F445114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 443 | 347 | 886 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300032005|Ga0307411_10137326|Ga0307411_101373261 |
| Length | 235 |
| Sequence | VPTDSPQYWEQFEIPYRPNLNVISCLMEIQKNPVNKAGERTTPPVWHMNCLEQVCGICTMIINGRARQSCSALVDKLEQPIKLEPMSKFPNVRDLVVDRSRMFDHLRRVHAWIELDGTHDLGPGPRMDQDDVQERYAYSRCMTCGCCLEACPQYEGDNYIGPQAIAQVRLFNMHPTGKMNREERLEGIMQEDGITNCGNAQNCVKACPMNIPLTRAIYEENRETVLHGLLGWLKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 42 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 55 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 56 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 57 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 58 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 59 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 60 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 61 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 62 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 63 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 64 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 65 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 66 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 67 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 68 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 69 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 70 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 71 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 72 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 73 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 74 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 75 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 86 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 87 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 88 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 89 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 90 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 91 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 92 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 93 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 96 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 97 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 98 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 99 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 100 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 101 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 102 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 103 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 104 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 105 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 106 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 107 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 108 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 109 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 110 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 111 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 119 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 134 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 135 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 136 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 137 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 138 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 139 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 140 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 141 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 142 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 143 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 144 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 145 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 146 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 147 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 148 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 149 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 150 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 151 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 152 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 153 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 154 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 155 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 156 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 157 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 158 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 159 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 160 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 161 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 162 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 163 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 164 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 165 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 166 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 167 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 168 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 169 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 170 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 171 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 172 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 173 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 174 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 175 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 176 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 177 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 178 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 179 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 180 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 181 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 182 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 183 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 184 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 185 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 186 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 187 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 188 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 189 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 190 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 191 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 192 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 193 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 194 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 195 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 196 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 197 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 198 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 199 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 200 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 201 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 202 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 203 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 204 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 205 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 206 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 207 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 208 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 209 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 210 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 211 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 212 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 213 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 214 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 215 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 216 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 217 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 218 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 219 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 220 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 221 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 222 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 223 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 224 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 225 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 226 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 227 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 228 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 229 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 230 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 231 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 232 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 233 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 234 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 235 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 236 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 237 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 238 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 239 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 240 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 241 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 242 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 243 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 244 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 245 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 246 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 247 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 248 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 249 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 250 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 251 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 252 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 253 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 254 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 255 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 256 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 257 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 258 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 259 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 260 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 261 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 262 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 263 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 264 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 265 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 266 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 267 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 268 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 269 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 270 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 271 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 272 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 273 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 274 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 275 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 276 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 277 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 278 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 279 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 280 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 281 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 282 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 283 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 284 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 285 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 286 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 287 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 288 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 289 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 290 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 291 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 292 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 293 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 294 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 295 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 296 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 297 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 298 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 299 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 300 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 301 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 302 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 303 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 304 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 305 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 306 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 307 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 308 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 309 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 310 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 311 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 312 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 313 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 314 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 315 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 316 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 317 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 318 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 319 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 320 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 321 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 322 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 323 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 324 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 325 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 326 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 327 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 328 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 329 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 330 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 331 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 332 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 333 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 334 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 335 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 336 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 337 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 338 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 339 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 340 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 341 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 342 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 343 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 344 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 345 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 346 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 347 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 43.12 |
| Metatranscriptomes | 8.58 |
| Isolates | 48.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.45 |
| Bulb | 0 |
| Endosphere | 10.84 |
| Nodule | 0.45 |
| Rhizoplane | 5.87 |
| Rhizosphere | 50.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307411_10137326 | 3300032005 | Bacteria | 1797 |
| 2 | JGI25159J45721_1019791 | 3300002987 | Bacteria | 1315 |
| 3 | JGI25151J46595_10000060 | 3300003187 | Bacteria | 146867 |
| 4 | JGI25151J46595_10001026 | 3300003187 | Bacteria | 20940 |
| 5 | JGI25151J46595_10043326 | 3300003187 | Bacteria | 1612 |
| 6 | rootH2_10014760 | 3300003320 | Bacteria | 7144 |
| 7 | rootL2_10017105 | 3300003322 | Bacteria | 7279 |
| 8 | Ga0006562J51391_1001014 | 3300003578 | Bacteria | 6410 |
| 9 | Ga0006562J51391_1001234 | 3300003578 | Bacteria | 59187 |
| 10 | Ga0055538_1000228 | 3300003751 | Bacteria | 31405 |
| 11 | Ga0055538_1001029 | 3300003751 | Bacteria | 6343 |
| 12 | Ga0055538_1001093 | 3300003751 | Bacteria | 5900 |
| 13 | Ga0055532_1000078 | 3300003758 | Bacteria | 121493 |
| 14 | Ga0055532_1001872 | 3300003758 | Bacteria | 5105 |
| 15 | Ga0055532_1004846 | 3300003758 | Bacteria | 1965 |
| 16 | Ga0055535_1001524 | 3300003761 | Bacteria | 11415 |
| 17 | Ga0055528_1002485 | 3300003790 | Bacteria | 9846 |
| 18 | Ga0055541_1000493 | 3300003841 | Bacteria | 11107 |
| 19 | Ga0055541_1001563 | 3300003841 | Bacteria | 4915 |
| 20 | Ga0055541_1004923 | 3300003841 | Bacteria | 2380 |
| 21 | Ga0070670_100091656 | 3300005331 | Bacteria | 2613 |
| 22 | Ga0070682_100174120 | 3300005337 | Bacteria | 1498 |
| 23 | Ga0070669_100349836 | 3300005353 | Bacteria | 1199 |
| 24 | Ga0070671_100005950 | 3300005355 | Bacteria | 9717 |
| 25 | Ga0070667_100571426 | 3300005367 | Bacteria | 1040 |
| 26 | Ga0070681_10195312 | 3300005458 | Bacteria | 1943 |
| 27 | Ga0070697_100116539 | 3300005536 | Bacteria | 2231 |
| 28 | Ga0070672_100336183 | 3300005543 | Bacteria | 1285 |
| 29 | Ga0070665_100487948 | 3300005548 | Bacteria | 1243 |
| 30 | Ga0105251_10009717 | 3300009011 | Bacteria | 5653 |
| 31 | Ga0105251_10010107 | 3300009011 | Bacteria | 5507 |
| 32 | Ga0105244_10015259 | 3300009036 | Bacteria | 4409 |
| 33 | Ga0105244_10052658 | 3300009036 | Bacteria | 2071 |
| 34 | Ga0105250_10006661 | 3300009092 | Bacteria | 5027 |
| 35 | Ga0105250_10019434 | 3300009092 | Bacteria | 2746 |
| 36 | Ga0105245_10028735 | 3300009098 | Bacteria | 4907 |
| 37 | Ga0105247_10064439 | 3300009101 | Bacteria | 2277 |
| 38 | Ga0105243_10002172 | 3300009148 | Bacteria | 16573 |
| 39 | Ga0105242_10009853 | 3300009176 | Bacteria | 7320 |
| 40 | Ga0105246_10010276 | 3300011119 | Bacteria | 5783 |
| 41 | Ga0157371_10008363 | 3300013102 | Bacteria | 8250 |
| 42 | Ga0157374_10047875 | 3300013296 | Bacteria | 3965 |
| 43 | Ga0157378_10027418 | 3300013297 | Bacteria | 5027 |
| 44 | Ga0157372_10825978 | 3300013307 | Bacteria | 1076 |
| 45 | Ga0157377_10011481 | 3300014745 | Bacteria | 4423 |
| 46 | Ga0157376_10006835 | 3300014969 | Bacteria | 8079 |
| 47 | Ga0209784_100092 | 3300025224 | Bacteria | 116472 |
| 48 | Ga0209784_100154 | 3300025224 | Bacteria | 62380 |
| 49 | Ga0209566_100130 | 3300025225 | Bacteria | 91966 |
| 50 | Ga0209566_100363 | 3300025225 | Bacteria | 38102 |
| 51 | Ga0209566_100585 | 3300025225 | Bacteria | 23257 |
| 52 | Ga0209566_100589 | 3300025225 | Bacteria | 23056 |
| 53 | Ga0209147_100050 | 3300025229 | Bacteria | 274639 |
| 54 | Ga0209147_100114 | 3300025229 | Bacteria | 144205 |
| 55 | Ga0209147_101693 | 3300025229 | Bacteria | 7196 |
| 56 | Ga0209147_102726 | 3300025229 | Bacteria | 4031 |
| 57 | Ga0209147_109143 | 3300025229 | Bacteria | 1193 |
| 58 | Ga0209258_101681 | 3300025242 | Bacteria | 6983 |
| 59 | Ga0209673_1001980 | 3300025273 | Bacteria | 15902 |
| 60 | Ga0209130_1002394 | 3300025284 | Bacteria | 9489 |
| 61 | Ga0209130_1005934 | 3300025284 | Bacteria | 4097 |
| 62 | Ga0209130_1011773 | 3300025284 | Bacteria | 2324 |
| 63 | Ga0209130_1013015 | 3300025284 | Bacteria | 2148 |
| 64 | Ga0209675_1007536 | 3300025291 | Bacteria | 4155 |
| 65 | Ga0209675_1026842 | 3300025291 | Bacteria | 1426 |
| 66 | Ga0209676_1000439 | 3300025292 | Bacteria | 71078 |
| 67 | Ga0209676_1015710 | 3300025292 | Bacteria | 2773 |
| 68 | Ga0209025_1000001 | 3300025294 | Bacteria | 1888151 |
| 69 | Ga0209025_1000488 | 3300025294 | Bacteria | 76500 |
| 70 | Ga0209025_1005641 | 3300025294 | Bacteria | 10095 |
| 71 | Ga0209025_1005857 | 3300025294 | Bacteria | 9828 |
| 72 | Ga0209025_1005978 | 3300025294 | Bacteria | 9670 |
| 73 | Ga0209025_1006581 | 3300025294 | Bacteria | 8956 |
| 74 | Ga0209025_1014086 | 3300025294 | Bacteria | 4960 |
| 75 | Ga0209025_1014217 | 3300025294 | Bacteria | 4923 |
| 76 | Ga0209025_1020525 | 3300025294 | Bacteria | 3609 |
| 77 | Ga0209025_1022730 | 3300025294 | Bacteria | 3311 |
| 78 | Ga0209025_1062027 | 3300025294 | Bacteria | 1390 |
| 79 | Ga0207426_1003050 | 3300025302 | Bacteria | 9666 |
| 80 | Ga0207696_1002366 | 3300025711 | Bacteria | 9313 |
| 81 | Ga0207696_1004385 | 3300025711 | Bacteria | 6097 |
| 82 | Ga0207655_1009345 | 3300025728 | Bacteria | 6097 |
| 83 | Ga0207655_1029303 | 3300025728 | Bacteria | 2579 |
| 84 | Ga0207655_1034751 | 3300025728 | Bacteria | 2262 |
| 85 | Ga0207655_1062465 | 3300025728 | Bacteria | 1432 |
| 86 | Ga0207655_1090309 | 3300025728 | Bacteria | 1080 |
| 87 | Ga0207713_1000242 | 3300025735 | Bacteria | 72255 |
| 88 | Ga0207713_1034972 | 3300025735 | Bacteria | 2174 |
| 89 | Ga0207681_10340931 | 3300025923 | Bacteria | 1197 |
| 90 | Ga0207650_10067142 | 3300025925 | Bacteria | 2691 |
| 91 | Ga0207644_10212528 | 3300025931 | Bacteria | 1530 |
| 92 | Ga0207709_10002517 | 3300025935 | Bacteria | 11431 |
| 93 | Ga0207691_10329433 | 3300025940 | Bacteria | 1308 |
| 94 | Ga0209371_1001629 | 3300027312 | Bacteria | 14518 |
| 95 | Ga0237817_10057 | 3300030083 | Bacteria | 38551 |
| 96 | Ga0237817_10507 | 3300030083 | Bacteria | 5174 |
| 97 | Ga0268256_1001574 | 3300030500 | Bacteria | 13379 |
| 98 | Ga0307409_100080517 | 3300031995 | Bacteria | 2628 |
| 99 | Ga0307409_100159628 | 3300031995 | Bacteria | 1970 |
| 100 | Ga0307409_100184195 | 3300031995 | Bacteria | 1852 |
| 101 | Ga0307416_100048924 | 3300032002 | Bacteria | 3358 |
| 102 | Ga0307415_100168041 | 3300032126 | Bacteria | 1707 |
| 103 | Ga0373933_0418196 | 3300035724 | Bacteria | 875 |
| 104 | Ga0373925_0681107 | 3300037068 | Bacteria | 848 |
| 105 | Ga0395899_0177918 | 3300037312 | Bacteria | 1495 |
| 106 | Ga0395898_0032442 | 3300037466 | Bacteria | 5214 |
| 107 | Ga0237819_00426 | 3300038705 | Bacteria | 14480 |
| 108 | Ga0237819_01987 | 3300038705 | Bacteria | 4590 |
| 109 | Ga0439436_0019821 | 3300041404 | Bacteria | 2005 |
| 110 | Ga0451789_0620855 | 3300041443 | Bacteria | 1245 |
| 111 | Ga0439433_0002018 | 3300041999 | Bacteria | 4263 |
| 112 | Ga0439449_0001506 | 3300042007 | Bacteria | 9126 |
| 113 | Ga0439449_0035896 | 3300042007 | Bacteria | 1844 |
| 114 | Ga0439462_0036268 | 3300042015 | Bacteria | 1312 |
| 115 | Ga0466961_0159078 | 3300044693 | Bacteria | 1408 |
| 116 | Ga0466971_0099153 | 3300044719 | Bacteria | 1338 |
| 117 | Ga0466968_0008064 | 3300044735 | Bacteria | 4026 |
| 118 | Ga0466959_0006223 | 3300045049 | Bacteria | 8247 |
| 119 | Ga0451576_0243462 | 3300045051 | Bacteria | 1879 |
| 120 | Ga0466967_0000037 | 3300045976 | Bacteria | 49418 |
| 121 | Ga0466967_0661275 | 3300045976 | Bacteria | 1034 |
| 122 | Ga0495584_0149813 | 3300046491 | Bacteria | 1185 |
| 123 | Ga0495585_0013268 | 3300046492 | Bacteria | 4826 |
| 124 | Ga0495620_0127506 | 3300046515 | Bacteria | 1000 |
| 125 | Ga0495631_0174694 | 3300046518 | Bacteria | 921 |
| 126 | Ga0495637_0131370 | 3300046520 | Bacteria | 956 |
| 127 | Ga0495661_0078540 | 3300046665 | Bacteria | 1909 |
| 128 | Ga0495661_0160554 | 3300046665 | Bacteria | 1207 |
| 129 | Ga0495661_0240555 | 3300046665 | Bacteria | 929 |
| 130 | Ga0495660_0105450 | 3300046810 | Bacteria | 1445 |
| 131 | Ga0495676_0137272 | 3300047321 | Bacteria | 1757 |
| 132 | Ga0495683_0012859 | 3300047323 | Bacteria | 4389 |
| 133 | Ga0495626_0022056 | 3300048091 | Bacteria | 3149 |
| 134 | Ga0496100_0000867 | 3300048903 | Bacteria | 14426 |
| 135 | Ga0496101_0000840 | 3300048904 | Bacteria | 18056 |
| 136 | Ga0496102_0007393 | 3300048905 | Bacteria | 9383 |
| 137 | Ga0496103_0003546 | 3300048906 | Bacteria | 9541 |
| 138 | Ga0496103_0202637 | 3300048906 | Bacteria | 1276 |
| 139 | Ga0496104_0005179 | 3300048907 | Bacteria | 11391 |
| 140 | Ga0496104_0256131 | 3300048907 | Bacteria | 1663 |
| 141 | Ga0496105_0000195 | 3300048908 | Bacteria | 40605 |
| 142 | Ga0496106_0000703 | 3300048909 | Bacteria | 24074 |
| 143 | Ga0496107_0000255 | 3300048910 | Bacteria | 28225 |
| 144 | Ga0496108_0000342 | 3300048911 | Bacteria | 39326 |
| 145 | Ga0496109_0005095 | 3300048912 | Bacteria | 10972 |
| 146 | Ga0496109_0366381 | 3300048912 | Bacteria | 1361 |
| 147 | Ga0496110_0000514 | 3300048913 | Bacteria | 26315 |
| 148 | Ga0496110_0002514 | 3300048913 | Bacteria | 13776 |
| 149 | Ga0496110_0134426 | 3300048913 | Bacteria | 2234 |
| 150 | Ga0496111_0002050 | 3300048914 | Bacteria | 12004 |
| 151 | Ga0496111_0012030 | 3300048914 | Bacteria | 5849 |
| 152 | Ga0496112_0012647 | 3300048915 | Bacteria | 7759 |
| 153 | Ga0496112_0123000 | 3300048915 | Bacteria | 2565 |
| 154 | Ga0496113_0023320 | 3300048916 | Bacteria | 4388 |
| 155 | Ga0496115_0359572 | 3300048918 | Bacteria | 1186 |
| 156 | Ga0496116_0001953 | 3300048919 | Bacteria | 22221 |
| 157 | Ga0496116_0012477 | 3300048919 | Bacteria | 6942 |
| 158 | Ga0496116_0036682 | 3300048919 | Bacteria | 3427 |
| 159 | Ga0496116_0038719 | 3300048919 | Bacteria | 3306 |
| 160 | Ga0496116_0073105 | 3300048919 | Bacteria | 2163 |
| 161 | Ga0496116_0116807 | 3300048919 | Bacteria | 1554 |
| 162 | Ga0496116_0153882 | 3300048919 | Bacteria | 1273 |
| 163 | Ga0496117_0182487 | 3300048920 | Bacteria | 1204 |
| 164 | Ga0496118_0121387 | 3300048921 | Bacteria | 1702 |
| 165 | Ga0496118_0145926 | 3300048921 | Bacteria | 1490 |
| 166 | Ga0496119_0020066 | 3300048922 | Bacteria | 4889 |
| 167 | Ga0496119_0047888 | 3300048922 | Bacteria | 2655 |
| 168 | Ga0496120_0008592 | 3300048923 | Bacteria | 7384 |
| 169 | Ga0496121_0395918 | 3300048924 | Bacteria | 906 |
| 170 | Ga0496122_0007652 | 3300048925 | Bacteria | 11927 |
| 171 | Ga0496122_0022554 | 3300048925 | Bacteria | 5590 |
| 172 | Ga0496122_0050063 | 3300048925 | Bacteria | 3190 |
| 173 | Ga0496122_0064214 | 3300048925 | Bacteria | 2673 |
| 174 | Ga0496123_0003517 | 3300048926 | Bacteria | 17450 |
| 175 | Ga0496123_0056389 | 3300048926 | Bacteria | 2568 |
| 176 | Ga0496123_0149318 | 3300048926 | Bacteria | 1264 |
| 177 | Ga0496124_0000998 | 3300048927 | Bacteria | 44860 |
| 178 | Ga0496124_0065380 | 3300048927 | Bacteria | 3033 |
| 179 | Ga0496124_0067793 | 3300048927 | Bacteria | 2968 |
| 180 | Ga0496124_0315490 | 3300048927 | Bacteria | 1122 |
| 181 | Ga0496124_0350061 | 3300048927 | Bacteria | 1045 |
| 182 | Ga0496125_0000620 | 3300048928 | Bacteria | 59641 |
| 183 | Ga0496125_0001530 | 3300048928 | Bacteria | 33186 |
| 184 | Ga0496125_0024871 | 3300048928 | Bacteria | 5496 |
| 185 | Ga0496125_0044448 | 3300048928 | Bacteria | 3756 |
| 186 | Ga0496125_0344416 | 3300048928 | Bacteria | 893 |
| 187 | Ga0496126_0031850 | 3300048929 | Bacteria | 4975 |
| 188 | Ga0496126_0530477 | 3300048929 | Bacteria | 937 |
| 189 | Ga0501306_002871 | 3300049127 | Bacteria | 1808 |
| 190 | Ga0501306_017981 | 3300049127 | Bacteria | 963 |
| 191 | Ga0501309_023429 | 3300049129 | Bacteria | 878 |
| 192 | Ga0501341_00245 | 3300049131 | Bacteria | 2038 |
| 193 | Ga0501343_000699 | 3300049132 | Bacteria | 2070 |
| 194 | Ga0501343_000919 | 3300049132 | Bacteria | 1891 |
| 195 | Ga0501344_00198 | 3300049133 | Bacteria | 2177 |
| 196 | Ga0501344_00377 | 3300049133 | Bacteria | 1812 |
| 197 | Ga0501345_00156 | 3300049134 | Bacteria | 1891 |
| 198 | Ga0501305_001546 | 3300049161 | Bacteria | 2280 |
| 199 | Ga0501305_013571 | 3300049161 | Bacteria | 1129 |
| 200 | Ga0501299_000419 | 3300049522 | Bacteria | 5043 |
| 201 | Ga0501312_000480 | 3300049528 | Bacteria | 3243 |
| 202 | Ga0501312_002754 | 3300049528 | Bacteria | 1926 |
| 203 | Ga0501313_005010 | 3300049529 | Bacteria | 1384 |
| 204 | Ga0501313_013076 | 3300049529 | Bacteria | 972 |
| 205 | Ga0501315_000808 | 3300049531 | Bacteria | 2379 |
| 206 | Ga0501316_000044 | 3300049532 | Bacteria | 5279 |
| 207 | Ga0501316_000157 | 3300049532 | Bacteria | 3739 |
| 208 | Ga0501316_000645 | 3300049532 | Bacteria | 2557 |
| 209 | Ga0501316_005957 | 3300049532 | Bacteria | 1282 |
| 210 | Ga0501317_000273 | 3300049533 | Bacteria | 3299 |
| 211 | Ga0501317_019689 | 3300049533 | Bacteria | 903 |
| 212 | Ga0501317_023593 | 3300049533 | Bacteria | 850 |
| 213 | Ga0501321_000439 | 3300049537 | Bacteria | 2655 |
| 214 | Ga0501323_000329 | 3300049539 | Bacteria | 3316 |
| 215 | Ga0501323_029663 | 3300049539 | Bacteria | 763 |
| 216 | Ga0501324_000344 | 3300049540 | Bacteria | 2386 |
| 217 | Ga0501330_000198 | 3300049546 | Bacteria | 2163 |
| 218 | Ga0501330_000267 | 3300049546 | Bacteria | 2010 |
| 219 | Ga0501331_00064 | 3300049547 | Bacteria | 3098 |
| 220 | Ga0501332_00307 | 3300049548 | Bacteria | 2039 |
| 221 | Ga0501335_000228 | 3300049551 | Bacteria | 3164 |
| 222 | Ga0501335_000566 | 3300049551 | Bacteria | 2444 |
| 223 | Ga0501335_015020 | 3300049551 | Bacteria | 787 |
| 224 | Ga0501336_000074 | 3300049552 | Bacteria | 3430 |
| 225 | Ga0501337_000278 | 3300049553 | Bacteria | 2338 |
| 226 | Ga0501216_019714 | 3300049660 | Bacteria | 1172 |
| 227 | Ga0501217_046655 | 3300049661 | Bacteria | 1120 |
| 228 | Ga0501235_001210 | 3300049669 | Bacteria | 5431 |
| 229 | nmdc:mga0rr50_22083_c1 | 3300050513 | Bacteria | 4360 |
| 230 | 2511176195 | 2510917027 | Bacteria | 5287437 |
| 231 | 2511700516 | 2511231119 | Bacteria | 4019861 |
| 232 | 2512638323 | 2512564013 | Bacteria | 6286191 |
| 233 | 2512730654 | 2512564039 | Bacteria | 8739048 |
| 234 | 2524187047 | 2524023129 | Bacteria | 6762600 |
| 235 | 2540607728 | 2540341094 | Bacteria | 4061186 |
| 236 | 2545557214 | 2545555800 | Bacteria | 4222588 |
| 237 | 2550903769 | 2548877040 | Bacteria | 7507281 |
| 238 | 2553395158 | 2551306519 | Bacteria | 5465154 |
| 239 | 2555467955 | 2554235283 | Bacteria | 3683090 |
| 240 | 2563928573 | 2563366752 | Bacteria | 4961801 |
| 241 | 2571529824 | 2571042143 | Bacteria | 6986194 |
| 242 | 2573040481 | 2571042588 | Bacteria | 5045676 |
| 243 | 2578338383 | 2576861424 | Bacteria | 5270569 |
| 244 | 2578931477 | 2576861599 | Bacteria | 4217202 |
| 245 | 2580930630 | 2579778775 | Bacteria | 5360914 |
| 246 | 2587742862 | 2585428059 | Bacteria | 8696589 |
| 247 | 2595089934 | 2593339131 | Bacteria | 5116855 |
| 248 | 2595319595 | 2593339198 | Bacteria | 7267884 |
| 249 | 2600400843 | 2600254943 | Bacteria | 2613887 |
| 250 | 2601640713 | 2600255286 | Bacteria | 5390125 |
| 251 | 2621276829 | 2619619294 | Bacteria | 5575484 |
| 252 | 2631985053 | 2630968484 | Bacteria | 3876276 |
| 253 | 2643740943 | 2643221543 | Bacteria | 6628015 |
| 254 | 2644428107 | 2643221676 | Bacteria | 8119172 |
| 255 | 2644706505 | 2643221729 | Bacteria | 6621700 |
| 256 | 2644713186 | 2643221730 | Bacteria | 6523787 |
| 257 | 2644715594 | 2643221731 | Bacteria | 5623886 |
| 258 | 2644726898 | 2643221732 | Bacteria | 5756404 |
| 259 | 2644741398 | 2643221735 | Bacteria | 3676263 |
| 260 | 2651532763 | 2648501850 | Bacteria | 3975476 |
| 261 | 2672337274 | 2671180330 | Bacteria | 5521719 |
| 262 | 2673818127 | 2671180694 | Bacteria | 7506943 |
| 263 | 2674418657 | 2671180844 | Bacteria | 4164150 |
| 264 | 2685152480 | 2684622632 | Bacteria | 5380049 |
| 265 | 2686997818 | 2684623153 | Bacteria | 3878815 |
| 266 | 2687499158 | 2687453109 | Bacteria | 3860091 |
| 267 | 2695628508 | 2695420354 | Bacteria | 3922431 |
| 268 | 2698320687 | 2695420987 | Bacteria | 6152737 |
| 269 | 2705996407 | 2703719227 | Bacteria | 5631989 |
| 270 | 2717915796 | 2716884898 | Bacteria | 3928789 |
| 271 | 2721507639 | 2718218445 | Bacteria | 5113413 |
| 272 | 2723605734 | 2721755693 | Bacteria | 6126117 |
| 273 | 2728532165 | 2728368933 | Bacteria | 7044283 |
| 274 | 2730136409 | 2728369359 | Bacteria | 5621728 |
| 275 | 2738814081 | 2738541295 | Bacteria | 5730091 |
| 276 | 2738838235 | 2738541299 | Bacteria | 4020721 |
| 277 | 2739157729 | 2738541358 | Bacteria | 5932299 |
| 278 | 2739209820 | 2738543006 | Bacteria | 5904091 |
| 279 | 2739229949 | 2738543010 | Bacteria | 5583595 |
| 280 | 2739233712 | 2738543010 | Bacteria | 5583595 |
| 281 | 2739270787 | 2738543017 | Bacteria | 4271950 |
| 282 | 2745167898 | 2744054657 | Bacteria | 5016802 |
| 283 | 2753810364 | 2751185905 | Bacteria | 6142767 |
| 284 | 2757568175 | 2757320391 | Bacteria | 4746095 |
| 285 | 2777764329 | 2775507177 | Bacteria | 4384303 |
| 286 | 2777839510 | 2775507192 | Bacteria | 4622234 |
| 287 | 2791214726 | 2788500588 | Bacteria | 4584915 |
| 288 | 2793185155 | 2791355222 | Bacteria | 5898266 |
| 289 | 2802438669 | 2802428803 | Bacteria | 5806948 |
| 290 | 2808869667 | 2808606364 | Bacteria | 4465927 |
| 291 | 2809056104 | 2808606399 | Bacteria | 4021018 |
| 292 | 2812317013 | 2811994870 | Bacteria | 3776934 |
| 293 | 2816862303 | 2816332186 | Bacteria | 5331395 |
| 294 | 2817481102 | 2816332295 | Bacteria | 4352468 |
| 295 | 2817617436 | 2816332336 | Bacteria | 5207640 |
| 296 | 2819568724 | 2818991441 | Bacteria | 5062707 |
| 297 | 2819581398 | 2818991443 | Bacteria | 6598732 |
| 298 | 2819627911 | 2818991451 | Bacteria | 4697364 |
| 299 | 2819674878 | 2818991459 | Bacteria | 8736032 |
| 300 | 2819709062 | 2818991465 | Bacteria | 5388835 |
| 301 | 2819724093 | 2818991468 | Bacteria | 3723169 |
| 302 | 2821117328 | 2821111986 | Bacteria | 6894338 |
| 303 | 2823528971 | 2823526263 | Bacteria | 3765752 |
| 304 | 2831906587 | 2831905167 | Bacteria | 3319172 |
| 305 | 2842684780 | 2842682962 | Bacteria | 5589973 |
| 306 | 2842884695 | 2842882022 | Bacteria | 6158489 |
| 307 | 2849142800 | 2849139964 | Bacteria | 5613304 |
| 308 | 2852675876 | 2852673933 | Bacteria | 3347676 |
| 309 | 2857362143 | 2857357740 | Bacteria | 9937880 |
| 310 | 2857457995 | 2857453340 | Bacteria | 8090534 |
| 311 | 2857462508 | 2857460504 | Bacteria | 5194327 |
| 312 | 2857466367 | 2857465823 | Bacteria | 6772595 |
| 313 | 2857476002 | 2857472729 | Bacteria | 6568124 |
| 314 | 2857585487 | 2857581216 | Bacteria | 5522813 |
| 315 | 2857590759 | 2857586860 | Bacteria | 4354574 |
| 316 | 2857593558 | 2857591370 | Bacteria | 6569758 |
| 317 | 2857606187 | 2857604169 | Bacteria | 5111450 |
| 318 | 2857607062 | 2857604169 | Bacteria | 5111450 |
| 319 | 2857610596 | 2857609550 | Bacteria | 3753890 |
| 320 | 2860840502 | 2860837431 | Bacteria | 4202080 |
| 321 | 2864735585 | 2864733723 | Bacteria | 6770668 |
| 322 | 2865001275 | 2864997549 | Bacteria | 5139696 |
| 323 | 2865005679 | 2865002811 | Bacteria | 6333767 |
| 324 | 2877771416 | 2877768649 | Bacteria | 3957164 |
| 325 | 2880172274 | 2880169592 | Bacteria | 3900066 |
| 326 | 2881640177 | 2881636855 | Bacteria | 5205297 |
| 327 | 2881648526 | 2881644220 | Bacteria | 5302661 |
| 328 | 2885533060 | 2885526491 | Bacteria | 7164189 |
| 329 | 2888580596 | 2888578766 | Bacteria | 6743310 |
| 330 | 2889047596 | 2889042446 | Bacteria | 7618936 |
| 331 | 2889050751 | 2889049205 | Bacteria | 7524325 |
| 332 | 2889276246 | 2889276214 | Bacteria | 5979355 |
| 333 | 2889300516 | 2889295896 | Bacteria | 4704906 |
| 334 | 2897112549 | 2897109615 | Bacteria | 4009619 |
| 335 | 2898909319 | 2898907183 | Bacteria | 4067722 |
| 336 | 2904118933 | 2904113452 | Bacteria | 7796941 |
| 337 | 2904162453 | 2904162308 | Bacteria | 7086713 |
| 338 | 2904495613 | 2904490793 | Bacteria | 7046938 |
| 339 | 2904524275 | 2904524088 | Bacteria | 5887454 |
| 340 | 2904564470 | 2904560550 | Bacteria | 4029838 |
| 341 | 2904598966 | 2904595352 | Bacteria | 6124848 |
| 342 | 2904609513 | 2904606771 | Bacteria | 4684500 |
| 343 | 2904759357 | 2904755435 | Bacteria | 7986759 |
| 344 | 2907207568 | 2907202186 | Bacteria | 6632024 |
| 345 | 2908667816 | 2908665501 | Bacteria | 3678115 |
| 346 | 2915600254 | 2915597211 | Bacteria | 6475886 |
| 347 | 2915609841 | 2915606848 | Bacteria | 6032732 |
| 348 | 2916974985 | 2916971899 | Bacteria | 4250608 |
| 349 | 2919095611 | 2919093281 | Bacteria | 3660974 |
| 350 | 2919147148 | 2919143609 | Bacteria | 6219228 |
| 351 | 2919164500 | 2919160200 | Bacteria | 6929020 |
| 352 | 2919417690 | 2919414237 | Bacteria | 5429133 |
| 353 | 2919428579 | 2919425241 | Bacteria | 8055701 |
| 354 | 2919519052 | 2919517244 | Bacteria | 5858162 |
| 355 | 2919723420 | 2919720352 | Bacteria | 5986006 |
| 356 | 2919728682 | 2919726948 | Bacteria | 3696050 |
| 357 | 2925328822 | 2925326138 | Bacteria | 9652120 |
| 358 | 2928096054 | 2928093941 | Bacteria | 5965005 |
| 359 | 2928514300 | 2928510474 | Bacteria | 4815308 |
| 360 | 2929006575 | 2929004312 | Bacteria | 5678476 |
| 361 | 2929185437 | 2929183550 | Bacteria | 6377511 |
| 362 | 2929211096 | 2929206907 | Bacteria | 5918291 |
| 363 | 2929238183 | 2929233124 | Bacteria | 5948380 |
| 364 | 2929297934 | 2929297113 | Bacteria | 3141306 |
| 365 | 2931384646 | 2931384279 | Bacteria | 7299545 |
| 366 | 2936340711 | 2936340661 | Bacteria | 5139038 |
| 367 | 2936362041 | 2936361878 | Bacteria | 5632809 |
| 368 | 2938652890 | 2938649242 | Bacteria | 7118381 |
| 369 | 2938922375 | 2938917290 | Bacteria | 5914775 |
| 370 | 2939595246 | 2939593269 | Bacteria | 4798695 |
| 371 | 2939683930 | 2939679117 | Bacteria | 6921672 |
| 372 | 2939704255 | 2939702853 | Bacteria | 5139229 |
| 373 | 2945996697 | 2945991243 | Bacteria | 7008369 |
| 374 | 2946059387 | 2946053406 | Bacteria | 6978655 |
| 375 | 2947431267 | 2947426588 | Bacteria | 5357194 |
| 376 | 2954773483 | 2954773129 | Bacteria | 3741715 |
| 377 | 2956897622 | 2956897341 | Bacteria | 5447711 |
| 378 | 2960319672 | 2960319331 | Bacteria | 5502575 |
| 379 | 2960381116 | 2960375949 | Bacteria | 5361395 |
| 380 | 2962293708 | 2962290636 | Bacteria | 4072939 |
| 381 | 2964379269 | 2964375228 | Bacteria | 4909004 |
| 382 | 2965765988 | 2965761152 | Bacteria | 5806513 |
| 383 | 2968563640 | 2968558590 | Bacteria | 6956864 |
| 384 | 2969139707 | 2969136845 | Bacteria | 3923176 |
| 385 | 2969143865 | 2969141011 | Bacteria | 4118468 |
| 386 | 2969767748 | 2969765954 | Bacteria | 4216713 |
| 387 | 2969772889 | 2969770375 | Bacteria | 4271280 |
| 388 | 2971408814 | 2971403814 | Bacteria | 7370929 |
| 389 | 2971413505 | 2971410472 | Bacteria | 8311090 |
| 390 | 2971516017 | 2971511577 | Bacteria | 5404012 |
| 391 | 2971896076 | 2971893375 | Bacteria | 3929648 |
| 392 | 2977256373 | 2977254563 | Bacteria | 4828420 |
| 393 | 2979088169 | 2979083700 | Bacteria | 5894929 |
| 394 | 2980126835 | 2980125574 | Bacteria | 5567337 |
| 395 | 2980177771 | 2980176882 | Bacteria | 5397533 |
| 396 | 2980183294 | 2980182181 | Bacteria | 9454109 |
| 397 | 2980185922 | 2980182181 | Bacteria | 9454109 |
| 398 | 2980495494 | 2980492589 | Bacteria | 4072961 |
| 399 | 2981287569 | 2981284811 | Bacteria | 4641497 |
| 400 | 2981292764 | 2981289755 | Bacteria | 4641509 |
| 401 | 2981983022 | 2981980479 | Bacteria | 4641628 |
| 402 | 2981987932 | 2981985349 | Bacteria | 4641497 |
| 403 | 2984530865 | 2984527788 | Bacteria | 5288478 |
| 404 | 2984536973 | 2984532647 | Bacteria | 5288506 |
| 405 | 2988225982 | 2988225383 | Bacteria | 7221625 |
| 406 | 2990277253 | 2990275345 | Bacteria | 4887158 |
| 407 | 2996634216 | 2996632988 | Bacteria | 6921523 |
| 408 | 2996711584 | 2996706504 | Bacteria | 5757485 |
| 409 | 3001268623 | 3001267043 | Bacteria | 4823521 |
| 410 | 3001274103 | 3001272096 | Bacteria | 4729684 |
| 411 | 3001897561 | 3001892409 | Bacteria | 6328293 |
| 412 | 3006828411 | 3006826541 | Bacteria | 4678913 |
| 413 | 3006861516 | 3006858327 | Bacteria | 4317835 |
| 414 | 3006882326 | 3006879489 | Bacteria | 4064221 |
| 415 | 3006971971 | 3006969106 | Bacteria | 4739423 |
| 416 | 3006976146 | 3006973921 | Bacteria | 4423788 |
| 417 | 3006982073 | 3006978542 | Bacteria | 5328100 |
| 418 | 3006984324 | 3006984091 | Bacteria | 4207523 |
| 419 | 3006988739 | 3006988479 | Bacteria | 4767936 |
| 420 | 648171779 | 648028048 | Bacteria | 5394884 |
| 421 | 8002321402 | 8002317523 | Bacteria | 8051857 |
| 422 | 8022624425 | 8022621104 | Bacteria | 5241040 |
| 423 | 8022632148 | 8022630665 | Bacteria | 3886130 |
| 424 | 8022654670 | 8022653035 | Bacteria | 4035078 |
| 425 | 8022797100 | 8022792930 | Bacteria | 5693794 |
| 426 | 8022898375 | 8022893055 | Bacteria | 5300455 |
| 427 | 8022917549 | 8022914991 | Bacteria | 5584517 |
| 428 | 8022950059 | 8022948649 | Bacteria | 5366783 |
| 429 | 8023443802 | 8023438354 | Bacteria | 5779374 |
| 430 | 8023445379 | 8023444577 | Bacteria | 5661597 |
| 431 | 8046995636 | 8046991243 | Bacteria | 8497463 |
| 432 | 8051954948 | 8051952484 | Bacteria | 3926774 |
| 433 | 8052176334 | 8052174270 | Bacteria | 3881265 |
| 434 | 8054470700 | 8054465665 | Bacteria | 7323556 |
| 435 | 8054797995 | 8054795415 | Bacteria | 9785225 |
| 436 | 8055535794 | 8055531788 | Bacteria | 5249694 |
| 437 | 8055633427 | 8055632911 | Bacteria | 5283357 |
| 438 | 8056535747 | 8056533031 | Bacteria | 8964429 |
| 439 | 8057477354 | 8057473075 | Bacteria | 5892720 |
| 440 | 8057586931 | 8057582654 | Bacteria | 5218944 |
| 441 | 8057635676 | 8057632132 | Bacteria | 4726859 |
| 442 | 8057737139 | 8057733483 | Bacteria | 6578323 |
| 443 | 8057980962 | 8057977335 | Bacteria | 5694872 |
| 444 | Ga0307411_10137326 | |||
| 445 | JGI25159J45721_1019791 | |||
| 446 | JGI25151J46595_10000060 | |||
| 447 | JGI25151J46595_10001026 | |||
| 448 | JGI25151J46595_10043326 | |||
| 449 | rootH2_10014760 | |||
| 450 | rootL2_10017105 | |||
| 451 | Ga0006562J51391_1001014 | |||
| 452 | Ga0006562J51391_1001234 | |||
| 453 | Ga0055538_1000228 | |||
| 454 | Ga0055538_1001029 | |||
| 455 | Ga0055538_1001093 | |||
| 456 | Ga0055532_1000078 | |||
| 457 | Ga0055532_1001872 | |||
| 458 | Ga0055532_1004846 | |||
| 459 | Ga0055535_1001524 | |||
| 460 | Ga0055528_1002485 | |||
| 461 | Ga0055541_1000493 | |||
| 462 | Ga0055541_1001563 | |||
| 463 | Ga0055541_1004923 | |||
| 464 | Ga0070670_100091656 | |||
| 465 | Ga0070682_100174120 | |||
| 466 | Ga0070669_100349836 | |||
| 467 | Ga0070671_100005950 | |||
| 468 | Ga0070667_100571426 | |||
| 469 | Ga0070681_10195312 | |||
| 470 | Ga0070697_100116539 | |||
| 471 | Ga0070672_100336183 | |||
| 472 | Ga0070665_100487948 | |||
| 473 | Ga0105251_10009717 | |||
| 474 | Ga0105251_10010107 | |||
| 475 | Ga0105244_10015259 | |||
| 476 | Ga0105244_10052658 | |||
| 477 | Ga0105250_10006661 | |||
| 478 | Ga0105250_10019434 | |||
| 479 | Ga0105245_10028735 | |||
| 480 | Ga0105247_10064439 | |||
| 481 | Ga0105243_10002172 | |||
| 482 | Ga0105242_10009853 | |||
| 483 | Ga0105246_10010276 | |||
| 484 | Ga0157371_10008363 | |||
| 485 | Ga0157374_10047875 | |||
| 486 | Ga0157378_10027418 | |||
| 487 | Ga0157372_10825978 | |||
| 488 | Ga0157377_10011481 | |||
| 489 | Ga0157376_10006835 | |||
| 490 | Ga0209784_100092 | |||
| 491 | Ga0209784_100154 | |||
| 492 | Ga0209566_100130 | |||
| 493 | Ga0209566_100363 | |||
| 494 | Ga0209566_100585 | |||
| 495 | Ga0209566_100589 | |||
| 496 | Ga0209147_100050 | |||
| 497 | Ga0209147_100114 | |||
| 498 | Ga0209147_101693 | |||
| 499 | Ga0209147_102726 | |||
| 500 | Ga0209147_109143 | |||
| 501 | Ga0209258_101681 | |||
| 502 | Ga0209673_1001980 | |||
| 503 | Ga0209130_1002394 | |||
| 504 | Ga0209130_1005934 | |||
| 505 | Ga0209130_1011773 | |||
| 506 | Ga0209130_1013015 | |||
| 507 | Ga0209675_1007536 | |||
| 508 | Ga0209675_1026842 | |||
| 509 | Ga0209676_1000439 | |||
| 510 | Ga0209676_1015710 | |||
| 511 | Ga0209025_1000001 | |||
| 512 | Ga0209025_1000488 | |||
| 513 | Ga0209025_1005641 | |||
| 514 | Ga0209025_1005857 | |||
| 515 | Ga0209025_1005978 | |||
| 516 | Ga0209025_1006581 | |||
| 517 | Ga0209025_1014086 | |||
| 518 | Ga0209025_1014217 | |||
| 519 | Ga0209025_1020525 | |||
| 520 | Ga0209025_1022730 | |||
| 521 | Ga0209025_1062027 | |||
| 522 | Ga0207426_1003050 | |||
| 523 | Ga0207696_1002366 | |||
| 524 | Ga0207696_1004385 | |||
| 525 | Ga0207655_1009345 | |||
| 526 | Ga0207655_1029303 | |||
| 527 | Ga0207655_1034751 | |||
| 528 | Ga0207655_1062465 | |||
| 529 | Ga0207655_1090309 | |||
| 530 | Ga0207713_1000242 | |||
| 531 | Ga0207713_1034972 | |||
| 532 | Ga0207681_10340931 | |||
| 533 | Ga0207650_10067142 | |||
| 534 | Ga0207644_10212528 | |||
| 535 | Ga0207709_10002517 | |||
| 536 | Ga0207691_10329433 | |||
| 537 | Ga0209371_1001629 | |||
| 538 | Ga0237817_10057 | |||
| 539 | Ga0237817_10507 | |||
| 540 | Ga0268256_1001574 | |||
| 541 | Ga0307409_100080517 | |||
| 542 | Ga0307409_100159628 | |||
| 543 | Ga0307409_100184195 | |||
| 544 | Ga0307416_100048924 | |||
| 545 | Ga0307415_100168041 | |||
| 546 | Ga0373933_0418196 | |||
| 547 | Ga0373925_0681107 | |||
| 548 | Ga0395899_0177918 | |||
| 549 | Ga0395898_0032442 | |||
| 550 | Ga0237819_00426 | |||
| 551 | Ga0237819_01987 | |||
| 552 | Ga0439436_0019821 | |||
| 553 | Ga0451789_0620855 | |||
| 554 | Ga0439433_0002018 | |||
| 555 | Ga0439449_0001506 | |||
| 556 | Ga0439449_0035896 | |||
| 557 | Ga0439462_0036268 | |||
| 558 | Ga0466961_0159078 | |||
| 559 | Ga0466971_0099153 | |||
| 560 | Ga0466968_0008064 | |||
| 561 | Ga0466959_0006223 | |||
| 562 | Ga0451576_0243462 | |||
| 563 | Ga0466967_0000037 | |||
| 564 | Ga0466967_0661275 | |||
| 565 | Ga0495584_0149813 | |||
| 566 | Ga0495585_0013268 | |||
| 567 | Ga0495620_0127506 | |||
| 568 | Ga0495631_0174694 | |||
| 569 | Ga0495637_0131370 | |||
| 570 | Ga0495661_0078540 | |||
| 571 | Ga0495661_0160554 | |||
| 572 | Ga0495661_0240555 | |||
| 573 | Ga0495660_0105450 | |||
| 574 | Ga0495676_0137272 | |||
| 575 | Ga0495683_0012859 | |||
| 576 | Ga0495626_0022056 | |||
| 577 | Ga0496100_0000867 | |||
| 578 | Ga0496101_0000840 | |||
| 579 | Ga0496102_0007393 | |||
| 580 | Ga0496103_0003546 | |||
| 581 | Ga0496103_0202637 | |||
| 582 | Ga0496104_0005179 | |||
| 583 | Ga0496104_0256131 | |||
| 584 | Ga0496105_0000195 | |||
| 585 | Ga0496106_0000703 | |||
| 586 | Ga0496107_0000255 | |||
| 587 | Ga0496108_0000342 | |||
| 588 | Ga0496109_0005095 | |||
| 589 | Ga0496109_0366381 | |||
| 590 | Ga0496110_0000514 | |||
| 591 | Ga0496110_0002514 | |||
| 592 | Ga0496110_0134426 | |||
| 593 | Ga0496111_0002050 | |||
| 594 | Ga0496111_0012030 | |||
| 595 | Ga0496112_0012647 | |||
| 596 | Ga0496112_0123000 | |||
| 597 | Ga0496113_0023320 | |||
| 598 | Ga0496115_0359572 | |||
| 599 | Ga0496116_0001953 | |||
| 600 | Ga0496116_0012477 | |||
| 601 | Ga0496116_0036682 | |||
| 602 | Ga0496116_0038719 | |||
| 603 | Ga0496116_0073105 | |||
| 604 | Ga0496116_0116807 | |||
| 605 | Ga0496116_0153882 | |||
| 606 | Ga0496117_0182487 | |||
| 607 | Ga0496118_0121387 | |||
| 608 | Ga0496118_0145926 | |||
| 609 | Ga0496119_0020066 | |||
| 610 | Ga0496119_0047888 | |||
| 611 | Ga0496120_0008592 | |||
| 612 | Ga0496121_0395918 | |||
| 613 | Ga0496122_0007652 | |||
| 614 | Ga0496122_0022554 | |||
| 615 | Ga0496122_0050063 | |||
| 616 | Ga0496122_0064214 | |||
| 617 | Ga0496123_0003517 | |||
| 618 | Ga0496123_0056389 | |||
| 619 | Ga0496123_0149318 | |||
| 620 | Ga0496124_0000998 | |||
| 621 | Ga0496124_0065380 | |||
| 622 | Ga0496124_0067793 | |||
| 623 | Ga0496124_0315490 | |||
| 624 | Ga0496124_0350061 | |||
| 625 | Ga0496125_0000620 | |||
| 626 | Ga0496125_0001530 | |||
| 627 | Ga0496125_0024871 | |||
| 628 | Ga0496125_0044448 | |||
| 629 | Ga0496125_0344416 | |||
| 630 | Ga0496126_0031850 | |||
| 631 | Ga0496126_0530477 | |||
| 632 | Ga0501306_002871 | |||
| 633 | Ga0501306_017981 | |||
| 634 | Ga0501309_023429 | |||
| 635 | Ga0501341_00245 | |||
| 636 | Ga0501343_000699 | |||
| 637 | Ga0501343_000919 | |||
| 638 | Ga0501344_00198 | |||
| 639 | Ga0501344_00377 | |||
| 640 | Ga0501345_00156 | |||
| 641 | Ga0501305_001546 | |||
| 642 | Ga0501305_013571 | |||
| 643 | Ga0501299_000419 | |||
| 644 | Ga0501312_000480 | |||
| 645 | Ga0501312_002754 | |||
| 646 | Ga0501313_005010 | |||
| 647 | Ga0501313_013076 | |||
| 648 | Ga0501315_000808 | |||
| 649 | Ga0501316_000044 | |||
| 650 | Ga0501316_000157 | |||
| 651 | Ga0501316_000645 | |||
| 652 | Ga0501316_005957 | |||
| 653 | Ga0501317_000273 | |||
| 654 | Ga0501317_019689 | |||
| 655 | Ga0501317_023593 | |||
| 656 | Ga0501321_000439 | |||
| 657 | Ga0501323_000329 | |||
| 658 | Ga0501323_029663 | |||
| 659 | Ga0501324_000344 | |||
| 660 | Ga0501330_000198 | |||
| 661 | Ga0501330_000267 | |||
| 662 | Ga0501331_00064 | |||
| 663 | Ga0501332_00307 | |||
| 664 | Ga0501335_000228 | |||
| 665 | Ga0501335_000566 | |||
| 666 | Ga0501335_015020 | |||
| 667 | Ga0501336_000074 | |||
| 668 | Ga0501337_000278 | |||
| 669 | Ga0501216_019714 | |||
| 670 | Ga0501217_046655 | |||
| 671 | Ga0501235_001210 | |||
| 672 | nmdc:mga0rr50_22083_c1 | |||
| 673 | 2511176195 | |||
| 674 | 2511700516 | |||
| 675 | 2512638323 | |||
| 676 | 2512730654 | |||
| 677 | 2524187047 | |||
| 678 | 2540607728 | |||
| 679 | 2545557214 | |||
| 680 | 2550903769 | |||
| 681 | 2553395158 | |||
| 682 | 2555467955 | |||
| 683 | 2563928573 | |||
| 684 | 2571529824 | |||
| 685 | 2573040481 | |||
| 686 | 2578338383 | |||
| 687 | 2578931477 | |||
| 688 | 2580930630 | |||
| 689 | 2587742862 | |||
| 690 | 2595089934 | |||
| 691 | 2595319595 | |||
| 692 | 2600400843 | |||
| 693 | 2601640713 | |||
| 694 | 2621276829 | |||
| 695 | 2631985053 | |||
| 696 | 2643740943 | |||
| 697 | 2644428107 | |||
| 698 | 2644706505 | |||
| 699 | 2644713186 | |||
| 700 | 2644715594 | |||
| 701 | 2644726898 | |||
| 702 | 2644741398 | |||
| 703 | 2651532763 | |||
| 704 | 2672337274 | |||
| 705 | 2673818127 | |||
| 706 | 2674418657 | |||
| 707 | 2685152480 | |||
| 708 | 2686997818 | |||
| 709 | 2687499158 | |||
| 710 | 2695628508 | |||
| 711 | 2698320687 | |||
| 712 | 2705996407 | |||
| 713 | 2717915796 | |||
| 714 | 2721507639 | |||
| 715 | 2723605734 | |||
| 716 | 2728532165 | |||
| 717 | 2730136409 | |||
| 718 | 2738814081 | |||
| 719 | 2738838235 | |||
| 720 | 2739157729 | |||
| 721 | 2739209820 | |||
| 722 | 2739229949 | |||
| 723 | 2739233712 | |||
| 724 | 2739270787 | |||
| 725 | 2745167898 | |||
| 726 | 2753810364 | |||
| 727 | 2757568175 | |||
| 728 | 2777764329 | |||
| 729 | 2777839510 | |||
| 730 | 2791214726 | |||
| 731 | 2793185155 | |||
| 732 | 2802438669 | |||
| 733 | 2808869667 | |||
| 734 | 2809056104 | |||
| 735 | 2812317013 | |||
| 736 | 2816862303 | |||
| 737 | 2817481102 | |||
| 738 | 2817617436 | |||
| 739 | 2819568724 | |||
| 740 | 2819581398 | |||
| 741 | 2819627911 | |||
| 742 | 2819674878 | |||
| 743 | 2819709062 | |||
| 744 | 2819724093 | |||
| 745 | 2821117328 | |||
| 746 | 2823528971 | |||
| 747 | 2831906587 | |||
| 748 | 2842684780 | |||
| 749 | 2842884695 | |||
| 750 | 2849142800 | |||
| 751 | 2852675876 | |||
| 752 | 2857362143 | |||
| 753 | 2857457995 | |||
| 754 | 2857462508 | |||
| 755 | 2857466367 | |||
| 756 | 2857476002 | |||
| 757 | 2857585487 | |||
| 758 | 2857590759 | |||
| 759 | 2857593558 | |||
| 760 | 2857606187 | |||
| 761 | 2857607062 | |||
| 762 | 2857610596 | |||
| 763 | 2860840502 | |||
| 764 | 2864735585 | |||
| 765 | 2865001275 | |||
| 766 | 2865005679 | |||
| 767 | 2877771416 | |||
| 768 | 2880172274 | |||
| 769 | 2881640177 | |||
| 770 | 2881648526 | |||
| 771 | 2885533060 | |||
| 772 | 2888580596 | |||
| 773 | 2889047596 | |||
| 774 | 2889050751 | |||
| 775 | 2889276246 | |||
| 776 | 2889300516 | |||
| 777 | 2897112549 | |||
| 778 | 2898909319 | |||
| 779 | 2904118933 | |||
| 780 | 2904162453 | |||
| 781 | 2904495613 | |||
| 782 | 2904524275 | |||
| 783 | 2904564470 | |||
| 784 | 2904598966 | |||
| 785 | 2904609513 | |||
| 786 | 2904759357 | |||
| 787 | 2907207568 | |||
| 788 | 2908667816 | |||
| 789 | 2915600254 | |||
| 790 | 2915609841 | |||
| 791 | 2916974985 | |||
| 792 | 2919095611 | |||
| 793 | 2919147148 | |||
| 794 | 2919164500 | |||
| 795 | 2919417690 | |||
| 796 | 2919428579 | |||
| 797 | 2919519052 | |||
| 798 | 2919723420 | |||
| 799 | 2919728682 | |||
| 800 | 2925328822 | |||
| 801 | 2928096054 | |||
| 802 | 2928514300 | |||
| 803 | 2929006575 | |||
| 804 | 2929185437 | |||
| 805 | 2929211096 | |||
| 806 | 2929238183 | |||
| 807 | 2929297934 | |||
| 808 | 2931384646 | |||
| 809 | 2936340711 | |||
| 810 | 2936362041 | |||
| 811 | 2938652890 | |||
| 812 | 2938922375 | |||
| 813 | 2939595246 | |||
| 814 | 2939683930 | |||
| 815 | 2939704255 | |||
| 816 | 2945996697 | |||
| 817 | 2946059387 | |||
| 818 | 2947431267 | |||
| 819 | 2954773483 | |||
| 820 | 2956897622 | |||
| 821 | 2960319672 | |||
| 822 | 2960381116 | |||
| 823 | 2962293708 | |||
| 824 | 2964379269 | |||
| 825 | 2965765988 | |||
| 826 | 2968563640 | |||
| 827 | 2969139707 | |||
| 828 | 2969143865 | |||
| 829 | 2969767748 | |||
| 830 | 2969772889 | |||
| 831 | 2971408814 | |||
| 832 | 2971413505 | |||
| 833 | 2971516017 | |||
| 834 | 2971896076 | |||
| 835 | 2977256373 | |||
| 836 | 2979088169 | |||
| 837 | 2980126835 | |||
| 838 | 2980177771 | |||
| 839 | 2980183294 | |||
| 840 | 2980185922 | |||
| 841 | 2980495494 | |||
| 842 | 2981287569 | |||
| 843 | 2981292764 | |||
| 844 | 2981983022 | |||
| 845 | 2981987932 | |||
| 846 | 2984530865 | |||
| 847 | 2984536973 | |||
| 848 | 2988225982 | |||
| 849 | 2990277253 | |||
| 850 | 2996634216 | |||
| 851 | 2996711584 | |||
| 852 | 3001268623 | |||
| 853 | 3001274103 | |||
| 854 | 3001897561 | |||
| 855 | 3006828411 | |||
| 856 | 3006861516 | |||
| 857 | 3006882326 | |||
| 858 | 3006971971 | |||
| 859 | 3006976146 | |||
| 860 | 3006982073 | |||
| 861 | 3006984324 | |||
| 862 | 3006988739 | |||
| 863 | 648171779 | |||
| 864 | 8002321402 | |||
| 865 | 8022624425 | |||
| 866 | 8022632148 | |||
| 867 | 8022654670 | |||
| 868 | 8022797100 | |||
| 869 | 8022898375 | |||
| 870 | 8022917549 | |||
| 871 | 8022950059 | |||
| 872 | 8023443802 | |||
| 873 | 8023445379 | |||
| 874 | 8046995636 | |||
| 875 | 8051954948 | |||
| 876 | 8052176334 | |||
| 877 | 8054470700 | |||
| 878 | 8054797995 | |||
| 879 | 8055535794 | |||
| 880 | 8055633427 | |||
| 881 | 8056535747 | |||
| 882 | 8057477354 | |||
| 883 | 8057586931 | |||
| 884 | 8057635676 | |||
| 885 | 8057737139 | |||
| 886 | 8057980962 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bs3-assembly1.cif.gz_B | glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes | 0.8315 | 3 | 239 |
| 8gs8-assembly1.cif.gz_B | cryo-em structure of the human respiratory complex ii | 0.8299 | 1 | 240 |
| 5xmj-assembly2.cif.gz_F | crystal structure of quinol:fumarate reductase from desulfovibrio gigas | 0.8271 | 3 | 240 |
| 2acz-assembly1.cif.gz_B | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.8237 | 4 | 241 |
| 8gs8-assembly1.cif.gz_B | cryo-em structure of the human respiratory complex ii | 0.8236 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZC7_12_128_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9404 | 1 | 111 | 3.10.20.30 |
| af_Q2FZC7_130_266_1.10.1060.10 | Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin | 0.9114 | 114 | 247 | 1.10.1060.10 |
| af_Q2FZC7_130_266_1.10.1060.10 | Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin | 0.8859 | 114 | 247 | 1.10.1060.10 |
| af_Q2FZC7_12_128_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8851 | 1 | 111 | 3.10.20.30 |
| af_O53669_2_103_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8763 | 5 | 111 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V9GF84-F1-model_v4 | Succinate dehydrogenase iron-sulfur protein | 0.992 | 155 | 248 |
GO:0009060
GO:0022904 GO:0051536 |
| AF-A0A846KTL4-F1-model_v4 | Succinate dehydrogenase iron-sulfur subunit | 0.9805 | 163 | 249 |
GO:0051536
|
| AF-V9GF84-F1-model_v4 | Succinate dehydrogenase iron-sulfur protein | 0.9715 | 155 | 248 |
GO:0009060
GO:0022904 GO:0051536 |
| AF-A0A382NSU5-F1-model_v4 | Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein | 0.9624 | 3 | 110 |
GO:0009055
GO:0009060 GO:0022904 GO:0051536 |
| AF-A0A382NSU5-F1-model_v4 | Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein | 0.945 | 3 | 110 |
GO:0009055
GO:0009060 GO:0022904 GO:0051536 |