F445159

General Info

Members Datasets Scaffolds Average Seq Length
443 338 886 158

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0500729|Ga0496121_0500729_82_561
Length 159
Sequence MMIDMDSLIRWMHIIGACVLLGTGAGIAFFMVMAHRTGKASIIAHTAGVVVIADTIFTATAVVVQPITGAMLAHRIGWSLTDGWVAASLGLYVLAGIFWLPVVWIQVQLGKIASAAAASVDETLPPRYFRLYRIWFACGFPAFAAVLAIIWLMVAKPSL

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
102 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
105 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
108 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
109 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
110 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
111 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
196 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
209 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
212 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
213 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
214 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
215 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
216 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
217 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
218 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
219 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
220 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
221 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
222 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
223 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
224 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
225 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
226 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
227 2519899620 Rhizobium sp. Pop5 Isolate Nodule
228 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
229 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
230 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
231 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
232 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
233 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
234 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
235 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
236 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
237 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
238 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
239 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
240 2643221568 Rhizobium sp. Root564 Isolate Unclassified
241 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
242 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
243 2643221693 Rhizobium sp. Root491 Isolate Unclassified
244 2718217927 Rhizobium sp. N324 Isolate Nodule
245 2718218423 Rhizobium sp. N941 Isolate Nodule
246 2721755809 Rhizobium sp. N541 Isolate Nodule
247 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
248 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
249 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
250 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
251 2791355266 Rhizobium sp. L43 Isolate Nodule
252 2791355267 Rhizobium sp. L18 Isolate Nodule
253 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
254 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
255 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
256 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
257 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
258 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
259 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
260 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
261 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
262 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
263 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
264 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
265 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
266 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
267 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
268 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
269 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
270 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
271 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
272 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
273 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
274 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
275 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
276 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
277 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
278 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
279 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
280 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
281 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
282 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
283 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
284 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
285 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
286 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
287 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
288 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
289 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
290 2909042592 Labrys sp. LIt4 Isolate Nodule
291 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
292 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
293 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
294 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
295 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
296 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
297 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
298 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
299 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
300 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
301 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
302 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
303 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
304 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
305 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
306 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
307 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
308 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
309 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
310 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
311 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
312 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
313 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
314 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
315 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
316 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
317 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
318 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
319 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
320 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
321 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
322 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
323 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
324 8005275841 Rhizobium sp. N4311 Isolate Nodule
325 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
326 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
327 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
328 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
329 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
330 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
331 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
332 8018176218 Rhizobium sp. N122 Isolate Nodule
333 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
334 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
335 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
336 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
337 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
338 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.43
Metatranscriptomes 0.45
Isolates 29.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 19.64
Nodule 17.83
Rhizoplane 4.29
Rhizosphere 35.21
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0500729 3300048924 Bacteria 771
2 JGI24739J22299_10155789 3300001989 Bacteria 675
3 JGI25159J45721_1000966 3300002987 Bacteria 12481
4 JGI25406J46586_10003705 3300003203 Bacteria 7160
5 JGI25153J46596_10044929 3300003215 Bacteria 1323
6 JGI25160J50197_1000001 3300003354 Bacteria 782301
7 JGI25161J50226_1000001 3300003374 Bacteria 655036
8 Ga0055529_1002751 3300003763 Bacteria 3210
9 Ga0055526_1000241 3300003771 Bacteria 46273
10 Ga0055536_1075195 3300003781 Bacteria 654
11 Ga0055528_1001122 3300003790 Bacteria 17570
12 Ga0055540_1000283 3300003792 Bacteria 45546
13 Ga0055540_1015831 3300003792 Bacteria 2175
14 Ga0055531_10016911 3300003794 Bacteria 3114
15 Ga0055543_1000003 3300004625 Bacteria 358656
16 Ga0065165_1000068 3300005262 Bacteria 170609
17 Ga0065165_1000577 3300005262 Bacteria 54256
18 Ga0068868_100079189 3300005338 Bacteria 2632
19 Ga0070661_100915956 3300005344 Bacteria 724
20 Ga0070671_100141420 3300005355 Bacteria 2031
21 Ga0070674_100108540 3300005356 Bacteria 2034
22 Ga0070678_100084846 3300005456 Bacteria 2412
23 Ga0070662_100159629 3300005457 Bacteria 1763
24 Ga0070665_100014202 3300005548 Bacteria 8002
25 Ga0070665_100151873 3300005548 Bacteria 2319
26 Ga0070665_100211732 3300005548 Bacteria 1939
27 Ga0068855_100032466 3300005563 Bacteria 6234
28 Ga0068855_101224196 3300005563 Bacteria 780
29 Ga0070664_100455272 3300005564 Bacteria 1175
30 Ga0068852_100485081 3300005616 Bacteria 1229
31 Ga0068852_100501382 3300005616 Bacteria 1209
32 Ga0068864_100001426 3300005618 Bacteria 19733
33 Ga0068861_101394867 3300005719 Bacteria 684
34 Ga0068851_10035327 3300005834 Bacteria 2498
35 Ga0081539_10001499 3300005985 Bacteria 39468
36 Ga0075365_10033199 3300006038 Bacteria 3323
37 Ga0075365_10203889 3300006038 Bacteria 1386
38 Ga0075365_10338900 3300006038 Bacteria 1059
39 Ga0075368_10013669 3300006042 Bacteria 2984
40 Ga0075364_10256136 3300006051 Bacteria 1189
41 Ga0075362_10073704 3300006177 Bacteria 1563
42 Ga0075367_10325467 3300006178 Bacteria 969
43 Ga0075367_10557758 3300006178 Bacteria 727
44 Ga0075369_10001343 3300006186 Bacteria 8357
45 Ga0075366_10008456 3300006195 Bacteria 5724
46 Ga0097621_100480153 3300006237 Bacteria 1123
47 Ga0075370_10007946 3300006353 Bacteria 5434
48 Ga0075370_10218397 3300006353 Bacteria 1126
49 Ga0105244_10166033 3300009036 Bacteria 1052
50 Ga0105240_10000076 3300009093 Bacteria 198848
51 Ga0105240_10914643 3300009093 Bacteria 943
52 Ga0105245_10154750 3300009098 Bacteria 2171
53 Ga0105243_10010781 3300009148 Bacteria 6918
54 Ga0105248_10171004 3300009177 Bacteria 2449
55 Ga0105248_10354740 3300009177 Bacteria 1651
56 Ga0105237_10011962 3300009545 Bacteria 9171
57 Ga0105238_10575364 3300009551 Bacteria 1132
58 Ga0105239_10046855 3300010375 Bacteria 4737
59 Ga0105239_10213161 3300010375 Bacteria 2165
60 Ga0105246_10053299 3300011119 Bacteria 2783
61 Ga0157373_10603709 3300013100 Bacteria 799
62 Ga0157371_10000908 3300013102 Bacteria 33346
63 Ga0157370_10000282 3300013104 Bacteria 64601
64 Ga0157370_10000351 3300013104 Bacteria 58496
65 Ga0157369_10184785 3300013105 Bacteria 2192
66 Ga0157369_10483598 3300013105 Bacteria 1281
67 Ga0157374_10438239 3300013296 Bacteria 1307
68 Ga0157374_10481275 3300013296 Bacteria 1245
69 Ga0157375_10020863 3300013308 Bacteria 5997
70 Ga0163163_10127278 3300014325 Bacteria 2585
71 Ga0182008_10007751 3300014497 Bacteria 5909
72 Ga0157377_10296804 3300014745 Bacteria 1065
73 Ga0157377_10861058 3300014745 Unclassified 674
74 Ga0182007_10005437 3300015262 Bacteria 5597
75 Ga0182005_1002519 3300015265 Bacteria 6504
76 Ga0209677_100268 3300025253 Bacteria 35373
77 Ga0209148_1000038 3300025254 Bacteria 493744
78 Ga0209233_1000260 3300025261 Bacteria 79607
79 Ga0209455_1000068 3300025272 Bacteria 310024
80 Ga0209673_1000384 3300025273 Bacteria 79540
81 Ga0209673_1000977 3300025273 Bacteria 35281
82 Ga0209130_1000003 3300025284 Bacteria 677988
83 Ga0209130_1000348 3300025284 Bacteria 53200
84 Ga0209676_1019434 3300025292 Bacteria 2338
85 Ga0209025_1000405 3300025294 Bacteria 87670
86 Ga0209564_1000019 3300025295 Bacteria 573686
87 Ga0209564_1000388 3300025295 Bacteria 79331
88 Ga0209758_1000642 3300025297 Bacteria 53219
89 Ga0209758_1060767 3300025297 Bacteria 1249
90 Ga0209050_1019755 3300025298 Bacteria 2543
91 Ga0209256_1002304 3300025299 Bacteria 15989
92 Ga0207426_1000011 3300025302 Bacteria 791203
93 Ga0209051_1000308 3300025303 Bacteria 76477
94 Ga0209051_1024950 3300025303 Bacteria 2445
95 Ga0209257_1000853 3300025304 Bacteria 43617
96 Ga0209257_1019871 3300025304 Bacteria 2509
97 Ga0207647_10512420 3300025904 Bacteria 668
98 Ga0207705_10073125 3300025909 Bacteria 2487
99 Ga0207695_10000011 3300025913 Bacteria 910221
100 Ga0207695_10516191 3300025913 Bacteria 1076
101 Ga0207671_10000093 3300025914 Bacteria 138939
102 Ga0207681_10405205 3300025923 Bacteria 1102
103 Ga0207644_10279774 3300025931 Bacteria 1339
104 Ga0207706_10329575 3300025933 Bacteria 1328
105 Ga0207709_10150110 3300025935 Bacteria 1613
106 Ga0207669_10111879 3300025937 Bacteria 1832
107 Ga0207711_10351937 3300025941 Bacteria 1364
108 Ga0207667_10398942 3300025949 Bacteria 1400
109 Ga0207667_10773395 3300025949 Bacteria 958
110 Ga0207668_10255601 3300025972 Bacteria 1425
111 Ga0207658_10658119 3300025986 Bacteria 945
112 Ga0207677_10170403 3300026023 Bacteria 1702
113 Ga0207683_10015488 3300026121 Bacteria 6493
114 Ga0207683_11217148 3300026121 Bacteria 698
115 Ga0207698_10321369 3300026142 Bacteria 1450
116 Ga0209371_1016359 3300027312 Bacteria 1959
117 Ga0209813_10016716 3300027866 Bacteria 2006
118 Ga0268266_10016871 3300028379 Bacteria 6240
119 Ga0268266_10023807 3300028379 Bacteria 5212
120 Ga0268266_10189215 3300028379 Bacteria 1878
121 Ga0268266_10303444 3300028379 Bacteria 1490
122 Ga0268265_10952668 3300028380 Bacteria 846
123 Ga0307517_10184584 3300028786 Bacteria 1338
124 Ga0307515_10017597 3300028794 Bacteria 13001
125 Ga0268256_1018176 3300030500 Bacteria 1959
126 Ga0316582_0201485 3300036647 Bacteria 1358
127 Ga0316582_0830999 3300036647 Bacteria 633
128 Ga0395905_0000736 3300037471 Bacteria 43138
129 Ga0395905_0170467 3300037471 Bacteria 2044
130 Ga0395905_0445424 3300037471 Bacteria 1193
131 Ga0395901_1389456 3300038443 Bacteria 661
132 Ga0451791_0821308 3300041451 Bacteria 2156
133 Ga0451793_0197141 3300041452 Bacteria 1028
134 Ga0451798_1021969 3300041458 Bacteria 3390
135 Ga0451833_0894306 3300041491 Bacteria 2800
136 Ga0451835_0040641 3300041492 Bacteria 2567
137 Ga0451837_0392092 3300041494 Bacteria 3031
138 Ga0451837_0569472 3300041494 Bacteria 1243
139 Ga0451839_0313923 3300041496 Bacteria 4452
140 Ga0451839_0695105 3300041496 Bacteria 831
141 Ga0451840_28865 3300041497 Bacteria 791
142 Ga0451841_0153783 3300041498 Bacteria 2481
143 Ga0451845_0687709 3300041501 Bacteria 800
144 Ga0451845_0717367 3300041501 Bacteria 2484
145 Ga0451845_0862479 3300041501 Bacteria 727
146 Ga0451847_0237521 3300041503 Bacteria 1694
147 Ga0451850_51532 3300041506 Bacteria 999
148 Ga0451851_0161803 3300041507 Bacteria 5715
149 Ga0451855_0491861 3300041511 Bacteria 2545
150 Ga0451855_1468966 3300041511 Bacteria 1782
151 Ga0451853_1152098 3300041512 Bacteria 5309
152 Ga0495627_108147 3300046453 Bacteria 790
153 Ga0495638_0270116 3300046460 Bacteria 928
154 Ga0495605_0018481 3300046474 Bacteria 3737
155 Ga0495585_0024878 3300046492 Bacteria 3432
156 Ga0495596_0021263 3300046500 Bacteria 2650
157 Ga0495583_0215985 3300046506 Bacteria 776
158 Ga0495606_0002164 3300046507 Bacteria 23646
159 Ga0495606_0282564 3300046507 Bacteria 907
160 Ga0495610_0001253 3300046512 Bacteria 22804
161 Ga0495610_0045802 3300046512 Bacteria 2162
162 Ga0495620_0047658 3300046515 Bacteria 1843
163 Ga0495620_0141527 3300046515 Bacteria 940
164 Ga0495631_0145180 3300046518 Bacteria 1018
165 Ga0495632_0001015 3300046519 Bacteria 24284
166 Ga0495632_0051734 3300046519 Bacteria 2021
167 Ga0495648_0091124 3300046524 Bacteria 1706
168 Ga0495663_0008753 3300046525 Bacteria 2807
169 Ga0495654_0351040 3300046530 Bacteria 593
170 Ga0495609_0121926 3300046538 Bacteria 1120
171 Ga0495597_0057253 3300046542 Bacteria 1706
172 Ga0495645_0360351 3300046543 Bacteria 935
173 Ga0495633_0012064 3300046558 Bacteria 4615
174 Ga0495633_0040383 3300046558 Bacteria 2223
175 Ga0495656_0024881 3300046615 Bacteria 2369
176 Ga0495668_0097090 3300046616 Bacteria 1612
177 Ga0495611_0058439 3300046648 Bacteria 1749
178 Ga0495625_0003972 3300046660 Bacteria 14184
179 Ga0495625_0040946 3300046660 Bacteria 3375
180 Ga0495625_0053162 3300046660 Bacteria 2898
181 Ga0495661_0062923 3300046665 Bacteria 2196
182 Ga0495588_0226062 3300046674 Bacteria 988
183 Ga0495670_0016423 3300046691 Bacteria 3638
184 Ga0495670_0120839 3300046691 Bacteria 1360
185 Ga0495671_0077923 3300046692 Bacteria 1625
186 Ga0495671_0387907 3300046692 Bacteria 669
187 Ga0495649_0000001 3300046694 Bacteria 1113839
188 Ga0495660_0024502 3300046810 Bacteria 3436
189 Ga0495660_0037627 3300046810 Bacteria 2694
190 Ga0495636_0030596 3300047318 Bacteria 2202
191 Ga0495672_0182527 3300047320 Bacteria 1061
192 Ga0495686_0003045 3300047472 Bacteria 14859
193 Ga0495686_0024180 3300047472 Bacteria 3995
194 Ga0495686_0249728 3300047472 Bacteria 997
195 Ga0495686_0360441 3300047472 Bacteria 788
196 Ga0495686_0564785 3300047472 Bacteria 593
197 Ga0495615_0067974 3300048090 Bacteria 954
198 Ga0496100_0069653 3300048903 Bacteria 2343
199 Ga0496100_0208912 3300048903 Bacteria 1427
200 Ga0496101_0380710 3300048904 Bacteria 1110
201 Ga0496102_0035161 3300048905 Bacteria 4508
202 Ga0496104_0265792 3300048907 Bacteria 1628
203 Ga0496105_0504777 3300048908 Bacteria 949
204 Ga0496108_0076966 3300048911 Bacteria 2821
205 Ga0496109_0014861 3300048912 Bacteria 6774
206 Ga0496109_0646115 3300048912 Bacteria 995
207 Ga0496111_0000592 3300048914 Bacteria 19050
208 Ga0496112_0036522 3300048915 Bacteria 4793
209 Ga0496112_0074192 3300048915 Bacteria 3364
210 Ga0496113_0214366 3300048916 Bacteria 1533
211 Ga0496113_0445156 3300048916 Bacteria 1041
212 Ga0496116_0000322 3300048919 Bacteria 78643
213 Ga0496116_0036186 3300048919 Bacteria 3458
214 Ga0496116_0155057 3300048919 Bacteria 1265
215 Ga0496116_0157868 3300048919 Bacteria 1249
216 Ga0496116_0217565 3300048919 Bacteria 983
217 Ga0496117_0000002 3300048920 Bacteria 2483758
218 Ga0496117_0010714 3300048920 Bacteria 8293
219 Ga0496118_0000087 3300048921 Bacteria 176693
220 Ga0496118_0016543 3300048921 Bacteria 6762
221 Ga0496119_0055425 3300048922 Bacteria 2408
222 Ga0496119_0085939 3300048922 Bacteria 1799
223 Ga0496119_0097353 3300048922 Bacteria 1658
224 Ga0496119_0208294 3300048922 Bacteria 1007
225 Ga0496119_0409783 3300048922 Bacteria 645
226 Ga0496120_0000180 3300048923 Bacteria 107518
227 Ga0496120_0050587 3300048923 Bacteria 2378
228 Ga0496120_0055735 3300048923 Bacteria 2233
229 Ga0496121_0000003 3300048924 Bacteria 1191431
230 Ga0496121_0004088 3300048924 Bacteria 20038
231 Ga0496121_0005561 3300048924 Bacteria 16097
232 Ga0496121_0042223 3300048924 Bacteria 3971
233 Ga0496121_0268789 3300048924 Bacteria 1173
234 Ga0496122_0000004 3300048925 Bacteria 645283
235 Ga0496122_0011158 3300048925 Bacteria 9150
236 Ga0496122_0045300 3300048925 Bacteria 3420
237 Ga0496122_0066162 3300048925 Bacteria 2614
238 Ga0496122_0066466 3300048925 Bacteria 2604
239 Ga0496123_0000007 3300048926 Bacteria 645283
240 Ga0496123_0011197 3300048926 Bacteria 7806
241 Ga0496123_0015258 3300048926 Bacteria 6312
242 Ga0496123_0016919 3300048926 Bacteria 5892
243 Ga0496123_0131741 3300048926 Bacteria 1383
244 Ga0496124_0000457 3300048927 Bacteria 71169
245 Ga0496124_0005097 3300048927 Bacteria 14961
246 Ga0496124_0009382 3300048927 Bacteria 10083
247 Ga0496124_0018572 3300048927 Bacteria 6509
248 Ga0496124_0055401 3300048927 Bacteria 3351
249 Ga0496124_0092081 3300048927 Bacteria 2469
250 Ga0496125_0000039 3300048928 Bacteria 318665
251 Ga0496125_0114726 3300048928 Bacteria 1940
252 Ga0496125_0307085 3300048928 Bacteria 969
253 Ga0496126_0001008 3300048929 Bacteria 47974
254 Ga0496126_0073083 3300048929 Bacteria 3049
255 Ga0496126_0102546 3300048929 Bacteria 2501
256 Ga0496126_0232582 3300048929 Bacteria 1543
257 Ga0496126_0399266 3300048929 Bacteria 1115
258 Ga0496126_0620527 3300048929 Bacteria 849
259 Ga0495678_036872 3300049459 Bacteria 1992
260 Ga0501033_0000050 3300049570 Bacteria 111819
261 Ga0501036_0096634 3300049572 Bacteria 2497
262 Ga0501037_0119498 3300049573 Bacteria 1895
263 Ga0501038_0037411 3300049574 Bacteria 4254
264 Ga0501038_0119673 3300049574 Bacteria 2173
265 Ga0501039_0372691 3300049575 Bacteria 1121
266 Ga0501040_0290959 3300049576 Bacteria 1167
267 Ga0501042_0366574 3300049578 Bacteria 1042
268 Ga0501043_0051598 3300049579 Bacteria 3231
269 Ga0501048_0128429 3300049582 Bacteria 1792
270 Ga0501068_0005152 3300049584 Bacteria 7127
271 Ga0501070_0151475 3300049586 Bacteria 1913
272 Ga0501080_0021122 3300049742 Bacteria 6026
273 Ga0501282_013549 3300049778 Bacteria 884
274 Ga0501035_0003062 3300049822 Bacteria 16037
275 Ga0501044_0289201 3300049823 Bacteria 1570
276 nmdc:mga03683_156429_c1 3300050489 Bacteria 1031
277 nmdc:mga03n38_161034_c1 3300050490 Bacteria 1136
278 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
279 nmdc:mga00v17_219554_c1 3300050491 Bacteria 1231
280 nmdc:mga00v17_368132_c1 3300050491 Bacteria 934
281 nmdc:mga0yw44_204418_c1 3300050492 Bacteria 1305
282 nmdc:mga0yw44_50013_c1 3300050492 Bacteria 2526
283 nmdc:mga0yw44_685063_c1 3300050492 Bacteria 696
284 nmdc:mga0k408_46470_c1 3300050493 Bacteria 2507
285 nmdc:mga06z11_70010_c1 3300050494 Bacteria 1854
286 nmdc:mga07m45_250877_c1 3300050496 Bacteria 1030
287 nmdc:mga0sz30_240_c1 3300050516 Bacteria 21031
288 nmdc:mga0sz30_24150_c1 3300050516 Bacteria 2479
289 nmdc:mga0sz30_68394_c1 3300050516 Bacteria 1526
290 nmdc:mga0sz30_70698_c1 3300050516 Bacteria 1502
291 Ga0500644_0081302 3300053088 Bacteria 1192
292 Ga0500566_0287132 3300053094 Unclassified 781
293 Ga0500560_000131 3300053107 Bacteria 8079
294 Ga0500562_069372 3300053108 Bacteria 951
295 Ga0500572_291065 3300053111 Bacteria 527
296 Ga0500607_107783 3300053121 Bacteria 1371
297 Ga0500608_029678 3300053122 Bacteria 2588
298 Ga0500618_053165 3300053125 Bacteria 916
299 Ga0500658_0043668 3300053134 Bacteria 1805
300 Ga0500561_0000126 3300053137 Bacteria 14808
301 Ga0500568_0000355 3300053139 Bacteria 35644
302 Ga0500577_0175647 3300053142 Bacteria 918
303 Ga0500616_0000884 3300053153 Bacteria 33039
304 Ga0500620_000329 3300053155 Bacteria 8951
305 Ga0500620_001984 3300053155 Bacteria 3975
306 Ga0500622_0000697 3300053156 Bacteria 29561
307 Ga0500624_001069 3300053157 Bacteria 5287
308 Ga0500624_016058 3300053157 Bacteria 1151
309 Ga0500627_0044831 3300053158 Bacteria 1912
310 Ga0500627_0161558 3300053158 Bacteria 1011
311 Ga0500634_0004429 3300053161 Bacteria 6490
312 Ga0500634_0008929 3300053161 Bacteria 5037
313 Ga0500611_047232 3300053727 Bacteria 971
314 Ga0500645_096723 3300053730 Bacteria 835
315 2509392133 2509276021 Bacteria 7634384
316 2509445779 2509276033 Bacteria 7180565
317 2509446919 2509276033 Bacteria 7180565
318 2510133877 2510065019 Bacteria 6903379
319 2510895298 2510461076 Bacteria 8618824
320 2511135316 2510917022 Bacteria 6504556
321 2511173706 2510917026 Bacteria 7046020
322 2513573648 2513237084 Bacteria 7231967
323 2513629476 2513237093 Bacteria 7545552
324 2513708126 2513237103 Bacteria 7647401
325 2514020083 2513237162 Bacteria 7468464
326 2514032787 2513237164 Bacteria 7563725
327 2515112922 2515075009 Bacteria 7288508
328 2515636399 2515154113 Bacteria 7807172
329 2515640885 2515154114 Bacteria 7848616
330 2515655431 2515154116 Bacteria 7552979
331 2517095756 2517093000 Bacteria 7412387
332 2520381428 2519899620 Bacteria 6499161
333 2530646031 2529292951 Bacteria 6916614
334 2585271053 2582581307 Bacteria 6597605
335 2585277408 2582581308 Bacteria 7413247
336 2585323418 2582581315 Bacteria 7318924
337 2585535035 2585427527 Bacteria 7273426
338 2585555883 2585427530 Bacteria 7383882
339 2585558777 2585427531 Bacteria 6992870
340 2585904253 2585427609 Bacteria 6667127
341 2586000734 2585427634 Bacteria 6455027
342 2587980630 2585428125 Bacteria 6662905
343 2599721978 2599185236 Bacteria 6875203
344 2616308883 2615840626 Bacteria 7921970
345 2643856843 2643221568 Bacteria 5187270
346 2644129284 2643221623 Bacteria 5239945
347 2644157745 2643221627 Bacteria 6761570
348 2644522035 2643221693 Bacteria 5513853
349 2719386259 2718217927 Bacteria 6972593
350 2721400041 2718218423 Bacteria 6438183
351 2724038854 2721755809 Bacteria 6438790
352 2725952638 2724679232 Bacteria 7646494
353 2765464698 2765235802 Bacteria 5618596
354 2766065790 2765235942 Bacteria 7445910
355 2792748742 2791355123 Bacteria 8049106
356 2793363621 2791355266 Bacteria 7116587
357 2793370253 2791355267 Bacteria 7222458
358 2808987995 2808606387 Bacteria 5697198
359 2819241475 2818991272 Bacteria 4622173
360 2819637701 2818991453 Bacteria 7181617
361 2838043890 2838042994 Bacteria 6046894
362 2838076942 2838074704 Bacteria 6785777
363 2838681689 2838680041 Bacteria 6545511
364 2838696261 2838694306 Bacteria 6853137
365 2838710500 2838707686 Bacteria 6619912
366 2841869875 2841864319 Bacteria 6742987
367 2842078674 2842077413 Bacteria 6508645
368 2842114904 2842110456 Bacteria 7656360
369 2842118817 2842118031 Bacteria 7033875
370 2842217855 2842217011 Bacteria 7497767
371 2842239912 2842237096 Bacteria 6620661
372 2842292336 2842291075 Bacteria 7076806
373 2842369042 2842363717 Bacteria 6844742
374 2842372256 2842370503 Bacteria 7038661
375 2842378733 2842377471 Bacteria 7140707
376 2842385327 2842384541 Bacteria 7057858
377 2842699368 2842698319 Bacteria 5190321
378 2847676199 2847670302 Bacteria 6165597
379 2852390134 2852387548 Bacteria 8025568
380 2854899211 2854896431 Bacteria 5869725
381 2856315985 2856314179 Bacteria 6477897
382 2857517515 2857516855 Bacteria 7787325
383 2871503100 2871495908 Bacteria 6935695
384 2874170834 2874168670 Bacteria 8062617
385 2878040253 2878035449 Bacteria 6555736
386 2878766989 2878760144 Bacteria 6823465
387 2878774187 2878767105 Bacteria 6898628
388 2882633294 2882632389 Bacteria 8154593
389 2896388091 2896384573 Bacteria 7700774
390 2899796128 2899792073 Bacteria 4926588
391 2899807349 2899803654 Bacteria 5577784
392 2899850712 2899845264 Bacteria 5672268
393 2903548289 2903540706 Bacteria 7062119
394 2906416122 2906414383 Bacteria 6580790
395 2909044041 2909042592 Bacteria 6499737
396 2919169170 2919166419 Bacteria 4952238
397 2919174783 2919171160 Bacteria 6499771
398 2920761620 2920760137 Bacteria 7427611
399 2924765163 2924762789 Bacteria 6561353
400 2926762907 2926760298 Bacteria 5505990
401 2929140789 2929138655 Bacteria 5810547
402 2933591276 2933586486 Bacteria 7667493
403 2935900733 2935894831 Bacteria 6620579
404 2936372121 2936367885 Bacteria 7324495
405 2936381074 2936375103 Bacteria 6652732
406 2937854318 2937848649 Bacteria 6983481
407 2938002113 2937994558 Bacteria 7036190
408 2958172167 2958165035 Bacteria 6906348
409 2961170615 2961163497 Bacteria 6901077
410 2965025362 2965018300 Bacteria 6883036
411 2968179001 2968171901 Bacteria 6894245
412 2970561845 2970554993 Bacteria 6814252
413 2977926728 2977922695 Bacteria 6956781
414 2979094601 2979089926 Bacteria 5670289
415 2979100834 2979095461 Bacteria 5669583
416 2984589864 2984587000 Bacteria 5263363
417 2987666854 2987659509 Bacteria 6966464
418 2987667794 2987666974 Bacteria 6509233
419 2996313959 2996310559 Bacteria 6357320
420 3004195858 3004188549 Bacteria 6952365
421 3004215055 3004211236 Bacteria 7417683
422 3004222354 3004218560 Bacteria 7421728
423 3004339939 3004334049 Bacteria 8449246
424 3005448363 3005445848 Bacteria 6906074
425 639649115 639633055 Bacteria 7751309
426 650740480 650716007 Bacteria 5573770
427 8002288946 8002285264 Bacteria 6717907
428 8003571547 8003570095 Bacteria 5747666
429 8005281050 8005275841 Bacteria 6929066
430 8005303044 8005301065 Bacteria 6614431
431 8005380848 8005376324 Bacteria 6590079
432 8005463599 8005460587 Bacteria 7157962
433 8005557094 8005556819 Bacteria 6908598
434 8005567911 8005563573 Bacteria 7153261
435 8005692186 8005688590 Bacteria 6610080
436 8018163868 8018163183 Bacteria 7277977
437 8018181402 8018176218 Bacteria 6896178
438 8024482946 8024479707 Bacteria 6954785
439 8024487948 8024486573 Bacteria 6540512
440 8054560762 8054558443 Bacteria 5204801
441 8056378449 8056375014 Bacteria 7006639
442 8057575818 8057575449 Bacteria 7367519
443 8057877319 8057874678 Bacteria 7494653
444 Ga0496121_0500729
445 JGI24739J22299_10155789
446 JGI25159J45721_1000966
447 JGI25406J46586_10003705
448 JGI25153J46596_10044929
449 JGI25160J50197_1000001
450 JGI25161J50226_1000001
451 Ga0055529_1002751
452 Ga0055526_1000241
453 Ga0055536_1075195
454 Ga0055528_1001122
455 Ga0055540_1000283
456 Ga0055540_1015831
457 Ga0055531_10016911
458 Ga0055543_1000003
459 Ga0065165_1000068
460 Ga0065165_1000577
461 Ga0068868_100079189
462 Ga0070661_100915956
463 Ga0070671_100141420
464 Ga0070674_100108540
465 Ga0070678_100084846
466 Ga0070662_100159629
467 Ga0070665_100014202
468 Ga0070665_100151873
469 Ga0070665_100211732
470 Ga0068855_100032466
471 Ga0068855_101224196
472 Ga0070664_100455272
473 Ga0068852_100485081
474 Ga0068852_100501382
475 Ga0068864_100001426
476 Ga0068861_101394867
477 Ga0068851_10035327
478 Ga0081539_10001499
479 Ga0075365_10033199
480 Ga0075365_10203889
481 Ga0075365_10338900
482 Ga0075368_10013669
483 Ga0075364_10256136
484 Ga0075362_10073704
485 Ga0075367_10325467
486 Ga0075367_10557758
487 Ga0075369_10001343
488 Ga0075366_10008456
489 Ga0097621_100480153
490 Ga0075370_10007946
491 Ga0075370_10218397
492 Ga0105244_10166033
493 Ga0105240_10000076
494 Ga0105240_10914643
495 Ga0105245_10154750
496 Ga0105243_10010781
497 Ga0105248_10171004
498 Ga0105248_10354740
499 Ga0105237_10011962
500 Ga0105238_10575364
501 Ga0105239_10046855
502 Ga0105239_10213161
503 Ga0105246_10053299
504 Ga0157373_10603709
505 Ga0157371_10000908
506 Ga0157370_10000282
507 Ga0157370_10000351
508 Ga0157369_10184785
509 Ga0157369_10483598
510 Ga0157374_10438239
511 Ga0157374_10481275
512 Ga0157375_10020863
513 Ga0163163_10127278
514 Ga0182008_10007751
515 Ga0157377_10296804
516 Ga0157377_10861058
517 Ga0182007_10005437
518 Ga0182005_1002519
519 Ga0209677_100268
520 Ga0209148_1000038
521 Ga0209233_1000260
522 Ga0209455_1000068
523 Ga0209673_1000384
524 Ga0209673_1000977
525 Ga0209130_1000003
526 Ga0209130_1000348
527 Ga0209676_1019434
528 Ga0209025_1000405
529 Ga0209564_1000019
530 Ga0209564_1000388
531 Ga0209758_1000642
532 Ga0209758_1060767
533 Ga0209050_1019755
534 Ga0209256_1002304
535 Ga0207426_1000011
536 Ga0209051_1000308
537 Ga0209051_1024950
538 Ga0209257_1000853
539 Ga0209257_1019871
540 Ga0207647_10512420
541 Ga0207705_10073125
542 Ga0207695_10000011
543 Ga0207695_10516191
544 Ga0207671_10000093
545 Ga0207681_10405205
546 Ga0207644_10279774
547 Ga0207706_10329575
548 Ga0207709_10150110
549 Ga0207669_10111879
550 Ga0207711_10351937
551 Ga0207667_10398942
552 Ga0207667_10773395
553 Ga0207668_10255601
554 Ga0207658_10658119
555 Ga0207677_10170403
556 Ga0207683_10015488
557 Ga0207683_11217148
558 Ga0207698_10321369
559 Ga0209371_1016359
560 Ga0209813_10016716
561 Ga0268266_10016871
562 Ga0268266_10023807
563 Ga0268266_10189215
564 Ga0268266_10303444
565 Ga0268265_10952668
566 Ga0307517_10184584
567 Ga0307515_10017597
568 Ga0268256_1018176
569 Ga0316582_0201485
570 Ga0316582_0830999
571 Ga0395905_0000736
572 Ga0395905_0170467
573 Ga0395905_0445424
574 Ga0395901_1389456
575 Ga0451791_0821308
576 Ga0451793_0197141
577 Ga0451798_1021969
578 Ga0451833_0894306
579 Ga0451835_0040641
580 Ga0451837_0392092
581 Ga0451837_0569472
582 Ga0451839_0313923
583 Ga0451839_0695105
584 Ga0451840_28865
585 Ga0451841_0153783
586 Ga0451845_0687709
587 Ga0451845_0717367
588 Ga0451845_0862479
589 Ga0451847_0237521
590 Ga0451850_51532
591 Ga0451851_0161803
592 Ga0451855_0491861
593 Ga0451855_1468966
594 Ga0451853_1152098
595 Ga0495627_108147
596 Ga0495638_0270116
597 Ga0495605_0018481
598 Ga0495585_0024878
599 Ga0495596_0021263
600 Ga0495583_0215985
601 Ga0495606_0002164
602 Ga0495606_0282564
603 Ga0495610_0001253
604 Ga0495610_0045802
605 Ga0495620_0047658
606 Ga0495620_0141527
607 Ga0495631_0145180
608 Ga0495632_0001015
609 Ga0495632_0051734
610 Ga0495648_0091124
611 Ga0495663_0008753
612 Ga0495654_0351040
613 Ga0495609_0121926
614 Ga0495597_0057253
615 Ga0495645_0360351
616 Ga0495633_0012064
617 Ga0495633_0040383
618 Ga0495656_0024881
619 Ga0495668_0097090
620 Ga0495611_0058439
621 Ga0495625_0003972
622 Ga0495625_0040946
623 Ga0495625_0053162
624 Ga0495661_0062923
625 Ga0495588_0226062
626 Ga0495670_0016423
627 Ga0495670_0120839
628 Ga0495671_0077923
629 Ga0495671_0387907
630 Ga0495649_0000001
631 Ga0495660_0024502
632 Ga0495660_0037627
633 Ga0495636_0030596
634 Ga0495672_0182527
635 Ga0495686_0003045
636 Ga0495686_0024180
637 Ga0495686_0249728
638 Ga0495686_0360441
639 Ga0495686_0564785
640 Ga0495615_0067974
641 Ga0496100_0069653
642 Ga0496100_0208912
643 Ga0496101_0380710
644 Ga0496102_0035161
645 Ga0496104_0265792
646 Ga0496105_0504777
647 Ga0496108_0076966
648 Ga0496109_0014861
649 Ga0496109_0646115
650 Ga0496111_0000592
651 Ga0496112_0036522
652 Ga0496112_0074192
653 Ga0496113_0214366
654 Ga0496113_0445156
655 Ga0496116_0000322
656 Ga0496116_0036186
657 Ga0496116_0155057
658 Ga0496116_0157868
659 Ga0496116_0217565
660 Ga0496117_0000002
661 Ga0496117_0010714
662 Ga0496118_0000087
663 Ga0496118_0016543
664 Ga0496119_0055425
665 Ga0496119_0085939
666 Ga0496119_0097353
667 Ga0496119_0208294
668 Ga0496119_0409783
669 Ga0496120_0000180
670 Ga0496120_0050587
671 Ga0496120_0055735
672 Ga0496121_0000003
673 Ga0496121_0004088
674 Ga0496121_0005561
675 Ga0496121_0042223
676 Ga0496121_0268789
677 Ga0496122_0000004
678 Ga0496122_0011158
679 Ga0496122_0045300
680 Ga0496122_0066162
681 Ga0496122_0066466
682 Ga0496123_0000007
683 Ga0496123_0011197
684 Ga0496123_0015258
685 Ga0496123_0016919
686 Ga0496123_0131741
687 Ga0496124_0000457
688 Ga0496124_0005097
689 Ga0496124_0009382
690 Ga0496124_0018572
691 Ga0496124_0055401
692 Ga0496124_0092081
693 Ga0496125_0000039
694 Ga0496125_0114726
695 Ga0496125_0307085
696 Ga0496126_0001008
697 Ga0496126_0073083
698 Ga0496126_0102546
699 Ga0496126_0232582
700 Ga0496126_0399266
701 Ga0496126_0620527
702 Ga0495678_036872
703 Ga0501033_0000050
704 Ga0501036_0096634
705 Ga0501037_0119498
706 Ga0501038_0037411
707 Ga0501038_0119673
708 Ga0501039_0372691
709 Ga0501040_0290959
710 Ga0501042_0366574
711 Ga0501043_0051598
712 Ga0501048_0128429
713 Ga0501068_0005152
714 Ga0501070_0151475
715 Ga0501080_0021122
716 Ga0501282_013549
717 Ga0501035_0003062
718 Ga0501044_0289201
719 nmdc:mga03683_156429_c1
720 nmdc:mga03n38_161034_c1
721 nmdc:mga00v17_12_c1
722 nmdc:mga00v17_219554_c1
723 nmdc:mga00v17_368132_c1
724 nmdc:mga0yw44_204418_c1
725 nmdc:mga0yw44_50013_c1
726 nmdc:mga0yw44_685063_c1
727 nmdc:mga0k408_46470_c1
728 nmdc:mga06z11_70010_c1
729 nmdc:mga07m45_250877_c1
730 nmdc:mga0sz30_240_c1
731 nmdc:mga0sz30_24150_c1
732 nmdc:mga0sz30_68394_c1
733 nmdc:mga0sz30_70698_c1
734 Ga0500644_0081302
735 Ga0500566_0287132
736 Ga0500560_000131
737 Ga0500562_069372
738 Ga0500572_291065
739 Ga0500607_107783
740 Ga0500608_029678
741 Ga0500618_053165
742 Ga0500658_0043668
743 Ga0500561_0000126
744 Ga0500568_0000355
745 Ga0500577_0175647
746 Ga0500616_0000884
747 Ga0500620_000329
748 Ga0500620_001984
749 Ga0500622_0000697
750 Ga0500624_001069
751 Ga0500624_016058
752 Ga0500627_0044831
753 Ga0500627_0161558
754 Ga0500634_0004429
755 Ga0500634_0008929
756 Ga0500611_047232
757 Ga0500645_096723
758 2509392133
759 2509445779
760 2509446919
761 2510133877
762 2510895298
763 2511135316
764 2511173706
765 2513573648
766 2513629476
767 2513708126
768 2514020083
769 2514032787
770 2515112922
771 2515636399
772 2515640885
773 2515655431
774 2517095756
775 2520381428
776 2530646031
777 2585271053
778 2585277408
779 2585323418
780 2585535035
781 2585555883
782 2585558777
783 2585904253
784 2586000734
785 2587980630
786 2599721978
787 2616308883
788 2643856843
789 2644129284
790 2644157745
791 2644522035
792 2719386259
793 2721400041
794 2724038854
795 2725952638
796 2765464698
797 2766065790
798 2792748742
799 2793363621
800 2793370253
801 2808987995
802 2819241475
803 2819637701
804 2838043890
805 2838076942
806 2838681689
807 2838696261
808 2838710500
809 2841869875
810 2842078674
811 2842114904
812 2842118817
813 2842217855
814 2842239912
815 2842292336
816 2842369042
817 2842372256
818 2842378733
819 2842385327
820 2842699368
821 2847676199
822 2852390134
823 2854899211
824 2856315985
825 2857517515
826 2871503100
827 2874170834
828 2878040253
829 2878766989
830 2878774187
831 2882633294
832 2896388091
833 2899796128
834 2899807349
835 2899850712
836 2903548289
837 2906416122
838 2909044041
839 2919169170
840 2919174783
841 2920761620
842 2924765163
843 2926762907
844 2929140789
845 2933591276
846 2935900733
847 2936372121
848 2936381074
849 2937854318
850 2938002113
851 2958172167
852 2961170615
853 2965025362
854 2968179001
855 2970561845
856 2977926728
857 2979094601
858 2979100834
859 2984589864
860 2987666854
861 2987667794
862 2996313959
863 3004195858
864 3004215055
865 3004222354
866 3004339939
867 3005448363
868 639649115
869 650740480
870 8002288946
871 8003571547
872 8005281050
873 8005303044
874 8005380848
875 8005463599
876 8005557094
877 8005567911
878 8005692186
879 8018163868
880 8018181402
881 8024482946
882 8024487948
883 8054560762
884 8056378449
885 8057575818
886 8057877319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

7

157

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.7078 9 145
8dt0-assembly1.cif.gz_A scaffolding protein functional sites using deep learning 0.6925 3 148
1y4c-assembly1.cif.gz_A designed helical protein fusion mbp 0.6835 6 145
8dt0-assembly1.cif.gz_A scaffolding protein functional sites using deep learning 0.6816 3 148
7jrp-assembly1.cif.gz_c plant mitochondrial complex sc iii2+iv from vigna radiata 0.6715 11 147
ID Description Score Start End Superfamily
af_I1MTQ0_31_190_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.787 6 151 1.20.120.520
af_P0DP42_16_168_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7814 88 152 1.20.140.150
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.753 10 150 1.20.1440.210
2yfbB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7528 9 150 1.20.1440.210
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7308 10 150 1.20.1440.210
ID Description Score Start End GO Terms
AF-A0A4Q3QCN3-F1-model_v4 deleted 0.9938 74 156
AF-A0A0N1KXX8-F1-model_v4 deleted 0.98 1 157
AF-A0A6M7XXB4-F1-model_v4 DUF2269 domain-containing protein 0.9796 1 158 GO:0016020
AF-G6YJP6-F1-model_v4 DUF2269 domain-containing protein 0.9787 1 156 GO:0016020
AF-A0A0N0LEN1-F1-model_v4 deleted 0.9776 1 158

Map