteria 8989
297 Ga0207667_10100140 3300025949 Bacteria 2989
298 Ga0207651_10000221 3300025960 Bacteria 24397
299 Ga0207651_10001491 3300025960 Bacteria 10648
300 Ga0207651_10003732 3300025960 Bacteria 7535
301 Ga0207651_10193932 3300025960 Bacteria 1622
302 Ga0207712_10000974 3300025961 Bacteria 20541
303 Ga0207712_10021951 3300025961 Bacteria 4197
304 Ga0207668_10004449 3300025972 Bacteria 8233
305 Ga0207668_10021529 3300025972 Bacteria 4113
306 Ga0207640_10000330 3300025981 Bacteria 31573
307 Ga0207640_10000507 3300025981 Bacteria 23561
308 Ga0207640_10206411 3300025981 Bacteria 1493
309 Ga0207658_10001264 3300025986 Bacteria 19972
310 Ga0207658_10006192 3300025986 Bacteria 8170
311 Ga0207677_10000872 3300026023 Bacteria 17147
312 Ga0207703_10009563 3300026035 Bacteria 7611
313 Ga0207703_10017252 3300026035 Bacteria 5633
314 Ga0207703_10065097 3300026035 Bacteria 2994
315 Ga0207703_10098993 3300026035 Bacteria 2467
316 Ga0207639_10000154 3300026041 Bacteria 52098
317 Ga0207639_10004688 3300026041 Bacteria 9199
318 Ga0207639_10206276 3300026041 Bacteria 1689
319 Ga0207678_10008816 3300026067 Bacteria 8876
320 Ga0207678_10020049 3300026067 Bacteria 5874
321 Ga0207678_10020598 3300026067 Bacteria 5782
322 Ga0207678_10058707 3300026067 Bacteria 3310
323 Ga0207678_10205832 3300026067 Bacteria 1683
324 Ga0207702_10002919 3300026078 Bacteria 16002
325 Ga0207702_10224879 3300026078 Bacteria 1750
326 Ga0207641_10001971 3300026088 Bacteria 19615
327 Ga0207641_10009658 3300026088 Bacteria 7948
328 Ga0207641_10033929 3300026088 Bacteria 4242
329 Ga0207641_10035687 3300026088 Bacteria 4145
330 Ga0207641_10048146 3300026088 Bacteria 3597
331 Ga0207641_10048959 3300026088 Bacteria 3569
332 Ga0207648_10000752 3300026089 Bacteria 36454
333 Ga0207648_10051872 3300026089 Bacteria 3586
334 Ga0207648_10376447 3300026089 Bacteria 1283
335 Ga0207676_10000257 3300026095 Bacteria 46040
336 Ga0207676_10001827 3300026095 Bacteria 15590
337 Ga0207676_10026954 3300026095 Bacteria 4276
338 Ga0207676_10179847 3300026095 Bacteria 1851
339 Ga0207676_10259120 3300026095 Bacteria 1569
340 Ga0207676_10403155 3300026095 Bacteria 1278
341 Ga0207674_10007851 3300026116 Bacteria 12402
342 Ga0207674_10026309 3300026116 Bacteria 6183
343 Ga0207674_10147002 3300026116 Bacteria 2315
344 Ga0207674_10229983 3300026116 Bacteria 1802
345 Ga0207683_10001252 3300026121 Bacteria 23031
346 Ga0207683_10039848 3300026121 Bacteria 4098
347 Ga0207683_10068634 3300026121 Bacteria 3130
348 Ga0207698_10005371 3300026142 Bacteria 7909
349 Ga0207698_10023263 3300026142 Bacteria 4325
350 Ga0207698_10062175 3300026142 Bacteria 2914
351 Ga0207698_10171047 3300026142 Bacteria 1913
352 Ga0268266_10003672 3300028379 Bacteria 15154
353 Ga0268266_10061077 3300028379 Bacteria 3250
354 Ga0268266_10077506 3300028379 Bacteria 2890
355 Ga0268266_10078002 3300028379 Bacteria 2881
356 Ga0268265_10398445 3300028380 Bacteria 1271
357 Ga0268264_10000546 3300028381 Bacteria 47268
358 Ga0268264_10007331 3300028381 Bacteria 9218
359 Ga0268264_10012457 3300028381 Bacteria 7000
360 Ga0268264_10088540 3300028381 Bacteria 2665
361 Ga0307413_10012866 3300031824 Bacteria 4181
362 Ga0307406_10019832 3300031901 Bacteria 3951
363 Ga0307416_100024081 3300032002 Bacteria 4434
364 Ga0307416_100421280 3300032002 Bacteria 1379
365 Ga0307411_10054586 3300032005 Bacteria 2624
366 Ga0373952_0008510 3300035092 Bacteria 1948
367 Ga0373939_0023529 3300035114 Bacteria 1708
368 Ga0373943_0002661 3300035170 Bacteria 8130
369 Ga0373931_0004980 3300035691 Bacteria 6110
370 Ga0373947_0066874 3300035725 Bacteria 2194
371 Ga0395899_0030421 3300037312 Bacteria 4061
372 Ga0395899_0063726 3300037312 Bacteria 2711
373 Ga0395900_0000912 3300037418 Bacteria 38872
374 Ga0395900_0015486 3300037418 Bacteria 7774
375 Ga0395900_0085246 3300037418 Bacteria 3246
376 Ga0395900_0108933 3300037418 Bacteria 2846
377 Ga0395900_0207167 3300037418 Bacteria 1981
378 Ga0395900_0256597 3300037418 Bacteria 1747
379 Ga0395900_0278899 3300037418 Bacteria 1664
380 Ga0395900_0336487 3300037418 Bacteria 1486
381 Ga0395898_0075759 3300037466 Bacteria 3249
382 Ga0395898_0134470 3300037466 Bacteria 2367
383 Ga0395898_0254174 3300037466 Bacteria 1676
384 Ga0395898_0392784 3300037466 Bacteria 1323
385 Ga0395905_0001141 3300037471 Bacteria 33234
386 Ga0395905_0025518 3300037471 Bacteria 5573
387 Ga0395905_0116874 3300037471 Bacteria 2506
388 Ga0395905_0188301 3300037471 Bacteria 1936
389 Ga0395905_0438455 3300037471 Bacteria 1203
390 Ga0395905_0461556 3300037471 Bacteria 1168
391 Ga0395901_0026636 3300038443 Bacteria 5936
392 Ga0395901_0045615 3300038443 Bacteria 4550
393 Ga0395901_0098236 3300038443 Bacteria 3070
394 Ga0395901_0174646 3300038443 Bacteria 2253
395 Ga0395901_0181348 3300038443 Bacteria 2208
396 Ga0395901_0372139 3300038443 Bacteria 1471
397 Ga0439464_0000818 3300042439 Bacteria 6855
398 Ga0466966_0130560 3300044684 Bacteria 1538
399 Ga0466966_0141662 3300044684 Bacteria 1469
400 Ga0466961_0166425 3300044693 Bacteria 1372
401 Ga0466963_0006221 3300044694 Bacteria 7049
402 Ga0466963_0020556 3300044694 Bacteria 4151
403 Ga0466970_0024076 3300044765 Bacteria 3183
404 Ga0466970_0101539 3300044765 Bacteria 1567
405 Ga0466957_0056437 3300044842 Bacteria 2401
406 Ga0466957_0203502 3300044842 Bacteria 1301
407 Ga0466958_0005699 3300045836 Bacteria 6726
408 Ga0466967_0003118 3300045976 Bacteria 10667
409 Ga0466967_0208884 3300045976 Bacteria 1851
410 Ga0466967_0243271 3300045976 Bacteria 1717
411 Ga0495621_0028881 3300046539 Bacteria 1887
412 Ga0495669_0021162 3300046684 Bacteria 2820
413 Ga0496100_0047013 3300048903 Bacteria 2778
414 Ga0496101_0024445 3300048904 Bacteria 4181
415 Ga0496101_0100591 3300048904 Bacteria 2163
416 Ga0496101_0125600 3300048904 Bacteria 1944
417 Ga0496103_0042471 3300048906 Bacteria 2798
418 Ga0496104_0112398 3300048907 Bacteria 2612
419 Ga0496105_0018212 3300048908 Bacteria 5640
420 Ga0496106_0081682 3300048909 Bacteria 2483
421 Ga0496106_0089460 3300048909 Bacteria 2374
422 Ga0496107_0002426 3300048910 Bacteria 12080
423 Ga0496107_0003734 3300048910 Bacteria 10223
424 Ga0496108_0012667 3300048911 Bacteria 6871
425 Ga0496108_0018510 3300048911 Bacteria 5704
426 Ga0496109_0342504 3300048912 Bacteria 1412
427 Ga0496110_0003372 3300048913 Bacteria 12200
428 Ga0496110_0123127 3300048913 Bacteria 2338
429 Ga0496111_0000090 3300048914 Bacteria 38333
430 Ga0496111_0027373 3300048914 Bacteria 4033
431 Ga0496112_0001628 3300048915 Bacteria 17393
432 Ga0496112_0043764 3300048915 Bacteria 4384
433 Ga0496112_0082094 3300048915 Bacteria 3188
434 Ga0496113_0001877 3300048916 Bacteria 11976
435 Ga0496113_0084822 3300048916 Bacteria 2432
436 Ga0496113_0093343 3300048916 Bacteria 2323
437 Ga0496113_0164325 3300048916 Bacteria 1756
438 Ga0496115_0003053 3300048918 Bacteria 12021
439 Ga0496115_0146622 3300048918 Bacteria 1948
440 Ga0501068_0190541 3300049584 Bacteria 1299
441 Ga0501080_0053601 3300049742 Bacteria 3756
442 Ga0501044_0280795 3300049823 Bacteria 1599
443 nmdc:mga0a205_66500_c1 3300050515 Bacteria 3483
444 Ga0466962_0012326 3300061719 Bacteria 4110
445 Ga0466962_0025917 3300061719 Bacteria 2814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100134383 Ga0070660_1001343832 308
2 3300025909 Ga0207705_10325694 Ga0207705_103256941 308
3 3300025919 Ga0207657_10195809 Ga0207657_101958092 308
4 3300037471 Ga0395905_0025518 Ga0395905_0025518_3745_4836 313
5 3300025931 Ga0207644_10093915 Ga0207644_100939152 314
6 3300048918 Ga0496115_0146622 Ga0496115_0146622_870_1817 314
7 3300061719 Ga0466962_0012326 Ga0466962_0012326_13_960 314
8 3300005353 Ga0070669_100059738 Ga0070669_1000597381 318
9 3300005456 Ga0070678_100184663 Ga0070678_1001846632 324
10 3300005330 Ga0070690_100167455 Ga0070690_1001674552 325
11 3300005841 Ga0068863_100001851 Ga0068863_1000018514 325
12 3300009177 Ga0105248_10113693 Ga0105248_101136933 325
13 3300013297 Ga0157378_10194262 Ga0157378_101942622 325
14 3300014325 Ga0163163_10001932 Ga0163163_100019322 325
15 3300026088 Ga0207641_10048146 Ga0207641_100481463 325
16 3300045976 Ga0466967_0208884 Ga0466967_0208884_640_1620 325
17 3300049584 Ga0501068_0190541 Ga0501068_0190541_133_1113 325
18 3300049742 Ga0501080_0053601 Ga0501080_0053601_1365_2345 325
19 3300037418 Ga0395900_0336487 Ga0395900_0336487_276_1358 327
20 3300005327 Ga0070658_10015564 Ga0070658_100155645 329
21 3300005355 Ga0070671_100222180 Ga0070671_1002221801 329
22 3300005435 Ga0070714_100012303 Ga0070714_1000123037 329
23 3300005436 Ga0070713_100039471 Ga0070713_1000394715 329
24 3300005618 Ga0068864_100281298 Ga0068864_1002812982 329
25 3300005834 Ga0068851_10110001 Ga0068851_101100011 329
26 3300009177 Ga0105248_10551040 Ga0105248_105510402 329
27 3300025909 Ga0207705_10149745 Ga0207705_101497452 329
28 3300025941 Ga0207711_10026112 Ga0207711_100261121 329
29 3300026095 Ga0207676_10259120 Ga0207676_102591202 329
30 3300048914 Ga0496111_0027373 Ga0496111_0027373_451_1533 329
31 3300048916 Ga0496113_0084822 Ga0496113_0084822_282_1364 329
32 3300013105 Ga0157369_10355269 Ga0157369_103552692 331
33 3300013104 Ga0157370_10331666 Ga0157370_103316662 333
34 3300013307 Ga0157372_10453247 Ga0157372_104532471 333
35 3300005327 Ga0070658_10342195 Ga0070658_103421951 343
36 3300005563 Ga0068855_100113986 Ga0068855_1001139864 343
37 3300026041 Ga0207639_10206276 Ga0207639_102062762 343
38 3300025907 Ga0207645_10121022 Ga0207645_101210222 346
39 3300037418 Ga0395900_0256597 Ga0395900_0256597_15_1055 346
40 3300044694 Ga0466963_0006221 Ga0466963_0006221_201_1244 346
41 3300013105 Ga0157369_10159746 Ga0157369_101597462 349
42 3300025949 Ga0207667_10100140 Ga0207667_101001402 349
43 3300049823 Ga0501044_0280795 Ga0501044_0280795_172_1254 349
44 3300005339 Ga0070660_100032392 Ga0070660_1000323922 351
45 3300025919 Ga0207657_10165127 Ga0207657_101651273 351
46 3300005563 Ga0068855_100000705 Ga0068855_10000070516 352
47 3300009093 Ga0105240_10015761 Ga0105240_100157617 352
48 3300013105 Ga0157369_10466951 Ga0157369_104669512 352
49 3300025949 Ga0207667_10001551 Ga0207667_100015515 352
50 3300031824 Ga0307413_10012866 Ga0307413_100128664 352
51 3300005353 Ga0070669_100176470 Ga0070669_1001764701 357
52 3300005564 Ga0070664_100303992 Ga0070664_1003039921 357
53 3300005577 Ga0068857_100263061 Ga0068857_1002630612 357
54 3300005578 Ga0068854_100000548 Ga0068854_10000054813 357
55 3300025923 Ga0207681_10072692 Ga0207681_100726921 357
56 3300025981 Ga0207640_10000330 Ga0207640_1000033030 357
57 3300026116 Ga0207674_10229983 Ga0207674_102299832 357
58 3300006852 Ga0075433_10036603 Ga0075433_100366035 359
59 3300025933 Ga0207706_10301566 Ga0207706_103015662 359
60 3300032002 Ga0307416_100024081 Ga0307416_1000240816 359
61 3300037418 Ga0395900_0015486 Ga0395900_0015486_2497_3579 359
62 3300037466 Ga0395898_0254174 Ga0395898_0254174_418_1500 359
63 3300001989 JGI24739J22299_10043942 JGI24739J22299_100439422 360
64 3300003323 rootH1_10097014 rootH1_100970141 360
65 3300005327 Ga0070658_10098452 Ga0070658_100984522 360
66 3300005331 Ga0070670_100264266 Ga0070670_1002642662 360
67 3300005334 Ga0068869_100067933 Ga0068869_1000679332 360
68 3300005335 Ga0070666_10005022 Ga0070666_100050222 360
69 3300005336 Ga0070680_100146338 Ga0070680_1001463382 360
70 3300005338 Ga0068868_100127427 Ga0068868_1001274272 360
71 3300005339 Ga0070660_100092393 Ga0070660_1000923932 360
72 3300005339 Ga0070660_100212848 Ga0070660_1002128482 360
73 3300005344 Ga0070661_100017719 Ga0070661_1000177194 360
74 3300005347 Ga0070668_100096848 Ga0070668_1000968482 360
75 3300005353 Ga0070669_100059729 Ga0070669_1000597293 360
76 3300005355 Ga0070671_100004477 Ga0070671_1000044772 360
77 3300005355 Ga0070671_100005453 Ga0070671_1000054535 360
78 3300005355 Ga0070671_100009404 Ga0070671_1000094042 360
79 3300005355 Ga0070671_100010389 Ga0070671_1000103898 360
80 3300005356 Ga0070674_100007352 Ga0070674_1000073522 360
81 3300005356 Ga0070674_100266042 Ga0070674_1002660422 360
82 3300005364 Ga0070673_100006553 Ga0070673_1000065533 360
83 3300005364 Ga0070673_100052701 Ga0070673_1000527012 360
84 3300005365 Ga0070688_100218717 Ga0070688_1002187172 360
85 3300005366 Ga0070659_100003440 Ga0070659_1000034406 360
86 3300005366 Ga0070659_100040512 Ga0070659_1000405122 360
87 3300005367 Ga0070667_100025508 Ga0070667_1000255089 360
88 3300005367 Ga0070667_100050262 Ga0070667_1000502622 360
89 3300005367 Ga0070667_100383178 Ga0070667_1003831781 360
90 3300005434 Ga0070709_10010270 Ga0070709_100102708 360
91 3300005435 Ga0070714_100021305 Ga0070714_1000213052 360
92 3300005436 Ga0070713_100003850 Ga0070713_1000038508 360
93 3300005436 Ga0070713_100004402 Ga0070713_1000044024 360
94 3300005444 Ga0070694_100122394 Ga0070694_1001223941 360
95 3300005455 Ga0070663_100035538 Ga0070663_1000355382 360
96 3300005455 Ga0070663_100054453 Ga0070663_1000544533 360
97 3300005456 Ga0070678_100004420 Ga0070678_1000044209 360
98 3300005457 Ga0070662_100010116 Ga0070662_1000101164 360
99 3300005457 Ga0070662_100017671 Ga0070662_1000176712 360
100 3300005457 Ga0070662_100272986 Ga0070662_1002729861 360
101 3300005459 Ga0068867_100013770 Ga0068867_1000137704 360
102 3300005543 Ga0070672_100081491 Ga0070672_1000814912 360
103 3300005543 Ga0070672_100085121 Ga0070672_1000851212 360
104 3300005543 Ga0070672_100094636 Ga0070672_1000946362 360
105 3300005546 Ga0070696_100055399 Ga0070696_1000553992 360
106 3300005548 Ga0070665_100084749 Ga0070665_1000847491 360
107 3300005549 Ga0070704_100063516 Ga0070704_1000635163 360
108 3300005563 Ga0068855_100164777 Ga0068855_1001647772 360
109 3300005564 Ga0070664_100188790 Ga0070664_1001887902 360
110 3300005577 Ga0068857_100117979 Ga0068857_1001179793 360
111 3300005577 Ga0068857_100459117 Ga0068857_1004591171 360
112 3300005614 Ga0068856_100064544 Ga0068856_1000645444 360
113 3300005616 Ga0068852_100149314 Ga0068852_1001493142 360
114 3300005617 Ga0068859_100002802 Ga0068859_10000280213 360
115 3300005617 Ga0068859_100003879 Ga0068859_10000387915 360
116 3300005617 Ga0068859_100022761 Ga0068859_1000227612 360
117 3300005617 Ga0068859_100060051 Ga0068859_1000600516 360
118 3300005618 Ga0068864_100021643 Ga0068864_1000216439 360
119 3300005618 Ga0068864_100407927 Ga0068864_1004079271 360
120 3300005841 Ga0068863_100009718 Ga0068863_1000097188 360
121 3300005841 Ga0068863_100010630 Ga0068863_1000106303 360
122 3300005841 Ga0068863_100015109 Ga0068863_1000151092 360
123 3300005842 Ga0068858_100116314 Ga0068858_1001163141 360
124 3300005843 Ga0068860_100010609 Ga0068860_1000106097 360
125 3300005843 Ga0068860_100098294 Ga0068860_1000982943 360
126 3300005843 Ga0068860_100115201 Ga0068860_1001152011 360
127 3300005844 Ga0068862_100018564 Ga0068862_1000185646 360
128 3300005844 Ga0068862_100415991 Ga0068862_1004159911 360
129 3300006028 Ga0070717_10019745 Ga0070717_100197453 360
130 3300006028 Ga0070717_10073806 Ga0070717_100738063 360
131 3300006173 Ga0070716_100056963 Ga0070716_1000569633 360
132 3300006175 Ga0070712_100020872 Ga0070712_1000208724 360
133 3300006237 Ga0097621_100032300 Ga0097621_1000323005 360
134 3300006358 Ga0068871_100013930 Ga0068871_1000139302 360
135 3300006844 Ga0075428_100138133 Ga0075428_1001381333 360
136 3300006931 Ga0097620_100002802 Ga0097620_10000280213 360
137 3300006931 Ga0097620_100003878 Ga0097620_10000387815 360
138 3300006931 Ga0097620_100022761 Ga0097620_1000227618 360
139 3300006931 Ga0097620_100060051 Ga0097620_1000600516 360
140 3300009093 Ga0105240_10243413 Ga0105240_102434131 360
141 3300009098 Ga0105245_10028980 Ga0105245_100289802 360
142 3300009176 Ga0105242_10043502 Ga0105242_100435022 360
143 3300009177 Ga0105248_10000621 Ga0105248_1000062130 360
144 3300009177 Ga0105248_10009936 Ga0105248_100099367 360
145 3300009177 Ga0105248_10028305 Ga0105248_100283058 360
146 3300009177 Ga0105248_10310044 Ga0105248_103100442 360
147 3300009551 Ga0105238_10026977 Ga0105238_100269773 360
148 3300009553 Ga0105249_10015159 Ga0105249_100151592 360
149 3300009553 Ga0105249_10048532 Ga0105249_100485322 360
150 3300009553 Ga0105249_10426533 Ga0105249_104265332 360
151 3300013100 Ga0157373_10055900 Ga0157373_100559002 360
152 3300013102 Ga0157371_10026974 Ga0157371_100269742 360
153 3300013105 Ga0157369_10135099 Ga0157369_101350992 360
154 3300013306 Ga0163162_10051233 Ga0163162_100512334 360
155 3300013306 Ga0163162_10097547 Ga0163162_100975474 360
156 3300013306 Ga0163162_10250162 Ga0163162_102501622 360
157 3300013306 Ga0163162_10367957 Ga0163162_103679572 360
158 3300014325 Ga0163163_10000849 Ga0163163_1000084930 360
159 3300014745 Ga0157377_10020085 Ga0157377_100200853 360
160 3300014968 Ga0157379_10031672 Ga0157379_100316722 360
161 3300014969 Ga0157376_10017763 Ga0157376_100177637 360
162 3300025899 Ga0207642_10037774 Ga0207642_100377742 360
163 3300025903 Ga0207680_10049247 Ga0207680_100492471 360
164 3300025904 Ga0207647_10011268 Ga0207647_100112684 360
165 3300025904 Ga0207647_10136203 Ga0207647_101362031 360
166 3300025906 Ga0207699_10016710 Ga0207699_100167102 360
167 3300025915 Ga0207693_10027098 Ga0207693_100270982 360
168 3300025919 Ga0207657_10019090 Ga0207657_100190904 360
169 3300025919 Ga0207657_10035241 Ga0207657_100352412 360
170 3300025919 Ga0207657_10035380 Ga0207657_100353802 360
171 3300025919 Ga0207657_10069814 Ga0207657_100698142 360
172 3300025919 Ga0207657_10121671 Ga0207657_101216712 360
173 3300025920 Ga0207649_10023512 Ga0207649_100235124 360
174 3300025920 Ga0207649_10024523 Ga0207649_100245233 360
175 3300025925 Ga0207650_10151475 Ga0207650_101514752 360
176 3300025928 Ga0207700_10017605 Ga0207700_100176054 360
177 3300025931 Ga0207644_10000244 Ga0207644_1000024433 360
178 3300025931 Ga0207644_10054471 Ga0207644_100544714 360
179 3300025932 Ga0207690_10202289 Ga0207690_102022892 360
180 3300025933 Ga0207706_10003720 Ga0207706_1000372019 360
181 3300025933 Ga0207706_10010064 Ga0207706_1001006410 360
182 3300025933 Ga0207706_10017943 Ga0207706_100179439 360
183 3300025933 Ga0207706_10026532 Ga0207706_100265325 360
184 3300025933 Ga0207706_10100757 Ga0207706_101007572 360
185 3300025937 Ga0207669_10014612 Ga0207669_100146121 360
186 3300025938 Ga0207704_10296111 Ga0207704_102961111 360
187 3300025939 Ga0207665_10063497 Ga0207665_100634973 360
188 3300025940 Ga0207691_10032298 Ga0207691_100322984 360
189 3300025940 Ga0207691_10047964 Ga0207691_100479642 360
190 3300025940 Ga0207691_10134312 Ga0207691_101343122 360
191 3300025940 Ga0207691_10140433 Ga0207691_101404332 360
192 3300025941 Ga0207711_10001268 Ga0207711_1000126813 360
193 3300025941 Ga0207711_10007235 Ga0207711_100072354 360
194 3300025941 Ga0207711_10015273 Ga0207711_100152737 360
195 3300025942 Ga0207689_10013214 Ga0207689_100132145 360
196 3300025945 Ga0207679_10014258 Ga0207679_100142587 360
197 3300025945 Ga0207679_10235003 Ga0207679_102350031 360
198 3300025960 Ga0207651_10000221 Ga0207651_1000022115 360
199 3300025960 Ga0207651_10003732 Ga0207651_100037322 360
200 3300025960 Ga0207651_10193932 Ga0207651_101939322 360
201 3300025961 Ga0207712_10000974 Ga0207712_100009746 360
202 3300025961 Ga0207712_10021951 Ga0207712_100219512 360
203 3300025972 Ga0207668_10021529 Ga0207668_100215292 360
204 3300025981 Ga0207640_10206411 Ga0207640_102064112 360
205 3300025986 Ga0207658_10001264 Ga0207658_100012642 360
206 3300026035 Ga0207703_10009563 Ga0207703_100095637 360
207 3300026035 Ga0207703_10017252 Ga0207703_100172526 360
208 3300026035 Ga0207703_10098993 Ga0207703_100989931 360
209 3300026067 Ga0207678_10008816 Ga0207678_100088166 360
210 3300026067 Ga0207678_10020598 Ga0207678_100205985 360
211 3300026067 Ga0207678_10205832 Ga0207678_102058321 360
212 3300026078 Ga0207702_10224879 Ga0207702_102248792 360
213 3300026088 Ga0207641_10001971 Ga0207641_1000197118 360
214 3300026088 Ga0207641_10009658 Ga0207641_100096589 360
215 3300026088 Ga0207641_10048959 Ga0207641_100489594 360
216 3300026089 Ga0207648_10051872 Ga0207648_100518725 360
217 3300026089 Ga0207648_10376447 Ga0207648_103764471 360
218 3300026095 Ga0207676_10001827 Ga0207676_100018271 360
219 3300026095 Ga0207676_10179847 Ga0207676_101798472 360
220 3300026095 Ga0207676_10403155 Ga0207676_104031551 360
221 3300026116 Ga0207674_10026309 Ga0207674_100263092 360
222 3300026116 Ga0207674_10147002 Ga0207674_101470022 360
223 3300026121 Ga0207683_10001252 Ga0207683_1000125218 360
224 3300026121 Ga0207683_10039848 Ga0207683_100398486 360
225 3300026121 Ga0207683_10068634 Ga0207683_100686342 360
226 3300026142 Ga0207698_10171047 Ga0207698_101710472 360
227 3300028379 Ga0268266_10061077 Ga0268266_100610773 360
228 3300028379 Ga0268266_10078002 Ga0268266_100780022 360
229 3300028380 Ga0268265_10398445 Ga0268265_103984451 360
230 3300028381 Ga0268264_10000546 Ga0268264_1000054640 360
231 3300028381 Ga0268264_10012457 Ga0268264_100124576 360
232 3300028381 Ga0268264_10088540 Ga0268264_100885402 360
233 3300031901 Ga0307406_10019832 Ga0307406_100198322 360
234 3300032002 Ga0307416_100421280 Ga0307416_1004212802 360
235 3300032005 Ga0307411_10054586 Ga0307411_100545864 360
236 3300035170 Ga0373943_0002661 Ga0373943_0002661_3423_4508 360
237 3300035725 Ga0373947_0066874 Ga0373947_0066874_554_1639 360
238 3300037312 Ga0395899_0030421 Ga0395899_0030421_2520_3605 360
239 3300037312 Ga0395899_0063726 Ga0395899_0063726_1240_2325 360
240 3300037418 Ga0395900_0000912 Ga0395900_0000912_13543_14628 360
241 3300037418 Ga0395900_0085246 Ga0395900_0085246_1836_2921 360
242 3300037418 Ga0395900_0108933 Ga0395900_0108933_509_1594 360
243 3300037418 Ga0395900_0207167 Ga0395900_0207167_299_1384 360
244 3300037418 Ga0395900_0278899 Ga0395900_0278899_452_1537 360
245 3300037466 Ga0395898_0134470 Ga0395898_0134470_921_2006 360
246 3300037466 Ga0395898_0392784 Ga0395898_0392784_178_1263 360
247 3300037471 Ga0395905_0001141 Ga0395905_0001141_29787_30872 360
248 3300037471 Ga0395905_0188301 Ga0395905_0188301_14_1099 360
249 3300037471 Ga0395905_0438455 Ga0395905_0438455_30_1115 360
250 3300037471 Ga0395905_0461556 Ga0395905_0461556_70_1152 360
251 3300038443 Ga0395901_0026636 Ga0395901_0026636_4040_5122 360
252 3300038443 Ga0395901_0045615 Ga0395901_0045615_584_1669 360
253 3300038443 Ga0395901_0098236 Ga0395901_0098236_225_1310 360
254 3300038443 Ga0395901_0174646 Ga0395901_0174646_95_1180 360
255 3300038443 Ga0395901_0181348 Ga0395901_0181348_598_1683 360
256 3300038443 Ga0395901_0372139 Ga0395901_0372139_218_1303 360
257 3300044684 Ga0466966_0130560 Ga0466966_0130560_250_1335 360
258 3300044684 Ga0466966_0141662 Ga0466966_0141662_40_1125 360
259 3300044693 Ga0466961_0166425 Ga0466961_0166425_234_1319 360
260 3300044694 Ga0466963_0020556 Ga0466963_0020556_1142_2233 360
261 3300044765 Ga0466970_0024076 Ga0466970_0024076_1244_2350 360
262 3300044765 Ga0466970_0101539 Ga0466970_0101539_210_1295 360
263 3300044842 Ga0466957_0056437 Ga0466957_0056437_891_1982 360
264 3300044842 Ga0466957_0203502 Ga0466957_0203502_111_1196 360
265 3300045836 Ga0466958_0005699 Ga0466958_0005699_3703_4788 360
266 3300045976 Ga0466967_0003118 Ga0466967_0003118_2305_3390 360
267 3300045976 Ga0466967_0243271 Ga0466967_0243271_135_1220 360
268 3300046539 Ga0495621_0028881 Ga0495621_0028881_530_1615 360
269 3300046684 Ga0495669_0021162 Ga0495669_0021162_375_1466 360
270 3300048903 Ga0496100_0047013 Ga0496100_0047013_1285_2370 360
271 3300048904 Ga0496101_0024445 Ga0496101_0024445_2109_3194 360
272 3300048904 Ga0496101_0125600 Ga0496101_0125600_718_1800 360
273 3300048906 Ga0496103_0042471 Ga0496103_0042471_1302_2387 360
274 3300048907 Ga0496104_0112398 Ga0496104_0112398_443_1528 360
275 3300048908 Ga0496105_0018212 Ga0496105_0018212_2253_3338 360
276 3300048909 Ga0496106_0089460 Ga0496106_0089460_422_1507 360
277 3300048910 Ga0496107_0003734 Ga0496107_0003734_6582_7667 360
278 3300048911 Ga0496108_0012667 Ga0496108_0012667_2575_3660 360
279 3300048913 Ga0496110_0003372 Ga0496110_0003372_573_1658 360
280 3300048914 Ga0496111_0000090 Ga0496111_0000090_2452_3537 360
281 3300048915 Ga0496112_0043764 Ga0496112_0043764_2919_4004 360
282 3300048915 Ga0496112_0082094 Ga0496112_0082094_965_2047 360
283 3300048916 Ga0496113_0001877 Ga0496113_0001877_9599_10684 360
284 3300048918 Ga0496115_0003053 Ga0496115_0003053_5404_6486 360
285 3300050515 nmdc:mga0a205_66500_c1 nmdc:mga0a205_66500_c1_2212_3294 360
286 3300061719 Ga0466962_0025917 Ga0466962_0025917_682_1773 360
287 3300005327 Ga0070658_10082471 Ga0070658_100824712 361
288 3300005344 Ga0070661_100092249 Ga0070661_1000922491 361
289 3300005355 Ga0070671_100001167 Ga0070671_1000011676 361
290 3300005366 Ga0070659_100221479 Ga0070659_1002214792 361
291 3300005458 Ga0070681_10209105 Ga0070681_102091052 361
292 3300005564 Ga0070664_100087436 Ga0070664_1000874362 361
293 3300005616 Ga0068852_100062533 Ga0068852_1000625332 361
294 3300005618 Ga0068864_100014126 Ga0068864_1000141263 361
295 3300005841 Ga0068863_100124244 Ga0068863_1001242442 361
296 3300009177 Ga0105248_10002609 Ga0105248_1000260914 361
297 3300025912 Ga0207707_10024394 Ga0207707_100243947 361
298 3300025913 Ga0207695_10112967 Ga0207695_101129672 361
299 3300025917 Ga0207660_10024950 Ga0207660_100249503 361
300 3300025919 Ga0207657_10161624 Ga0207657_101616242 361
301 3300025931 Ga0207644_10018544 Ga0207644_100185444 361
302 3300025932 Ga0207690_10179521 Ga0207690_101795211 361
303 3300025941 Ga0207711_10005183 Ga0207711_100051833 361
304 3300025945 Ga0207679_10057127 Ga0207679_100571272 361
305 3300025949 Ga0207667_10014480 Ga0207667_1001448012 361
306 3300026088 Ga0207641_10035687 Ga0207641_100356872 361
307 3300026142 Ga0207698_10062175 Ga0207698_100621752 361
308 3300042439 Ga0439464_0000818 Ga0439464_0000818_3261_4352 361
309 3300048904 Ga0496101_0100591 Ga0496101_0100591_381_1469 361
310 3300048909 Ga0496106_0081682 Ga0496106_0081682_414_1502 361
311 3300048910 Ga0496107_0002426 Ga0496107_0002426_8048_9136 361
312 3300048911 Ga0496108_0018510 Ga0496108_0018510_3388_4476 361
313 3300048913 Ga0496110_0123127 Ga0496110_0123127_1139_2227 361
314 3300048915 Ga0496112_0001628 Ga0496112_0001628_15567_16655 361
315 3300048916 Ga0496113_0093343 Ga0496113_0093343_22_1110 361
316 3300037466 Ga0395898_0075759 Ga0395898_0075759_998_2092 364
317 3300037471 Ga0395905_0116874 Ga0395905_0116874_132_1226 364
318 3300005336 Ga0070680_100034949 Ga0070680_1000349492 370
319 3300005338 Ga0068868_100223524 Ga0068868_1002235242 370
320 3300009177 Ga0105248_10000278 Ga0105248_1000027815 370
321 3300013100 Ga0157373_10106994 Ga0157373_101069942 370
322 3300013104 Ga0157370_10160438 Ga0157370_101604383 370
323 3300013105 Ga0157369_10212333 Ga0157369_102123332 370
324 3300014325 Ga0163163_10001741 Ga0163163_1000174116 370
325 3300035092 Ga0373952_0008510 Ga0373952_0008510_29_1141 370
326 3300035114 Ga0373939_0023529 Ga0373939_0023529_67_1179 370
327 3300035691 Ga0373931_0004980 Ga0373931_0004980_524_1636 370
328 3300048912 Ga0496109_0342504 Ga0496109_0342504_262_1374 370
329 3300048916 Ga0496113_0164325 Ga0496113_0164325_308_1420 370
330 3300001989 JGI24739J22299_10002905 JGI24739J22299_100029056 372
331 3300001990 JGI24737J22298_10001625 JGI24737J22298_100016259 372
332 3300002075 JGI24738J21930_10006098 JGI24738J21930_100060981 372
333 3300005327 Ga0070658_10002938 Ga0070658_1000293814 372
334 3300005329 Ga0070683_100003546 Ga0070683_1000035465 372
335 3300005331 Ga0070670_100222296 Ga0070670_1002222962 372
336 3300005335 Ga0070666_10000216 Ga0070666_1000021630 372
337 3300005339 Ga0070660_100002994 Ga0070660_10000299413 372
338 3300005344 Ga0070661_100000213 Ga0070661_10000021315 372
339 3300005355 Ga0070671_100016925 Ga0070671_1000169259 372
340 3300005366 Ga0070659_100000123 Ga0070659_10000012348 372
341 3300005367 Ga0070667_100182761 Ga0070667_1001827612 372
342 3300005455 Ga0070663_100018088 Ga0070663_1000180884 372
343 3300005457 Ga0070662_100000060 Ga0070662_10000006048 372
344 3300005535 Ga0070684_100009933 Ga0070684_1000099336 372
345 3300005539 Ga0068853_100000277 Ga0068853_10000027730 372
346 3300005547 Ga0070693_100014272 Ga0070693_1000142724 372
347 3300005548 Ga0070665_100003965 Ga0070665_10000396512 372
348 3300005563 Ga0068855_100000877 Ga0068855_10000087738 372
349 3300005564 Ga0070664_100002327 Ga0070664_10000232713 372
350 3300005614 Ga0068856_100002727 Ga0068856_10000272713 372
351 3300005616 Ga0068852_100001371 Ga0068852_10000137113 372
352 3300005618 Ga0068864_100036295 Ga0068864_1000362954 372
353 3300005834 Ga0068851_10078434 Ga0068851_100784342 372
354 3300025321 Ga0207656_10045546 Ga0207656_100455462 372
355 3300025903 Ga0207680_10000727 Ga0207680_100007276 372
356 3300025904 Ga0207647_10019874 Ga0207647_100198744 372
357 3300025909 Ga0207705_10000535 Ga0207705_100005356 372
358 3300025919 Ga0207657_10000334 Ga0207657_1000033448 372
359 3300025920 Ga0207649_10000211 Ga0207649_1000021114 372
360 3300025925 Ga0207650_10085720 Ga0207650_100857202 372
361 3300025931 Ga0207644_10011189 Ga0207644_100111891 372
362 3300025932 Ga0207690_10000182 Ga0207690_1000018238 372
363 3300025933 Ga0207706_10001196 Ga0207706_100011965 372
364 3300025941 Ga0207711_10000719 Ga0207711_1000071914 372
365 3300025944 Ga0207661_10001052 Ga0207661_1000105218 372
366 3300025945 Ga0207679_10000293 Ga0207679_1000029315 372
367 3300025949 Ga0207667_10001632 Ga0207667_1000163228 372
368 3300026041 Ga0207639_10000154 Ga0207639_1000015445 372
369 3300026067 Ga0207678_10020049 Ga0207678_100200494 372
370 3300026078 Ga0207702_10002919 Ga0207702_100029196 372
371 3300026095 Ga0207676_10026954 Ga0207676_100269544 372
372 3300026142 Ga0207698_10005371 Ga0207698_100053713 372
373 3300028379 Ga0268266_10003672 Ga0268266_1000367210 372
374 3300001979 JGI24740J21852_10003765 JGI24740J21852_100037654 383
375 3300001989 JGI24739J22299_10001694 JGI24739J22299_100016943 383
376 3300001990 JGI24737J22298_10001287 JGI24737J22298_100012879 383
377 3300002075 JGI24738J21930_10000781 JGI24738J21930_100007817 383
378 3300005328 Ga0070676_10055469 Ga0070676_100554692 383
379 3300005330 Ga0070690_100041991 Ga0070690_1000419911 383
380 3300005331 Ga0070670_100003150 Ga0070670_1000031503 383
381 3300005334 Ga0068869_100000074 Ga0068869_10000007425 383
382 3300005338 Ga0068868_100000398 Ga0068868_10000039829 383
383 3300005344 Ga0070661_100123656 Ga0070661_1001236562 383
384 3300005347 Ga0070668_100001938 Ga0070668_10000193815 383
385 3300005353 Ga0070669_100000197 Ga0070669_10000019744 383
386 3300005355 Ga0070671_100018198 Ga0070671_1000181981 383
387 3300005364 Ga0070673_100001014 Ga0070673_1000010147 383
388 3300005366 Ga0070659_100009065 Ga0070659_1000090657 383
389 3300005367 Ga0070667_100000876 Ga0070667_10000087625 383
390 3300005457 Ga0070662_100000334 Ga0070662_10000033418 383
391 3300005459 Ga0068867_100001586 Ga0068867_1000015863 383
392 3300005539 Ga0068853_100001079 Ga0068853_10000107913 383
393 3300005543 Ga0070672_100000227 Ga0070672_1000002277 383
394 3300005563 Ga0068855_100001413 Ga0068855_10000141323 383
395 3300005564 Ga0070664_100007035 Ga0070664_1000070352 383
396 3300005577 Ga0068857_100004019 Ga0068857_10000401912 383
397 3300005616 Ga0068852_100001013 Ga0068852_1000010134 383
398 3300005617 Ga0068859_100001673 Ga0068859_10000167318 383
399 3300005618 Ga0068864_100000393 Ga0068864_10000039328 383
400 3300005841 Ga0068863_100002359 Ga0068863_10000235919 383
401 3300005842 Ga0068858_100004688 Ga0068858_1000046888 383
402 3300005843 Ga0068860_100006230 Ga0068860_1000062307 383
403 3300006237 Ga0097621_100100771 Ga0097621_1001007712 383
404 3300006931 Ga0097620_100001673 Ga0097620_10000167318 383
405 3300009098 Ga0105245_10000068 Ga0105245_1000006896 383
406 3300009177 Ga0105248_10001005 Ga0105248_1000100520 383
407 3300013102 Ga0157371_10003436 Ga0157371_1000343620 383
408 3300013297 Ga0157378_10003316 Ga0157378_100033167 383
409 3300013307 Ga0157372_10117072 Ga0157372_101170722 383
410 3300014745 Ga0157377_10136627 Ga0157377_101366272 383
411 3300025315 Ga0207697_10000007 Ga0207697_1000000748 383
412 3300025901 Ga0207688_10016176 Ga0207688_100161763 383
413 3300025903 Ga0207680_10043249 Ga0207680_100432492 383
414 3300025904 Ga0207647_10003698 Ga0207647_1000369810 383
415 3300025907 Ga0207645_10001287 Ga0207645_100012872 383
416 3300025919 Ga0207657_10003513 Ga0207657_1000351320 383
417 3300025920 Ga0207649_10021297 Ga0207649_100212973 383
418 3300025923 Ga0207681_10000695 Ga0207681_1000069517 383
419 3300025925 Ga0207650_10013538 Ga0207650_100135383 383
420 3300025927 Ga0207687_10000584 Ga0207687_1000058425 383
421 3300025931 Ga0207644_10006478 Ga0207644_100064783 383
422 3300025932 Ga0207690_10002867 Ga0207690_100028677 383
423 3300025933 Ga0207706_10002875 Ga0207706_100028755 383
424 3300025937 Ga0207669_10003636 Ga0207669_100036363 383
425 3300025940 Ga0207691_10007439 Ga0207691_100074395 383
426 3300025941 Ga0207711_10000591 Ga0207711_1000059127 383
427 3300025942 Ga0207689_10002604 Ga0207689_100026045 383
428 3300025945 Ga0207679_10004030 Ga0207679_100040302 383
429 3300025949 Ga0207667_10001522 Ga0207667_1000152214 383
430 3300025960 Ga0207651_10001491 Ga0207651_100014915 383
431 3300025972 Ga0207668_10004449 Ga0207668_100044497 383
432 3300025981 Ga0207640_10000507 Ga0207640_1000050730 383
433 3300025986 Ga0207658_10006192 Ga0207658_100061922 383
434 3300026023 Ga0207677_10000872 Ga0207677_1000087212 383
435 3300026035 Ga0207703_10065097 Ga0207703_100650973 383
436 3300026041 Ga0207639_10004688 Ga0207639_100046883 383
437 3300026067 Ga0207678_10058707 Ga0207678_100587072 383
438 3300026088 Ga0207641_10033929 Ga0207641_100339293 383
439 3300026089 Ga0207648_10000752 Ga0207648_1000075220 383
440 3300026095 Ga0207676_10000257 Ga0207676_1000025738 383
441 3300026116 Ga0207674_10007851 Ga0207674_1000785112 383
442 3300026142 Ga0207698_10023263 Ga0207698_100232632 383
443 3300028379 Ga0268266_10077506 Ga0268266_100775063 383
444 3300028381 Ga0268264_10007331 Ga0268264_100073318 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

21

117

0.85

PF01266

DAO

FAD dependent oxidoreductase

125

383

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdw-assembly1.cif.gz_A nad+-dependent (r)-2-hydroxyglutarate dehydrogenase from acidaminococcus fermentans 0.9516 123 152
3oc4-assembly1.cif.gz_B crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 0.9516 125 152
3pp8-assembly1.cif.gz_A-2 2.1 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium 0.936 124 155
4b3h-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex 0.9354 124 156
3g5q-assembly1.cif.gz_A crystal structure of thermus thermophilus trmfo 0.9328 123 154
ID Description Score Start End Superfamily
af_L7N688_2_179_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9632 124 155 3.40.50.720
1xdwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9516 123 152 3.40.50.720
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9489 126 154 3.50.50.60
6bz0A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9471 125 154 3.50.50.60
af_P9WHH5_150_268_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.946 125 152 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A095ASL5-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9677 58 383 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A2T5FXY7-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9626 56 380 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A095ASL5-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.962 58 383 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A2V8UI84-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.948 147 380 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A4Q2YFF6-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9449 56 380 GO:0003884
GO:0005737
GO:0019478
GO:0071949

Feature Viewer

pLDDT pTM Quality
84.67 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map