F445114

General Info

Members Datasets Scaffolds Average Seq Length
443 347 886 253

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10137326|Ga0307411_101373261
Length 235
Sequence VPTDSPQYWEQFEIPYRPNLNVISCLMEIQKNPVNKAGERTTPPVWHMNCLEQVCGICTMIINGRARQSCSALVDKLEQPIKLEPMSKFPNVRDLVVDRSRMFDHLRRVHAWIELDGTHDLGPGPRMDQDDVQERYAYSRCMTCGCCLEACPQYEGDNYIGPQAIAQVRLFNMHPTGKMNREERLEGIMQEDGITNCGNAQNCVKACPMNIPLTRAIYEENRETVLHGLLGWLKG

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
54 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
55 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
66 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
67 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
68 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
80 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
84 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
119 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
134 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
135 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
138 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
139 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
140 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
141 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
142 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
143 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
144 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
145 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
146 2554235283 Bacillus safensis VK Isolate Rhizosphere
147 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
148 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
149 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
150 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
151 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
152 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
153 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
154 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
155 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
156 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
157 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
158 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
159 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
160 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
161 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
162 2643221729 Bacillus sp. Root11 Isolate Unclassified
163 2643221730 Bacillus sp. Root131 Isolate Unclassified
164 2643221731 Bacillus sp. Root147 Isolate Unclassified
165 2643221732 Bacillus sp. Root239 Isolate Unclassified
166 2643221735 Bacillus sp. Root920 Isolate Unclassified
167 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
168 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
169 2671180694 Paenibacillus sp. A3 Isolate Unclassified
170 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
171 2684622632 Bacillus cereus 905 Isolate Unclassified
172 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
173 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
174 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
175 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
176 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
177 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
178 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
179 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
180 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
181 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
182 2738541295 Bacillus sp. OK085 Isolate Unclassified
183 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
184 2738541358 Bacillus sp. OV752 Isolate Unclassified
185 2738543006 Bacillus sp. OK077 Isolate Unclassified
186 2738543010 Bacillus sp. YR335 Isolate Unclassified
187 2738543017 Bacillus sp. OV186 Isolate Unclassified
188 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
189 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
190 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
191 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
192 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
193 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
194 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
195 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
196 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
197 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
198 2811994870 Bacillus sp. JB4 Isolate Unclassified
199 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
200 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
201 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
202 2818991441 Niallia circulans 3243 Isolate Rhizosphere
203 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
204 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
205 2818991459 Paenibacillus sp. 597 Isolate Unclassified
206 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
207 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
208 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
209 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
210 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
211 2842682962 Bacillus sp. R-72492 Isolate Unclassified
212 2842882022 Bacillus sp. R-71893 Isolate Unclassified
213 2849139964 Bacillus sp. R-71875 Isolate Unclassified
214 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
215 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
216 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
217 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
218 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
219 2857472729 Cohnella sp. R-74144 Isolate Unclassified
220 2857581216 Bacillus sp. R-71922 Isolate Unclassified
221 2857586860 Bacillus sp. R-71935 Isolate Unclassified
222 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
223 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
224 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
225 2860837431 Bacillus sp. WR11 Isolate Unclassified
226 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
227 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
228 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
229 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
230 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
231 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
232 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
233 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
234 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
235 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
236 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
237 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
238 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
239 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
240 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
241 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
242 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
243 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
244 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
245 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
246 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
247 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
248 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
249 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
250 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
251 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
252 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
253 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
254 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
255 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
256 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
257 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
258 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
259 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
260 2919720352 Priestia megaterium 4340 Isolate Unclassified
261 2919726948 Bacillus pumilus 4489 Isolate Unclassified
262 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
263 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
264 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
265 2929004312 Priestia megaterium 1104 Isolate Unclassified
266 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
267 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
268 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
269 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
270 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
271 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
272 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
273 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
274 2938917290 Bacillus sp. CR71 Isolate Unclassified
275 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
276 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
277 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
278 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
279 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
280 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
281 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
282 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
283 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
284 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
285 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
286 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
287 2965761152 Bacillus sp. COPE52 Isolate Unclassified
288 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
289 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
290 2969141011 Bacillus velezensis MH25 Isolate Unclassified
291 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
292 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
293 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
294 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
295 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
296 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
297 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
298 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
299 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
300 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
301 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
302 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
303 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
304 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
305 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
306 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
307 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
308 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
309 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
310 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
311 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
312 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
313 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
314 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
315 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
316 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
317 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
318 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
319 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
320 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
321 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
322 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
323 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
324 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
325 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
326 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
327 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
328 8022653035 Bacillus sp. Rc4 Isolate Unclassified
329 8022792930 Bacillus sp. Xin Isolate Rhizosphere
330 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
331 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
332 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
333 8023438354 Bacillus sp. BH2 Isolate Unclassified
334 8023444577 Bacillus sp. BH32 Isolate Unclassified
335 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
336 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
337 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
338 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
339 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
340 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
341 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
342 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
343 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
344 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
345 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
346 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
347 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 43.12
Metatranscriptomes 8.58
Isolates 48.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 10.84
Nodule 0.45
Rhizoplane 5.87
Rhizosphere 50.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10137326 3300032005 Bacteria 1797
2 JGI25159J45721_1019791 3300002987 Bacteria 1315
3 JGI25151J46595_10000060 3300003187 Bacteria 146867
4 JGI25151J46595_10001026 3300003187 Bacteria 20940
5 JGI25151J46595_10043326 3300003187 Bacteria 1612
6 rootH2_10014760 3300003320 Bacteria 7144
7 rootL2_10017105 3300003322 Bacteria 7279
8 Ga0006562J51391_1001014 3300003578 Bacteria 6410
9 Ga0006562J51391_1001234 3300003578 Bacteria 59187
10 Ga0055538_1000228 3300003751 Bacteria 31405
11 Ga0055538_1001029 3300003751 Bacteria 6343
12 Ga0055538_1001093 3300003751 Bacteria 5900
13 Ga0055532_1000078 3300003758 Bacteria 121493
14 Ga0055532_1001872 3300003758 Bacteria 5105
15 Ga0055532_1004846 3300003758 Bacteria 1965
16 Ga0055535_1001524 3300003761 Bacteria 11415
17 Ga0055528_1002485 3300003790 Bacteria 9846
18 Ga0055541_1000493 3300003841 Bacteria 11107
19 Ga0055541_1001563 3300003841 Bacteria 4915
20 Ga0055541_1004923 3300003841 Bacteria 2380
21 Ga0070670_100091656 3300005331 Bacteria 2613
22 Ga0070682_100174120 3300005337 Bacteria 1498
23 Ga0070669_100349836 3300005353 Bacteria 1199
24 Ga0070671_100005950 3300005355 Bacteria 9717
25 Ga0070667_100571426 3300005367 Bacteria 1040
26 Ga0070681_10195312 3300005458 Bacteria 1943
27 Ga0070697_100116539 3300005536 Bacteria 2231
28 Ga0070672_100336183 3300005543 Bacteria 1285
29 Ga0070665_100487948 3300005548 Bacteria 1243
30 Ga0105251_10009717 3300009011 Bacteria 5653
31 Ga0105251_10010107 3300009011 Bacteria 5507
32 Ga0105244_10015259 3300009036 Bacteria 4409
33 Ga0105244_10052658 3300009036 Bacteria 2071
34 Ga0105250_10006661 3300009092 Bacteria 5027
35 Ga0105250_10019434 3300009092 Bacteria 2746
36 Ga0105245_10028735 3300009098 Bacteria 4907
37 Ga0105247_10064439 3300009101 Bacteria 2277
38 Ga0105243_10002172 3300009148 Bacteria 16573
39 Ga0105242_10009853 3300009176 Bacteria 7320
40 Ga0105246_10010276 3300011119 Bacteria 5783
41 Ga0157371_10008363 3300013102 Bacteria 8250
42 Ga0157374_10047875 3300013296 Bacteria 3965
43 Ga0157378_10027418 3300013297 Bacteria 5027
44 Ga0157372_10825978 3300013307 Bacteria 1076
45 Ga0157377_10011481 3300014745 Bacteria 4423
46 Ga0157376_10006835 3300014969 Bacteria 8079
47 Ga0209784_100092 3300025224 Bacteria 116472
48 Ga0209784_100154 3300025224 Bacteria 62380
49 Ga0209566_100130 3300025225 Bacteria 91966
50 Ga0209566_100363 3300025225 Bacteria 38102
51 Ga0209566_100585 3300025225 Bacteria 23257
52 Ga0209566_100589 3300025225 Bacteria 23056
53 Ga0209147_100050 3300025229 Bacteria 274639
54 Ga0209147_100114 3300025229 Bacteria 144205
55 Ga0209147_101693 3300025229 Bacteria 7196
56 Ga0209147_102726 3300025229 Bacteria 4031
57 Ga0209147_109143 3300025229 Bacteria 1193
58 Ga0209258_101681 3300025242 Bacteria 6983
59 Ga0209673_1001980 3300025273 Bacteria 15902
60 Ga0209130_1002394 3300025284 Bacteria 9489
61 Ga0209130_1005934 3300025284 Bacteria 4097
62 Ga0209130_1011773 3300025284 Bacteria 2324
63 Ga0209130_1013015 3300025284 Bacteria 2148
64 Ga0209675_1007536 3300025291 Bacteria 4155
65 Ga0209675_1026842 3300025291 Bacteria 1426
66 Ga0209676_1000439 3300025292 Bacteria 71078
67 Ga0209676_1015710 3300025292 Bacteria 2773
68 Ga0209025_1000001 3300025294 Bacteria 1888151
69 Ga0209025_1000488 3300025294 Bacteria 76500
70 Ga0209025_1005641 3300025294 Bacteria 10095
71 Ga0209025_1005857 3300025294 Bacteria 9828
72 Ga0209025_1005978 3300025294 Bacteria 9670
73 Ga0209025_1006581 3300025294 Bacteria 8956
74 Ga0209025_1014086 3300025294 Bacteria 4960
75 Ga0209025_1014217 3300025294 Bacteria 4923
76 Ga0209025_1020525 3300025294 Bacteria 3609
77 Ga0209025_1022730 3300025294 Bacteria 3311
78 Ga0209025_1062027 3300025294 Bacteria 1390
79 Ga0207426_1003050 3300025302 Bacteria 9666
80 Ga0207696_1002366 3300025711 Bacteria 9313
81 Ga0207696_1004385 3300025711 Bacteria 6097
82 Ga0207655_1009345 3300025728 Bacteria 6097
83 Ga0207655_1029303 3300025728 Bacteria 2579
84 Ga0207655_1034751 3300025728 Bacteria 2262
85 Ga0207655_1062465 3300025728 Bacteria 1432
86 Ga0207655_1090309 3300025728 Bacteria 1080
87 Ga0207713_1000242 3300025735 Bacteria 72255
88 Ga0207713_1034972 3300025735 Bacteria 2174
89 Ga0207681_10340931 3300025923 Bacteria 1197
90 Ga0207650_10067142 3300025925 Bacteria 2691
91 Ga0207644_10212528 3300025931 Bacteria 1530
92 Ga0207709_10002517 3300025935 Bacteria 11431
93 Ga0207691_10329433 3300025940 Bacteria 1308
94 Ga0209371_1001629 3300027312 Bacteria 14518
95 Ga0237817_10057 3300030083 Bacteria 38551
96 Ga0237817_10507 3300030083 Bacteria 5174
97 Ga0268256_1001574 3300030500 Bacteria 13379
98 Ga0307409_100080517 3300031995 Bacteria 2628
99 Ga0307409_100159628 3300031995 Bacteria 1970
100 Ga0307409_100184195 3300031995 Bacteria 1852
101 Ga0307416_100048924 3300032002 Bacteria 3358
102 Ga0307415_100168041 3300032126 Bacteria 1707
103 Ga0373933_0418196 3300035724 Bacteria 875
104 Ga0373925_0681107 3300037068 Bacteria 848
105 Ga0395899_0177918 3300037312 Bacteria 1495
106 Ga0395898_0032442 3300037466 Bacteria 5214
107 Ga0237819_00426 3300038705 Bacteria 14480
108 Ga0237819_01987 3300038705 Bacteria 4590
109 Ga0439436_0019821 3300041404 Bacteria 2005
110 Ga0451789_0620855 3300041443 Bacteria 1245
111 Ga0439433_0002018 3300041999 Bacteria 4263
112 Ga0439449_0001506 3300042007 Bacteria 9126
113 Ga0439449_0035896 3300042007 Bacteria 1844
114 Ga0439462_0036268 3300042015 Bacteria 1312
115 Ga0466961_0159078 3300044693 Bacteria 1408
116 Ga0466971_0099153 3300044719 Bacteria 1338
117 Ga0466968_0008064 3300044735 Bacteria 4026
118 Ga0466959_0006223 3300045049 Bacteria 8247
119 Ga0451576_0243462 3300045051 Bacteria 1879
120 Ga0466967_0000037 3300045976 Bacteria 49418
121 Ga0466967_0661275 3300045976 Bacteria 1034
122 Ga0495584_0149813 3300046491 Bacteria 1185
123 Ga0495585_0013268 3300046492 Bacteria 4826
124 Ga0495620_0127506 3300046515 Bacteria 1000
125 Ga0495631_0174694 3300046518 Bacteria 921
126 Ga0495637_0131370 3300046520 Bacteria 956
127 Ga0495661_0078540 3300046665 Bacteria 1909
128 Ga0495661_0160554 3300046665 Bacteria 1207
129 Ga0495661_0240555 3300046665 Bacteria 929
130 Ga0495660_0105450 3300046810 Bacteria 1445
131 Ga0495676_0137272 3300047321 Bacteria 1757
132 Ga0495683_0012859 3300047323 Bacteria 4389
133 Ga0495626_0022056 3300048091 Bacteria 3149
134 Ga0496100_0000867 3300048903 Bacteria 14426
135 Ga0496101_0000840 3300048904 Bacteria 18056
136 Ga0496102_0007393 3300048905 Bacteria 9383
137 Ga0496103_0003546 3300048906 Bacteria 9541
138 Ga0496103_0202637 3300048906 Bacteria 1276
139 Ga0496104_0005179 3300048907 Bacteria 11391
140 Ga0496104_0256131 3300048907 Bacteria 1663
141 Ga0496105_0000195 3300048908 Bacteria 40605
142 Ga0496106_0000703 3300048909 Bacteria 24074
143 Ga0496107_0000255 3300048910 Bacteria 28225
144 Ga0496108_0000342 3300048911 Bacteria 39326
145 Ga0496109_0005095 3300048912 Bacteria 10972
146 Ga0496109_0366381 3300048912 Bacteria 1361
147 Ga0496110_0000514 3300048913 Bacteria 26315
148 Ga0496110_0002514 3300048913 Bacteria 13776
149 Ga0496110_0134426 3300048913 Bacteria 2234
150 Ga0496111_0002050 3300048914 Bacteria 12004
151 Ga0496111_0012030 3300048914 Bacteria 5849
152 Ga0496112_0012647 3300048915 Bacteria 7759
153 Ga0496112_0123000 3300048915 Bacteria 2565
154 Ga0496113_0023320 3300048916 Bacteria 4388
155 Ga0496115_0359572 3300048918 Bacteria 1186
156 Ga0496116_0001953 3300048919 Bacteria 22221
157 Ga0496116_0012477 3300048919 Bacteria 6942
158 Ga0496116_0036682 3300048919 Bacteria 3427
159 Ga0496116_0038719 3300048919 Bacteria 3306
160 Ga0496116_0073105 3300048919 Bacteria 2163
161 Ga0496116_0116807 3300048919 Bacteria 1554
162 Ga0496116_0153882 3300048919 Bacteria 1273
163 Ga0496117_0182487 3300048920 Bacteria 1204
164 Ga0496118_0121387 3300048921 Bacteria 1702
165 Ga0496118_0145926 3300048921 Bacteria 1490
166 Ga0496119_0020066 3300048922 Bacteria 4889
167 Ga0496119_0047888 3300048922 Bacteria 2655
168 Ga0496120_0008592 3300048923 Bacteria 7384
169 Ga0496121_0395918 3300048924 Bacteria 906
170 Ga0496122_0007652 3300048925 Bacteria 11927
171 Ga0496122_0022554 3300048925 Bacteria 5590
172 Ga0496122_0050063 3300048925 Bacteria 3190
173 Ga0496122_0064214 3300048925 Bacteria 2673
174 Ga0496123_0003517 3300048926 Bacteria 17450
175 Ga0496123_0056389 3300048926 Bacteria 2568
176 Ga0496123_0149318 3300048926 Bacteria 1264
177 Ga0496124_0000998 3300048927 Bacteria 44860
178 Ga0496124_0065380 3300048927 Bacteria 3033
179 Ga0496124_0067793 3300048927 Bacteria 2968
180 Ga0496124_0315490 3300048927 Bacteria 1122
181 Ga0496124_0350061 3300048927 Bacteria 1045
182 Ga0496125_0000620 3300048928 Bacteria 59641
183 Ga0496125_0001530 3300048928 Bacteria 33186
184 Ga0496125_0024871 3300048928 Bacteria 5496
185 Ga0496125_0044448 3300048928 Bacteria 3756
186 Ga0496125_0344416 3300048928 Bacteria 893
187 Ga0496126_0031850 3300048929 Bacteria 4975
188 Ga0496126_0530477 3300048929 Bacteria 937
189 Ga0501306_002871 3300049127 Bacteria 1808
190 Ga0501306_017981 3300049127 Bacteria 963
191 Ga0501309_023429 3300049129 Bacteria 878
192 Ga0501341_00245 3300049131 Bacteria 2038
193 Ga0501343_000699 3300049132 Bacteria 2070
194 Ga0501343_000919 3300049132 Bacteria 1891
195 Ga0501344_00198 3300049133 Bacteria 2177
196 Ga0501344_00377 3300049133 Bacteria 1812
197 Ga0501345_00156 3300049134 Bacteria 1891
198 Ga0501305_001546 3300049161 Bacteria 2280
199 Ga0501305_013571 3300049161 Bacteria 1129
200 Ga0501299_000419 3300049522 Bacteria 5043
201 Ga0501312_000480 3300049528 Bacteria 3243
202 Ga0501312_002754 3300049528 Bacteria 1926
203 Ga0501313_005010 3300049529 Bacteria 1384
204 Ga0501313_013076 3300049529 Bacteria 972
205 Ga0501315_000808 3300049531 Bacteria 2379
206 Ga0501316_000044 3300049532 Bacteria 5279
207 Ga0501316_000157 3300049532 Bacteria 3739
208 Ga0501316_000645 3300049532 Bacteria 2557
209 Ga0501316_005957 3300049532 Bacteria 1282
210 Ga0501317_000273 3300049533 Bacteria 3299
211 Ga0501317_019689 3300049533 Bacteria 903
212 Ga0501317_023593 3300049533 Bacteria 850
213 Ga0501321_000439 3300049537 Bacteria 2655
214 Ga0501323_000329 3300049539 Bacteria 3316
215 Ga0501323_029663 3300049539 Bacteria 763
216 Ga0501324_000344 3300049540 Bacteria 2386
217 Ga0501330_000198 3300049546 Bacteria 2163
218 Ga0501330_000267 3300049546 Bacteria 2010
219 Ga0501331_00064 3300049547 Bacteria 3098
220 Ga0501332_00307 3300049548 Bacteria 2039
221 Ga0501335_000228 3300049551 Bacteria 3164
222 Ga0501335_000566 3300049551 Bacteria 2444
223 Ga0501335_015020 3300049551 Bacteria 787
224 Ga0501336_000074 3300049552 Bacteria 3430
225 Ga0501337_000278 3300049553 Bacteria 2338
226 Ga0501216_019714 3300049660 Bacteria 1172
227 Ga0501217_046655 3300049661 Bacteria 1120
228 Ga0501235_001210 3300049669 Bacteria 5431
229 nmdc:mga0rr50_22083_c1 3300050513 Bacteria 4360
230 2511176195 2510917027 Bacteria 5287437
231 2511700516 2511231119 Bacteria 4019861
232 2512638323 2512564013 Bacteria 6286191
233 2512730654 2512564039 Bacteria 8739048
234 2524187047 2524023129 Bacteria 6762600
235 2540607728 2540341094 Bacteria 4061186
236 2545557214 2545555800 Bacteria 4222588
237 2550903769 2548877040 Bacteria 7507281
238 2553395158 2551306519 Bacteria 5465154
239 2555467955 2554235283 Bacteria 3683090
240 2563928573 2563366752 Bacteria 4961801
241 2571529824 2571042143 Bacteria 6986194
242 2573040481 2571042588 Bacteria 5045676
243 2578338383 2576861424 Bacteria 5270569
244 2578931477 2576861599 Bacteria 4217202
245 2580930630 2579778775 Bacteria 5360914
246 2587742862 2585428059 Bacteria 8696589
247 2595089934 2593339131 Bacteria 5116855
248 2595319595 2593339198 Bacteria 7267884
249 2600400843 2600254943 Bacteria 2613887
250 2601640713 2600255286 Bacteria 5390125
251 2621276829 2619619294 Bacteria 5575484
252 2631985053 2630968484 Bacteria 3876276
253 2643740943 2643221543 Bacteria 6628015
254 2644428107 2643221676 Bacteria 8119172
255 2644706505 2643221729 Bacteria 6621700
256 2644713186 2643221730 Bacteria 6523787
257 2644715594 2643221731 Bacteria 5623886
258 2644726898 2643221732 Bacteria 5756404
259 2644741398 2643221735 Bacteria 3676263
260 2651532763 2648501850 Bacteria 3975476
261 2672337274 2671180330 Bacteria 5521719
262 2673818127 2671180694 Bacteria 7506943
263 2674418657 2671180844 Bacteria 4164150
264 2685152480 2684622632 Bacteria 5380049
265 2686997818 2684623153 Bacteria 3878815
266 2687499158 2687453109 Bacteria 3860091
267 2695628508 2695420354 Bacteria 3922431
268 2698320687 2695420987 Bacteria 6152737
269 2705996407 2703719227 Bacteria 5631989
270 2717915796 2716884898 Bacteria 3928789
271 2721507639 2718218445 Bacteria 5113413
272 2723605734 2721755693 Bacteria 6126117
273 2728532165 2728368933 Bacteria 7044283
274 2730136409 2728369359 Bacteria 5621728
275 2738814081 2738541295 Bacteria 5730091
276 2738838235 2738541299 Bacteria 4020721
277 2739157729 2738541358 Bacteria 5932299
278 2739209820 2738543006 Bacteria 5904091
279 2739229949 2738543010 Bacteria 5583595
280 2739233712 2738543010 Bacteria 5583595
281 2739270787 2738543017 Bacteria 4271950
282 2745167898 2744054657 Bacteria 5016802
283 2753810364 2751185905 Bacteria 6142767
284 2757568175 2757320391 Bacteria 4746095
285 2777764329 2775507177 Bacteria 4384303
286 2777839510 2775507192 Bacteria 4622234
287 2791214726 2788500588 Bacteria 4584915
288 2793185155 2791355222 Bacteria 5898266
289 2802438669 2802428803 Bacteria 5806948
290 2808869667 2808606364 Bacteria 4465927
291 2809056104 2808606399 Bacteria 4021018
292 2812317013 2811994870 Bacteria 3776934
293 2816862303 2816332186 Bacteria 5331395
294 2817481102 2816332295 Bacteria 4352468
295 2817617436 2816332336 Bacteria 5207640
296 2819568724 2818991441 Bacteria 5062707
297 2819581398 2818991443 Bacteria 6598732
298 2819627911 2818991451 Bacteria 4697364
299 2819674878 2818991459 Bacteria 8736032
300 2819709062 2818991465 Bacteria 5388835
301 2819724093 2818991468 Bacteria 3723169
302 2821117328 2821111986 Bacteria 6894338
303 2823528971 2823526263 Bacteria 3765752
304 2831906587 2831905167 Bacteria 3319172
305 2842684780 2842682962 Bacteria 5589973
306 2842884695 2842882022 Bacteria 6158489
307 2849142800 2849139964 Bacteria 5613304
308 2852675876 2852673933 Bacteria 3347676
309 2857362143 2857357740 Bacteria 9937880
310 2857457995 2857453340 Bacteria 8090534
311 2857462508 2857460504 Bacteria 5194327
312 2857466367 2857465823 Bacteria 6772595
313 2857476002 2857472729 Bacteria 6568124
314 2857585487 2857581216 Bacteria 5522813
315 2857590759 2857586860 Bacteria 4354574
316 2857593558 2857591370 Bacteria 6569758
317 2857606187 2857604169 Bacteria 5111450
318 2857607062 2857604169 Bacteria 5111450
319 2857610596 2857609550 Bacteria 3753890
320 2860840502 2860837431 Bacteria 4202080
321 2864735585 2864733723 Bacteria 6770668
322 2865001275 2864997549 Bacteria 5139696
323 2865005679 2865002811 Bacteria 6333767
324 2877771416 2877768649 Bacteria 3957164
325 2880172274 2880169592 Bacteria 3900066
326 2881640177 2881636855 Bacteria 5205297
327 2881648526 2881644220 Bacteria 5302661
328 2885533060 2885526491 Bacteria 7164189
329 2888580596 2888578766 Bacteria 6743310
330 2889047596 2889042446 Bacteria 7618936
331 2889050751 2889049205 Bacteria 7524325
332 2889276246 2889276214 Bacteria 5979355
333 2889300516 2889295896 Bacteria 4704906
334 2897112549 2897109615 Bacteria 4009619
335 2898909319 2898907183 Bacteria 4067722
336 2904118933 2904113452 Bacteria 7796941
337 2904162453 2904162308 Bacteria 7086713
338 2904495613 2904490793 Bacteria 7046938
339 2904524275 2904524088 Bacteria 5887454
340 2904564470 2904560550 Bacteria 4029838
341 2904598966 2904595352 Bacteria 6124848
342 2904609513 2904606771 Bacteria 4684500
343 2904759357 2904755435 Bacteria 7986759
344 2907207568 2907202186 Bacteria 6632024
345 2908667816 2908665501 Bacteria 3678115
346 2915600254 2915597211 Bacteria 6475886
347 2915609841 2915606848 Bacteria 6032732
348 2916974985 2916971899 Bacteria 4250608
349 2919095611 2919093281 Bacteria 3660974
350 2919147148 2919143609 Bacteria 6219228
351 2919164500 2919160200 Bacteria 6929020
352 2919417690 2919414237 Bacteria 5429133
353 2919428579 2919425241 Bacteria 8055701
354 2919519052 2919517244 Bacteria 5858162
355 2919723420 2919720352 Bacteria 5986006
356 2919728682 2919726948 Bacteria 3696050
357 2925328822 2925326138 Bacteria 9652120
358 2928096054 2928093941 Bacteria 5965005
359 2928514300 2928510474 Bacteria 4815308
360 2929006575 2929004312 Bacteria 5678476
361 2929185437 2929183550 Bacteria 6377511
362 2929211096 2929206907 Bacteria 5918291
363 2929238183 2929233124 Bacteria 5948380
364 2929297934 2929297113 Bacteria 3141306
365 2931384646 2931384279 Bacteria 7299545
366 2936340711 2936340661 Bacteria 5139038
367 2936362041 2936361878 Bacteria 5632809
368 2938652890 2938649242 Bacteria 7118381
369 2938922375 2938917290 Bacteria 5914775
370 2939595246 2939593269 Bacteria 4798695
371 2939683930 2939679117 Bacteria 6921672
372 2939704255 2939702853 Bacteria 5139229
373 2945996697 2945991243 Bacteria 7008369
374 2946059387 2946053406 Bacteria 6978655
375 2947431267 2947426588 Bacteria 5357194
376 2954773483 2954773129 Bacteria 3741715
377 2956897622 2956897341 Bacteria 5447711
378 2960319672 2960319331 Bacteria 5502575
379 2960381116 2960375949 Bacteria 5361395
380 2962293708 2962290636 Bacteria 4072939
381 2964379269 2964375228 Bacteria 4909004
382 2965765988 2965761152 Bacteria 5806513
383 2968563640 2968558590 Bacteria 6956864
384 2969139707 2969136845 Bacteria 3923176
385 2969143865 2969141011 Bacteria 4118468
386 2969767748 2969765954 Bacteria 4216713
387 2969772889 2969770375 Bacteria 4271280
388 2971408814 2971403814 Bacteria 7370929
389 2971413505 2971410472 Bacteria 8311090
390 2971516017 2971511577 Bacteria 5404012
391 2971896076 2971893375 Bacteria 3929648
392 2977256373 2977254563 Bacteria 4828420
393 2979088169 2979083700 Bacteria 5894929
394 2980126835 2980125574 Bacteria 5567337
395 2980177771 2980176882 Bacteria 5397533
396 2980183294 2980182181 Bacteria 9454109
397 2980185922 2980182181 Bacteria 9454109
398 2980495494 2980492589 Bacteria 4072961
399 2981287569 2981284811 Bacteria 4641497
400 2981292764 2981289755 Bacteria 4641509
401 2981983022 2981980479 Bacteria 4641628
402 2981987932 2981985349 Bacteria 4641497
403 2984530865 2984527788 Bacteria 5288478
404 2984536973 2984532647 Bacteria 5288506
405 2988225982 2988225383 Bacteria 7221625
406 2990277253 2990275345 Bacteria 4887158
407 2996634216 2996632988 Bacteria 6921523
408 2996711584 2996706504 Bacteria 5757485
409 3001268623 3001267043 Bacteria 4823521
410 3001274103 3001272096 Bacteria 4729684
411 3001897561 3001892409 Bacteria 6328293
412 3006828411 3006826541 Bacteria 4678913
413 3006861516 3006858327 Bacteria 4317835
414 3006882326 3006879489 Bacteria 4064221
415 3006971971 3006969106 Bacteria 4739423
416 3006976146 3006973921 Bacteria 4423788
417 3006982073 3006978542 Bacteria 5328100
418 3006984324 3006984091 Bacteria 4207523
419 3006988739 3006988479 Bacteria 4767936
420 648171779 648028048 Bacteria 5394884
421 8002321402 8002317523 Bacteria 8051857
422 8022624425 8022621104 Bacteria 5241040
423 8022632148 8022630665 Bacteria 3886130
424 8022654670 8022653035 Bacteria 4035078
425 8022797100 8022792930 Bacteria 5693794
426 8022898375 8022893055 Bacteria 5300455
427 8022917549 8022914991 Bacteria 5584517
428 8022950059 8022948649 Bacteria 5366783
429 8023443802 8023438354 Bacteria 5779374
430 8023445379 8023444577 Bacteria 5661597
431 8046995636 8046991243 Bacteria 8497463
432 8051954948 8051952484 Bacteria 3926774
433 8052176334 8052174270 Bacteria 3881265
434 8054470700 8054465665 Bacteria 7323556
435 8054797995 8054795415 Bacteria 9785225
436 8055535794 8055531788 Bacteria 5249694
437 8055633427 8055632911 Bacteria 5283357
438 8056535747 8056533031 Bacteria 8964429
439 8057477354 8057473075 Bacteria 5892720
440 8057586931 8057582654 Bacteria 5218944
441 8057635676 8057632132 Bacteria 4726859
442 8057737139 8057733483 Bacteria 6578323
443 8057980962 8057977335 Bacteria 5694872
444 Ga0307411_10137326
445 JGI25159J45721_1019791
446 JGI25151J46595_10000060
447 JGI25151J46595_10001026
448 JGI25151J46595_10043326
449 rootH2_10014760
450 rootL2_10017105
451 Ga0006562J51391_1001014
452 Ga0006562J51391_1001234
453 Ga0055538_1000228
454 Ga0055538_1001029
455 Ga0055538_1001093
456 Ga0055532_1000078
457 Ga0055532_1001872
458 Ga0055532_1004846
459 Ga0055535_1001524
460 Ga0055528_1002485
461 Ga0055541_1000493
462 Ga0055541_1001563
463 Ga0055541_1004923
464 Ga0070670_100091656
465 Ga0070682_100174120
466 Ga0070669_100349836
467 Ga0070671_100005950
468 Ga0070667_100571426
469 Ga0070681_10195312
470 Ga0070697_100116539
471 Ga0070672_100336183
472 Ga0070665_100487948
473 Ga0105251_10009717
474 Ga0105251_10010107
475 Ga0105244_10015259
476 Ga0105244_10052658
477 Ga0105250_10006661
478 Ga0105250_10019434
479 Ga0105245_10028735
480 Ga0105247_10064439
481 Ga0105243_10002172
482 Ga0105242_10009853
483 Ga0105246_10010276
484 Ga0157371_10008363
485 Ga0157374_10047875
486 Ga0157378_10027418
487 Ga0157372_10825978
488 Ga0157377_10011481
489 Ga0157376_10006835
490 Ga0209784_100092
491 Ga0209784_100154
492 Ga0209566_100130
493 Ga0209566_100363
494 Ga0209566_100585
495 Ga0209566_100589
496 Ga0209147_100050
497 Ga0209147_100114
498 Ga0209147_101693
499 Ga0209147_102726
500 Ga0209147_109143
501 Ga0209258_101681
502 Ga0209673_1001980
503 Ga0209130_1002394
504 Ga0209130_1005934
505 Ga0209130_1011773
506 Ga0209130_1013015
507 Ga0209675_1007536
508 Ga0209675_1026842
509 Ga0209676_1000439
510 Ga0209676_1015710
511 Ga0209025_1000001
512 Ga0209025_1000488
513 Ga0209025_1005641
514 Ga0209025_1005857
515 Ga0209025_1005978
516 Ga0209025_1006581
517 Ga0209025_1014086
518 Ga0209025_1014217
519 Ga0209025_1020525
520 Ga0209025_1022730
521 Ga0209025_1062027
522 Ga0207426_1003050
523 Ga0207696_1002366
524 Ga0207696_1004385
525 Ga0207655_1009345
526 Ga0207655_1029303
527 Ga0207655_1034751
528 Ga0207655_1062465
529 Ga0207655_1090309
530 Ga0207713_1000242
531 Ga0207713_1034972
532 Ga0207681_10340931
533 Ga0207650_10067142
534 Ga0207644_10212528
535 Ga0207709_10002517
536 Ga0207691_10329433
537 Ga0209371_1001629
538 Ga0237817_10057
539 Ga0237817_10507
540 Ga0268256_1001574
541 Ga0307409_100080517
542 Ga0307409_100159628
543 Ga0307409_100184195
544 Ga0307416_100048924
545 Ga0307415_100168041
546 Ga0373933_0418196
547 Ga0373925_0681107
548 Ga0395899_0177918
549 Ga0395898_0032442
550 Ga0237819_00426
551 Ga0237819_01987
552 Ga0439436_0019821
553 Ga0451789_0620855
554 Ga0439433_0002018
555 Ga0439449_0001506
556 Ga0439449_0035896
557 Ga0439462_0036268
558 Ga0466961_0159078
559 Ga0466971_0099153
560 Ga0466968_0008064
561 Ga0466959_0006223
562 Ga0451576_0243462
563 Ga0466967_0000037
564 Ga0466967_0661275
565 Ga0495584_0149813
566 Ga0495585_0013268
567 Ga0495620_0127506
568 Ga0495631_0174694
569 Ga0495637_0131370
570 Ga0495661_0078540
571 Ga0495661_0160554
572 Ga0495661_0240555
573 Ga0495660_0105450
574 Ga0495676_0137272
575 Ga0495683_0012859
576 Ga0495626_0022056
577 Ga0496100_0000867
578 Ga0496101_0000840
579 Ga0496102_0007393
580 Ga0496103_0003546
581 Ga0496103_0202637
582 Ga0496104_0005179
583 Ga0496104_0256131
584 Ga0496105_0000195
585 Ga0496106_0000703
586 Ga0496107_0000255
587 Ga0496108_0000342
588 Ga0496109_0005095
589 Ga0496109_0366381
590 Ga0496110_0000514
591 Ga0496110_0002514
592 Ga0496110_0134426
593 Ga0496111_0002050
594 Ga0496111_0012030
595 Ga0496112_0012647
596 Ga0496112_0123000
597 Ga0496113_0023320
598 Ga0496115_0359572
599 Ga0496116_0001953
600 Ga0496116_0012477
601 Ga0496116_0036682
602 Ga0496116_0038719
603 Ga0496116_0073105
604 Ga0496116_0116807
605 Ga0496116_0153882
606 Ga0496117_0182487
607 Ga0496118_0121387
608 Ga0496118_0145926
609 Ga0496119_0020066
610 Ga0496119_0047888
611 Ga0496120_0008592
612 Ga0496121_0395918
613 Ga0496122_0007652
614 Ga0496122_0022554
615 Ga0496122_0050063
616 Ga0496122_0064214
617 Ga0496123_0003517
618 Ga0496123_0056389
619 Ga0496123_0149318
620 Ga0496124_0000998
621 Ga0496124_0065380
622 Ga0496124_0067793
623 Ga0496124_0315490
624 Ga0496124_0350061
625 Ga0496125_0000620
626 Ga0496125_0001530
627 Ga0496125_0024871
628 Ga0496125_0044448
629 Ga0496125_0344416
630 Ga0496126_0031850
631 Ga0496126_0530477
632 Ga0501306_002871
633 Ga0501306_017981
634 Ga0501309_023429
635 Ga0501341_00245
636 Ga0501343_000699
637 Ga0501343_000919
638 Ga0501344_00198
639 Ga0501344_00377
640 Ga0501345_00156
641 Ga0501305_001546
642 Ga0501305_013571
643 Ga0501299_000419
644 Ga0501312_000480
645 Ga0501312_002754
646 Ga0501313_005010
647 Ga0501313_013076
648 Ga0501315_000808
649 Ga0501316_000044
650 Ga0501316_000157
651 Ga0501316_000645
652 Ga0501316_005957
653 Ga0501317_000273
654 Ga0501317_019689
655 Ga0501317_023593
656 Ga0501321_000439
657 Ga0501323_000329
658 Ga0501323_029663
659 Ga0501324_000344
660 Ga0501330_000198
661 Ga0501330_000267
662 Ga0501331_00064
663 Ga0501332_00307
664 Ga0501335_000228
665 Ga0501335_000566
666 Ga0501335_015020
667 Ga0501336_000074
668 Ga0501337_000278
669 Ga0501216_019714
670 Ga0501217_046655
671 Ga0501235_001210
672 nmdc:mga0rr50_22083_c1
673 2511176195
674 2511700516
675 2512638323
676 2512730654
677 2524187047
678 2540607728
679 2545557214
680 2550903769
681 2553395158
682 2555467955
683 2563928573
684 2571529824
685 2573040481
686 2578338383
687 2578931477
688 2580930630
689 2587742862
690 2595089934
691 2595319595
692 2600400843
693 2601640713
694 2621276829
695 2631985053
696 2643740943
697 2644428107
698 2644706505
699 2644713186
700 2644715594
701 2644726898
702 2644741398
703 2651532763
704 2672337274
705 2673818127
706 2674418657
707 2685152480
708 2686997818
709 2687499158
710 2695628508
711 2698320687
712 2705996407
713 2717915796
714 2721507639
715 2723605734
716 2728532165
717 2730136409
718 2738814081
719 2738838235
720 2739157729
721 2739209820
722 2739229949
723 2739233712
724 2739270787
725 2745167898
726 2753810364
727 2757568175
728 2777764329
729 2777839510
730 2791214726
731 2793185155
732 2802438669
733 2808869667
734 2809056104
735 2812317013
736 2816862303
737 2817481102
738 2817617436
739 2819568724
740 2819581398
741 2819627911
742 2819674878
743 2819709062
744 2819724093
745 2821117328
746 2823528971
747 2831906587
748 2842684780
749 2842884695
750 2849142800
751 2852675876
752 2857362143
753 2857457995
754 2857462508
755 2857466367
756 2857476002
757 2857585487
758 2857590759
759 2857593558
760 2857606187
761 2857607062
762 2857610596
763 2860840502
764 2864735585
765 2865001275
766 2865005679
767 2877771416
768 2880172274
769 2881640177
770 2881648526
771 2885533060
772 2888580596
773 2889047596
774 2889050751
775 2889276246
776 2889300516
777 2897112549
778 2898909319
779 2904118933
780 2904162453
781 2904495613
782 2904524275
783 2904564470
784 2904598966
785 2904609513
786 2904759357
787 2907207568
788 2908667816
789 2915600254
790 2915609841
791 2916974985
792 2919095611
793 2919147148
794 2919164500
795 2919417690
796 2919428579
797 2919519052
798 2919723420
799 2919728682
800 2925328822
801 2928096054
802 2928514300
803 2929006575
804 2929185437
805 2929211096
806 2929238183
807 2929297934
808 2931384646
809 2936340711
810 2936362041
811 2938652890
812 2938922375
813 2939595246
814 2939683930
815 2939704255
816 2945996697
817 2946059387
818 2947431267
819 2954773483
820 2956897622
821 2960319672
822 2960381116
823 2962293708
824 2964379269
825 2965765988
826 2968563640
827 2969139707
828 2969143865
829 2969767748
830 2969772889
831 2971408814
832 2971413505
833 2971516017
834 2971896076
835 2977256373
836 2979088169
837 2980126835
838 2980177771
839 2980183294
840 2980185922
841 2980495494
842 2981287569
843 2981292764
844 2981983022
845 2981987932
846 2984530865
847 2984536973
848 2988225982
849 2990277253
850 2996634216
851 2996711584
852 3001268623
853 3001274103
854 3001897561
855 3006828411
856 3006861516
857 3006882326
858 3006971971
859 3006976146
860 3006982073
861 3006984324
862 3006988739
863 648171779
864 8002321402
865 8022624425
866 8022632148
867 8022654670
868 8022797100
869 8022898375
870 8022917549
871 8022950059
872 8023443802
873 8023445379
874 8046995636
875 8051954948
876 8052176334
877 8054470700
878 8054797995
879 8055535794
880 8055633427
881 8056535747
882 8057477354
883 8057586931
884 8057635676
885 8057737139
886 8057980962

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

1

104

0.94

PF13534

Fer4_17

4Fe-4S dicluster domain

140

212

0.84

PF13183

Fer4_8

4Fe-4S dicluster domain

137

211

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bs3-assembly1.cif.gz_B glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes 0.8315 3 239
8gs8-assembly1.cif.gz_B cryo-em structure of the human respiratory complex ii 0.8299 1 240
5xmj-assembly2.cif.gz_F crystal structure of quinol:fumarate reductase from desulfovibrio gigas 0.8271 3 240
2acz-assembly1.cif.gz_B complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.8237 4 241
8gs8-assembly1.cif.gz_B cryo-em structure of the human respiratory complex ii 0.8236 1 240
ID Description Score Start End Superfamily
af_Q2FZC7_12_128_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9404 1 111 3.10.20.30
af_Q2FZC7_130_266_1.10.1060.10 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.9114 114 247 1.10.1060.10
af_Q2FZC7_130_266_1.10.1060.10 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.8859 114 247 1.10.1060.10
af_Q2FZC7_12_128_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8851 1 111 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8763 5 111 3.10.20.30
ID Description Score Start End GO Terms
AF-V9GF84-F1-model_v4 Succinate dehydrogenase iron-sulfur protein 0.992 155 248 GO:0009060
GO:0022904
GO:0051536
AF-A0A846KTL4-F1-model_v4 Succinate dehydrogenase iron-sulfur subunit 0.9805 163 249 GO:0051536
AF-V9GF84-F1-model_v4 Succinate dehydrogenase iron-sulfur protein 0.9715 155 248 GO:0009060
GO:0022904
GO:0051536
AF-A0A382NSU5-F1-model_v4 Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein 0.9624 3 110 GO:0009055
GO:0009060
GO:0022904
GO:0051536
AF-A0A382NSU5-F1-model_v4 Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein 0.945 3 110 GO:0009055
GO:0009060
GO:0022904
GO:0051536

Map