F444962

General Info

Members Datasets Scaffolds Average Seq Length
442 181 884 230

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0227066|Ga0496108_0227066_510_1283
Length 257
Sequence MAAKASSSAKETAMASEDTRVNGRGKMNASGQVVIGLLVMAFGVLFLLDNLNIIYLRHVIFFWPLAFVASGLVALCSDGPRSGRITGIVLIAIGLAMTLNRLGYVFISWRTFWPLVMIGLGGLILFRTMGGGRIVHVRTDSYTKDDARADNAVDITAILGGFERRISAPDFRGGEITAIMGGCALDLRDASMANEAVLNVFAIWGGITIKVPPDWTVILNGTPVMGGFTEKTARPPDNRKRLIVTGYAIMGGVEVRN

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 2857553236 Duganella sp. R-74557 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0
Rhizoplane 4.3
Rhizosphere 92.08
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0227066 3300048911 Bacteria 1623
2 Ga0055525_1000047 3300003759 Bacteria 261507
3 Ga0065165_1001661 3300005262 Bacteria 22512
4 Ga0070676_10052067 3300005328 Bacteria 2406
5 Ga0070690_100029948 3300005330 Bacteria 3380
6 Ga0068869_100110620 3300005334 Bacteria 2089
7 Ga0068868_100033399 3300005338 Bacteria 3965
8 Ga0070689_100010889 3300005340 Bacteria 6498
9 Ga0070661_100517454 3300005344 Bacteria 957
10 Ga0070668_100052066 3300005347 Bacteria 3156
11 Ga0070675_100004650 3300005354 Bacteria 10482
12 Ga0070673_100235449 3300005364 Bacteria 1590
13 Ga0070688_100023985 3300005365 Bacteria 3593
14 Ga0070701_10008302 3300005438 Bacteria 4487
15 Ga0070663_100077481 3300005455 Bacteria 2434
16 Ga0070678_100101678 3300005456 Bacteria 2229
17 Ga0068867_100025257 3300005459 Bacteria 4262
18 Ga0070685_10414228 3300005466 Unclassified 936
19 Ga0070672_100131715 3300005543 Bacteria 2056
20 Ga0070686_100030597 3300005544 Bacteria 3284
21 Ga0070664_100231084 3300005564 Bacteria 1658
22 Ga0070702_100012802 3300005615 Bacteria 4220
23 Ga0068859_100039987 3300005617 Bacteria 4706
24 Ga0068863_100111720 3300005841 Bacteria 2602
25 Ga0068858_100009070 3300005842 Bacteria 9513
26 Ga0068860_100118002 3300005843 Bacteria 2539
27 Ga0068862_100024053 3300005844 Bacteria 5107
28 Ga0075368_10072732 3300006042 Bacteria 1390
29 Ga0075363_100233748 3300006048 Bacteria 1056
30 Ga0075364_10036991 3300006051 Bacteria 3158
31 Ga0075362_10005611 3300006177 Bacteria 4605
32 Ga0075367_10003206 3300006178 Bacteria 7728
33 Ga0075428_100032007 3300006844 Bacteria 5810
34 Ga0075430_100181059 3300006846 Bacteria 1753
35 Ga0075431_100477961 3300006847 Bacteria 1239
36 Ga0075433_10359361 3300006852 Bacteria 1287
37 Ga0075429_100010329 3300006880 Bacteria 8076
38 Ga0068865_100013141 3300006881 Bacteria 5224
39 Ga0097620_100039992 3300006931 Bacteria 4706
40 Ga0075435_100002971 3300007076 Bacteria 11398
41 Ga0105248_10119826 3300009177 Bacteria 2968
42 Ga0105249_10543082 3300009553 Bacteria 1212
43 Ga0157372_10555530 3300013307 Bacteria 1338
44 Ga0157380_10084105 3300014326 Bacteria 2608
45 Ga0206351_10805552 3300020077 Bacteria 1114
46 Ga0213872_10000513 3300021361 Bacteria 30595
47 Ga0213872_10001816 3300021361 Bacteria 13264
48 Ga0213872_10003612 3300021361 Bacteria 8492
49 Ga0213872_10014620 3300021361 Bacteria 3659
50 Ga0207662_10039831 3300025918 Bacteria 2758
51 Ga0207681_10194268 3300025923 Bacteria 1555
52 Ga0207659_10048199 3300025926 Bacteria 3017
53 Ga0207706_10155121 3300025933 Bacteria 2014
54 Ga0207709_10038992 3300025935 Bacteria 2834
55 Ga0207669_10125348 3300025937 Bacteria 1753
56 Ga0207704_10087382 3300025938 Bacteria 2036
57 Ga0207691_10054696 3300025940 Bacteria 3640
58 Ga0207711_10192032 3300025941 Bacteria 1861
59 Ga0207679_10669440 3300025945 Unclassified 940
60 Ga0207651_10478465 3300025960 Unclassified 1073
61 Ga0207712_10108224 3300025961 Bacteria 2080
62 Ga0207668_10311839 3300025972 Bacteria 1302
63 Ga0207658_10095984 3300025986 Bacteria 2311
64 Ga0207677_10072142 3300026023 Bacteria 2440
65 Ga0207703_10104790 3300026035 Bacteria 2403
66 Ga0207678_10028247 3300026067 Bacteria 4898
67 Ga0207708_10028217 3300026075 Bacteria 4250
68 Ga0207641_10114527 3300026088 Bacteria 2396
69 Ga0207648_10000441 3300026089 Bacteria 45995
70 Ga0207675_100037242 3300026118 Bacteria 4538
71 Ga0207675_100042240 3300026118 Bacteria 4256
72 Ga0207683_10264321 3300026121 Bacteria 1571
73 Ga0207428_10001496 3300027907 Bacteria 24427
74 Ga0268265_10197680 3300028380 Bacteria 1741
75 Ga0268264_10108154 3300028381 Bacteria 2430
76 Ga0265314_10012934 3300031711 Bacteria 6777
77 Ga0395899_0002799 3300037312 Bacteria 14052
78 Ga0395899_0119882 3300037312 Bacteria 1885
79 Ga0395900_0000331 3300037418 Bacteria 69780
80 Ga0395900_0000763 3300037418 Bacteria 42856
81 Ga0395900_0004892 3300037418 Bacteria 14110
82 Ga0395900_0599370 3300037418 Bacteria 1042
83 Ga0395898_0448436 3300037466 Bacteria 1229
84 Ga0395905_0257219 3300037471 Bacteria 1630
85 Ga0395901_0000097 3300038443 Bacteria 118528
86 Ga0436361_0119822 3300039447 Bacteria 2431
87 Ga0436361_0147443 3300039447 Bacteria 20907
88 Ga0436361_0285452 3300039447 Bacteria 29974
89 Ga0436361_0613234 3300039447 Bacteria 11005
90 Ga0439448_0043439 3300042005 Bacteria 1459
91 Ga0495617_029381 3300046452 Bacteria 1848
92 Ga0495627_000008 3300046453 Bacteria 572150
93 Ga0495627_000255 3300046453 Bacteria 54602
94 Ga0495627_002405 3300046453 Bacteria 9070
95 Ga0495627_066779 3300046453 Bacteria 1055
96 Ga0495590_0000408 3300046457 Bacteria 21707
97 Ga0495590_0010629 3300046457 Bacteria 3451
98 Ga0495591_000043 3300046458 Bacteria 148885
99 Ga0495591_013065 3300046458 Bacteria 3059
100 Ga0495591_063415 3300046458 Bacteria 976
101 Ga0495629_0046515 3300046459 Bacteria 3043
102 Ga0495638_0018239 3300046460 Bacteria 4663
103 Ga0495638_0099275 3300046460 Bacteria 1743
104 Ga0495653_0012662 3300046463 Bacteria 6889
105 Ga0495653_0041287 3300046463 Bacteria 3601
106 Ga0495653_0079168 3300046463 Bacteria 2434
107 Ga0495650_0000495 3300046471 Bacteria 59867
108 Ga0495650_0000593 3300046471 Bacteria 50088
109 Ga0495650_0019398 3300046471 Bacteria 3348
110 Ga0495580_0046705 3300046472 Bacteria 3071
111 Ga0495582_0000488 3300046473 Bacteria 21702
112 Ga0495605_0000024 3300046474 Bacteria 236016
113 Ga0495605_0002779 3300046474 Bacteria 10658
114 Ga0495605_0005153 3300046474 Bacteria 7619
115 Ga0495605_0019740 3300046474 Bacteria 3594
116 Ga0495605_0049035 3300046474 Bacteria 2064
117 Ga0495605_0061353 3300046474 Bacteria 1799
118 Ga0495605_0111686 3300046474 Bacteria 1246
119 Ga0495639_0042186 3300046475 Bacteria 2057
120 Ga0495639_0217449 3300046475 Bacteria 939
121 Ga0495584_0000209 3300046491 Bacteria 42070
122 Ga0495584_0005242 3300046491 Bacteria 6873
123 Ga0495584_0008126 3300046491 Bacteria 5452
124 Ga0495584_0011375 3300046491 Bacteria 4557
125 Ga0495584_0014036 3300046491 Bacteria 4081
126 Ga0495584_0016500 3300046491 Bacteria 3765
127 Ga0495584_0040714 3300046491 Bacteria 2346
128 Ga0495584_0155588 3300046491 Bacteria 1161
129 Ga0495585_0000807 3300046492 Bacteria 27258
130 Ga0495585_0002717 3300046492 Bacteria 12365
131 Ga0495585_0020730 3300046492 Bacteria 3778
132 Ga0495585_0024470 3300046492 Bacteria 3462
133 Ga0495585_0033028 3300046492 Bacteria 2931
134 Ga0495585_0042172 3300046492 Bacteria 2557
135 Ga0495585_0066996 3300046492 Bacteria 1965
136 Ga0495585_0083484 3300046492 Bacteria 1728
137 Ga0495585_0183014 3300046492 Bacteria 1076
138 Ga0495585_0331717 3300046492 Bacteria 742
139 Ga0495594_0007941 3300046499 Bacteria 5456
140 Ga0495594_0010603 3300046499 Bacteria 4778
141 Ga0495594_0014861 3300046499 Bacteria 4085
142 Ga0495594_0077309 3300046499 Bacteria 1856
143 Ga0495594_0117575 3300046499 Bacteria 1501
144 Ga0495596_0000315 3300046500 Bacteria 31761
145 Ga0495596_0001158 3300046500 Bacteria 15496
146 Ga0495596_0001621 3300046500 Bacteria 12805
147 Ga0495596_0007423 3300046500 Bacteria 4947
148 Ga0495596_0010862 3300046500 Bacteria 3948
149 Ga0495596_0012083 3300046500 Bacteria 3706
150 Ga0495596_0013029 3300046500 Bacteria 3542
151 Ga0495596_0013088 3300046500 Bacteria 3531
152 Ga0495596_0017474 3300046500 Bacteria 2967
153 Ga0495596_0035062 3300046500 Bacteria 1990
154 Ga0495596_0057962 3300046500 Bacteria 1510
155 Ga0495596_0108523 3300046500 Bacteria 1077
156 Ga0495596_0109044 3300046500 Bacteria 1074
157 Ga0495607_0001333 3300046501 Bacteria 22039
158 Ga0495607_0009047 3300046501 Bacteria 6773
159 Ga0495607_0019358 3300046501 Bacteria 4325
160 Ga0495607_0053376 3300046501 Bacteria 2336
161 Ga0495583_0000217 3300046506 Bacteria 96747
162 Ga0495583_0000654 3300046506 Bacteria 45704
163 Ga0495583_0001243 3300046506 Bacteria 27052
164 Ga0495583_0001592 3300046506 Bacteria 22313
165 Ga0495583_0009165 3300046506 Bacteria 5946
166 Ga0495583_0107723 3300046506 Bacteria 1183
167 Ga0495606_0001555 3300046507 Bacteria 30156
168 Ga0495606_0019610 3300046507 Bacteria 5022
169 Ga0495606_0026382 3300046507 Bacteria 4142
170 Ga0495606_0046548 3300046507 Bacteria 2866
171 Ga0495606_0148341 3300046507 Bacteria 1379
172 Ga0495610_0001254 3300046512 Bacteria 22795
173 Ga0495616_0000634 3300046513 Bacteria 26282
174 Ga0495616_0002542 3300046513 Bacteria 12043
175 Ga0495616_0012675 3300046513 Bacteria 4776
176 Ga0495616_0013331 3300046513 Bacteria 4639
177 Ga0495616_0018315 3300046513 Bacteria 3846
178 Ga0495616_0021860 3300046513 Bacteria 3458
179 Ga0495616_0024932 3300046513 Bacteria 3201
180 Ga0495616_0029326 3300046513 Bacteria 2906
181 Ga0495616_0029625 3300046513 Bacteria 2887
182 Ga0495616_0037521 3300046513 Bacteria 2492
183 Ga0495616_0061623 3300046513 Bacteria 1839
184 Ga0495616_0164093 3300046513 Bacteria 997
185 Ga0495630_0025408 3300046517 Bacteria 4380
186 Ga0495631_0000172 3300046518 Bacteria 43983
187 Ga0495631_0001269 3300046518 Bacteria 15567
188 Ga0495631_0002189 3300046518 Bacteria 11267
189 Ga0495631_0013375 3300046518 Bacteria 3984
190 Ga0495631_0016214 3300046518 Bacteria 3557
191 Ga0495631_0024367 3300046518 Bacteria 2793
192 Ga0495631_0028609 3300046518 Bacteria 2542
193 Ga0495631_0035139 3300046518 Bacteria 2243
194 Ga0495631_0059978 3300046518 Bacteria 1651
195 Ga0495631_0100418 3300046518 Bacteria 1245
196 Ga0495632_0000073 3300046519 Bacteria 104293
197 Ga0495632_0000203 3300046519 Bacteria 60607
198 Ga0495632_0000225 3300046519 Bacteria 57394
199 Ga0495632_0043046 3300046519 Bacteria 2259
200 Ga0495637_0000009 3300046520 Bacteria 402028
201 Ga0495643_0000416 3300046522 Bacteria 55816
202 Ga0495643_0071054 3300046522 Bacteria 1827
203 Ga0495644_0004502 3300046523 Bacteria 5475
204 Ga0495644_0007109 3300046523 Bacteria 4329
205 Ga0495644_0007793 3300046523 Bacteria 4129
206 Ga0495644_0010192 3300046523 Bacteria 3621
207 Ga0495644_0059356 3300046523 Bacteria 1438
208 Ga0495648_0000290 3300046524 Bacteria 57025
209 Ga0495648_0000863 3300046524 Bacteria 31958
210 Ga0495648_0006749 3300046524 Bacteria 9281
211 Ga0495648_0015517 3300046524 Bacteria 5529
212 Ga0495648_0120336 3300046524 Bacteria 1412
213 Ga0495663_0001833 3300046525 Bacteria 6552
214 Ga0495663_0004646 3300046525 Bacteria 3848
215 Ga0495666_0000106 3300046526 Bacteria 33981
216 Ga0495666_0004466 3300046526 Bacteria 7068
217 Ga0495642_0000859 3300046528 Bacteria 14432
218 Ga0495642_0002452 3300046528 Bacteria 7546
219 Ga0495642_0004793 3300046528 Bacteria 5233
220 Ga0495642_0012470 3300046528 Bacteria 3277
221 Ga0495642_0022131 3300046528 Bacteria 2503
222 Ga0495642_0053433 3300046528 Bacteria 1665
223 Ga0495642_0055022 3300046528 Bacteria 1641
224 Ga0495642_0058765 3300046528 Bacteria 1592
225 Ga0495642_0103319 3300046528 Bacteria 1214
226 Ga0495652_0006446 3300046529 Bacteria 10912
227 Ga0495654_0002046 3300046530 Bacteria 13236
228 Ga0495654_0016255 3300046530 Bacteria 3938
229 Ga0495654_0018509 3300046530 Bacteria 3649
230 Ga0495654_0021884 3300046530 Bacteria 3325
231 Ga0495654_0048991 3300046530 Bacteria 2071
232 Ga0495665_0010278 3300046531 Bacteria 5065
233 Ga0495665_0017925 3300046531 Bacteria 3805
234 Ga0495665_0121621 3300046531 Bacteria 1367
235 Ga0495665_0143732 3300046531 Bacteria 1246
236 Ga0495640_0014111 3300046533 Bacteria 6057
237 Ga0495586_0003342 3300046535 Bacteria 8605
238 Ga0495586_0010194 3300046535 Bacteria 4999
239 Ga0495609_0000030 3300046538 Bacteria 215885
240 Ga0495609_0000365 3300046538 Bacteria 38952
241 Ga0495609_0005387 3300046538 Bacteria 6741
242 Ga0495609_0006674 3300046538 Bacteria 5858
243 Ga0495609_0010420 3300046538 Bacteria 4458
244 Ga0495609_0022350 3300046538 Bacteria 2913
245 Ga0495609_0073333 3300046538 Bacteria 1502
246 Ga0495597_0000219 3300046542 Bacteria 52473
247 Ga0495597_0000609 3300046542 Bacteria 29320
248 Ga0495597_0000620 3300046542 Bacteria 29005
249 Ga0495597_0008193 3300046542 Bacteria 5252
250 Ga0495597_0051090 3300046542 Bacteria 1823
251 Ga0495597_0094251 3300046542 Bacteria 1268
252 Ga0495645_0105164 3300046543 Bacteria 2003
253 Ga0495645_0352246 3300046543 Bacteria 948
254 Ga0495622_0015581 3300046557 Bacteria 3532
255 Ga0495622_0016620 3300046557 Bacteria 3427
256 Ga0495622_0043338 3300046557 Bacteria 2092
257 Ga0495633_0001168 3300046558 Bacteria 21108
258 Ga0495633_0001683 3300046558 Bacteria 16619
259 Ga0495633_0024340 3300046558 Bacteria 2992
260 Ga0495633_0175272 3300046558 Bacteria 988
261 Ga0495656_0001345 3300046615 Bacteria 8014
262 Ga0495656_0003825 3300046615 Bacteria 5118
263 Ga0495668_0000366 3300046616 Bacteria 59612
264 Ga0495668_0001472 3300046616 Bacteria 22608
265 Ga0495668_0002624 3300046616 Bacteria 14466
266 Ga0495668_0003610 3300046616 Bacteria 11471
267 Ga0495668_0020100 3300046616 Bacteria 3841
268 Ga0495668_0080931 3300046616 Bacteria 1782
269 Ga0495668_0089616 3300046616 Bacteria 1685
270 Ga0495634_0013235 3300046642 Bacteria 5964
271 Ga0495611_0000202 3300046648 Bacteria 41897
272 Ga0495611_0002118 3300046648 Bacteria 9303
273 Ga0495611_0009765 3300046648 Bacteria 4056
274 Ga0495611_0033155 3300046648 Bacteria 2279
275 Ga0495611_0084438 3300046648 Bacteria 1463
276 Ga0495611_0106603 3300046648 Bacteria 1303
277 Ga0495611_0139630 3300046648 Bacteria 1131
278 Ga0495625_0007131 3300046660 Bacteria 9816
279 Ga0495625_0075052 3300046660 Bacteria 2366
280 Ga0495625_0082792 3300046660 Bacteria 2231
281 Ga0495625_0263178 3300046660 Bacteria 1115
282 Ga0495635_0011829 3300046663 Bacteria 6118
283 Ga0495659_0001489 3300046664 Bacteria 7940
284 Ga0495659_0122304 3300046664 Bacteria 1026
285 Ga0495661_0000209 3300046665 Bacteria 67580
286 Ga0495661_0000949 3300046665 Bacteria 26312
287 Ga0495661_0000954 3300046665 Bacteria 26225
288 Ga0495661_0001862 3300046665 Bacteria 16855
289 Ga0495661_0022890 3300046665 Bacteria 4061
290 Ga0495661_0055074 3300046665 Bacteria 2385
291 Ga0495661_0057352 3300046665 Bacteria 2325
292 Ga0495661_0106622 3300046665 Bacteria 1567
293 Ga0495661_0125558 3300046665 Bacteria 1412
294 Ga0495588_0013104 3300046674 Bacteria 3941
295 Ga0495588_0031808 3300046674 Bacteria 2657
296 Ga0495588_0042664 3300046674 Bacteria 2320
297 Ga0495588_0084522 3300046674 Bacteria 1658
298 Ga0495588_0225218 3300046674 Bacteria 989
299 Ga0495588_0281973 3300046674 Bacteria 875
300 Ga0495623_0004664 3300046679 Bacteria 9010
301 Ga0495623_0012165 3300046679 Bacteria 5575
302 Ga0495623_0100002 3300046679 Bacteria 1768
303 Ga0495646_0130030 3300046680 Bacteria 1418
304 Ga0495669_0000206 3300046684 Bacteria 35834
305 Ga0495669_0000930 3300046684 Bacteria 12254
306 Ga0495669_0019025 3300046684 Bacteria 2961
307 Ga0495669_0030342 3300046684 Bacteria 2373
308 Ga0495669_0096203 3300046684 Bacteria 1372
309 Ga0495613_0021149 3300046689 Bacteria 4852
310 Ga0495613_0031028 3300046689 Bacteria 3969
311 Ga0495670_0002680 3300046691 Bacteria 8786
312 Ga0495670_0015186 3300046691 Bacteria 3788
313 Ga0495670_0015766 3300046691 Bacteria 3716
314 Ga0495670_0138999 3300046691 Bacteria 1269
315 Ga0495671_0000777 3300046692 Bacteria 22923
316 Ga0495671_0003195 3300046692 Bacteria 10180
317 Ga0495671_0005354 3300046692 Bacteria 7529
318 Ga0495671_0055958 3300046692 Bacteria 1953
319 Ga0495671_0205257 3300046692 Bacteria 955
320 Ga0495649_0000742 3300046694 Bacteria 26389
321 Ga0495649_0033591 3300046694 Bacteria 2823
322 Ga0495649_0123576 3300046694 Bacteria 1367
323 Ga0495589_0000021 3300046794 Bacteria 197941
324 Ga0495589_0000505 3300046794 Bacteria 27605
325 Ga0495589_0000598 3300046794 Bacteria 24527
326 Ga0495589_0002745 3300046794 Bacteria 9739
327 Ga0495589_0009424 3300046794 Bacteria 5077
328 Ga0495589_0010296 3300046794 Bacteria 4859
329 Ga0495589_0012203 3300046794 Bacteria 4456
330 Ga0495589_0053102 3300046794 Bacteria 2000
331 Ga0495600_0065405 3300046809 Bacteria 2377
332 Ga0495660_0000337 3300046810 Bacteria 41537
333 Ga0495660_0006888 3300046810 Bacteria 6693
334 Ga0495660_0009542 3300046810 Bacteria 5657
335 Ga0495660_0010295 3300046810 Bacteria 5436
336 Ga0495660_0019644 3300046810 Bacteria 3878
337 Ga0495660_0045580 3300046810 Bacteria 2406
338 Ga0495604_0005157 3300047317 Bacteria 10345
339 Ga0495604_0020398 3300047317 Bacteria 5292
340 Ga0495636_0001963 3300047318 Bacteria 7879
341 Ga0495636_0004008 3300047318 Bacteria 5756
342 Ga0495636_0074845 3300047318 Bacteria 1451
343 Ga0495636_0082527 3300047318 Bacteria 1386
344 Ga0495636_0127691 3300047318 Bacteria 1129
345 Ga0495672_0000055 3300047320 Bacteria 229428
346 Ga0495672_0000438 3300047320 Bacteria 49699
347 Ga0495672_0006889 3300047320 Bacteria 8670
348 Ga0495672_0011561 3300047320 Bacteria 6221
349 Ga0495672_0048154 3300047320 Bacteria 2529
350 Ga0495672_0065226 3300047320 Bacteria 2082
351 Ga0495676_0000100 3300047321 Bacteria 65339
352 Ga0495676_0112340 3300047321 Bacteria 1996
353 Ga0495680_0091495 3300047322 Bacteria 2280
354 Ga0495683_0000240 3300047323 Bacteria 49829
355 Ga0495683_0004693 3300047323 Bacteria 7693
356 Ga0495683_0011606 3300047323 Bacteria 4635
357 Ga0495683_0135152 3300047323 Bacteria 1159
358 Ga0495687_000012 3300047443 Bacteria 391586
359 Ga0495687_000276 3300047443 Bacteria 67876
360 Ga0495687_000545 3300047443 Bacteria 45047
361 Ga0495687_003737 3300047443 Bacteria 10775
362 Ga0495675_0001311 3300047444 Bacteria 15074
363 Ga0495675_0025498 3300047444 Bacteria 3769
364 Ga0495677_0000050 3300047445 Bacteria 67980
365 Ga0495677_0000125 3300047445 Bacteria 37212
366 Ga0495677_0001806 3300047445 Bacteria 8554
367 Ga0495677_0004244 3300047445 Bacteria 5519
368 Ga0495677_0024395 3300047445 Bacteria 2193
369 Ga0495677_0094637 3300047445 Bacteria 1127
370 Ga0495679_004579 3300047446 Bacteria 6316
371 Ga0495679_021074 3300047446 Bacteria 2258
372 Ga0495685_007289 3300047447 Bacteria 3647
373 Ga0495685_022923 3300047447 Bacteria 2148
374 Ga0495685_030299 3300047447 Bacteria 1860
375 Ga0495685_039556 3300047447 Bacteria 1614
376 Ga0495681_0000251 3300047470 Bacteria 43835
377 Ga0495681_0000744 3300047470 Bacteria 25082
378 Ga0495681_0003067 3300047470 Bacteria 11719
379 Ga0495681_0003256 3300047470 Bacteria 11321
380 Ga0495681_0024606 3300047470 Bacteria 3167
381 Ga0495681_0124447 3300047470 Bacteria 1103
382 Ga0495681_0202950 3300047470 Bacteria 803
383 Ga0495686_0000474 3300047472 Bacteria 59917
384 Ga0495686_0075320 3300047472 Bacteria 2069
385 Ga0495686_0079640 3300047472 Bacteria 2003
386 Ga0495593_0001135 3300047673 Bacteria 15510
387 Ga0495602_0007171 3300048088 Bacteria 11680
388 Ga0495614_0003384 3300048089 Bacteria 7136
389 Ga0495614_0005298 3300048089 Bacteria 5819
390 Ga0495615_0002981 3300048090 Bacteria 2786
391 Ga0495626_0000425 3300048091 Bacteria 43228
392 Ga0495626_0003605 3300048091 Bacteria 9848
393 Ga0495626_0003989 3300048091 Bacteria 9221
394 Ga0495626_0011179 3300048091 Bacteria 4757
395 Ga0495626_0014933 3300048091 Bacteria 3986
396 Ga0495626_0021032 3300048091 Bacteria 3244
397 Ga0495626_0025839 3300048091 Bacteria 2868
398 Ga0495626_0028170 3300048091 Bacteria 2725
399 Ga0495626_0053868 3300048091 Bacteria 1849
400 Ga0495626_0132535 3300048091 Bacteria 1063
401 Ga0496100_0260832 3300048903 Bacteria 1285
402 Ga0496101_0011618 3300048904 Bacteria 5848
403 Ga0496102_0000343 3300048905 Bacteria 56826
404 Ga0496102_0000598 3300048905 Bacteria 37839
405 Ga0496102_0022575 3300048905 Bacteria 5576
406 Ga0496102_0031136 3300048905 Bacteria 4783
407 Ga0496102_0292582 3300048905 Bacteria 1535
408 Ga0496102_0357155 3300048905 Bacteria 1375
409 Ga0496102_0491975 3300048905 Bacteria 1148
410 Ga0496103_0003240 3300048906 Bacteria 9984
411 Ga0496103_0053175 3300048906 Bacteria 2509
412 Ga0496103_0305501 3300048906 Bacteria 1023
413 Ga0496108_0272564 3300048911 Bacteria 1473
414 Ga0496109_0017700 3300048912 Bacteria 6251
415 Ga0496110_0000070 3300048913 Bacteria 51596
416 Ga0496110_0032042 3300048913 Bacteria 4537
417 Ga0496113_0000875 3300048916 Bacteria 15804
418 Ga0496115_0046362 3300048918 Bacteria 3473
419 Ga0496116_0156973 3300048919 Bacteria 1254
420 Ga0496122_0000452 3300048925 Bacteria 85514
421 Ga0496123_0000514 3300048926 Bacteria 67374
422 Ga0496124_0045813 3300048927 Bacteria 3749
423 Ga0496125_0000572 3300048928 Bacteria 63057
424 Ga0495678_000025 3300049459 Bacteria 227891
425 Ga0495678_000293 3300049459 Bacteria 54963
426 Ga0495678_001013 3300049459 Bacteria 24008
427 Ga0495678_001856 3300049459 Bacteria 15452
428 Ga0495678_083435 3300049459 Bacteria 1142
429 Ga0495682_0000509 3300049460 Bacteria 26895
430 Ga0495682_0006816 3300049460 Bacteria 4599
431 Ga0495682_0012952 3300049460 Bacteria 3185
432 Ga0495682_0020235 3300049460 Bacteria 2498
433 Ga0495682_0025644 3300049460 Bacteria 2193
434 Ga0501035_0003407 3300049822 Bacteria 15211
435 nmdc:mga00v17_12119_c1 3300050491 Bacteria 4751
436 nmdc:mga0yw44_105408_c1 3300050492 Bacteria 1801
437 nmdc:mga06z11_1721_c1 3300050494 Bacteria 8220
438 nmdc:mga06r32_193032_c1 3300050510 Bacteria 2023
439 nmdc:mga08y16_17757_c1 3300050511 Bacteria 7493
440 nmdc:mga0rr50_79146_c1 3300050513 Bacteria 2531
441 nmdc:mga0a205_354713_c1 3300050515 Bacteria 1334
442 2857558378 2857553236 Bacteria 6166726
443 Ga0496108_0227066
444 Ga0055525_1000047
445 Ga0065165_1001661
446 Ga0070676_10052067
447 Ga0070690_100029948
448 Ga0068869_100110620
449 Ga0068868_100033399
450 Ga0070689_100010889
451 Ga0070661_100517454
452 Ga0070668_100052066
453 Ga0070675_100004650
454 Ga0070673_100235449
455 Ga0070688_100023985
456 Ga0070701_10008302
457 Ga0070663_100077481
458 Ga0070678_100101678
459 Ga0068867_100025257
460 Ga0070685_10414228
461 Ga0070672_100131715
462 Ga0070686_100030597
463 Ga0070664_100231084
464 Ga0070702_100012802
465 Ga0068859_100039987
466 Ga0068863_100111720
467 Ga0068858_100009070
468 Ga0068860_100118002
469 Ga0068862_100024053
470 Ga0075368_10072732
471 Ga0075363_100233748
472 Ga0075364_10036991
473 Ga0075362_10005611
474 Ga0075367_10003206
475 Ga0075428_100032007
476 Ga0075430_100181059
477 Ga0075431_100477961
478 Ga0075433_10359361
479 Ga0075429_100010329
480 Ga0068865_100013141
481 Ga0097620_100039992
482 Ga0075435_100002971
483 Ga0105248_10119826
484 Ga0105249_10543082
485 Ga0157372_10555530
486 Ga0157380_10084105
487 Ga0206351_10805552
488 Ga0213872_10000513
489 Ga0213872_10001816
490 Ga0213872_10003612
491 Ga0213872_10014620
492 Ga0207662_10039831
493 Ga0207681_10194268
494 Ga0207659_10048199
495 Ga0207706_10155121
496 Ga0207709_10038992
497 Ga0207669_10125348
498 Ga0207704_10087382
499 Ga0207691_10054696
500 Ga0207711_10192032
501 Ga0207679_10669440
502 Ga0207651_10478465
503 Ga0207712_10108224
504 Ga0207668_10311839
505 Ga0207658_10095984
506 Ga0207677_10072142
507 Ga0207703_10104790
508 Ga0207678_10028247
509 Ga0207708_10028217
510 Ga0207641_10114527
511 Ga0207648_10000441
512 Ga0207675_100037242
513 Ga0207675_100042240
514 Ga0207683_10264321
515 Ga0207428_10001496
516 Ga0268265_10197680
517 Ga0268264_10108154
518 Ga0265314_10012934
519 Ga0395899_0002799
520 Ga0395899_0119882
521 Ga0395900_0000331
522 Ga0395900_0000763
523 Ga0395900_0004892
524 Ga0395900_0599370
525 Ga0395898_0448436
526 Ga0395905_0257219
527 Ga0395901_0000097
528 Ga0436361_0119822
529 Ga0436361_0147443
530 Ga0436361_0285452
531 Ga0436361_0613234
532 Ga0439448_0043439
533 Ga0495617_029381
534 Ga0495627_000008
535 Ga0495627_000255
536 Ga0495627_002405
537 Ga0495627_066779
538 Ga0495590_0000408
539 Ga0495590_0010629
540 Ga0495591_000043
541 Ga0495591_013065
542 Ga0495591_063415
543 Ga0495629_0046515
544 Ga0495638_0018239
545 Ga0495638_0099275
546 Ga0495653_0012662
547 Ga0495653_0041287
548 Ga0495653_0079168
549 Ga0495650_0000495
550 Ga0495650_0000593
551 Ga0495650_0019398
552 Ga0495580_0046705
553 Ga0495582_0000488
554 Ga0495605_0000024
555 Ga0495605_0002779
556 Ga0495605_0005153
557 Ga0495605_0019740
558 Ga0495605_0049035
559 Ga0495605_0061353
560 Ga0495605_0111686
561 Ga0495639_0042186
562 Ga0495639_0217449
563 Ga0495584_0000209
564 Ga0495584_0005242
565 Ga0495584_0008126
566 Ga0495584_0011375
567 Ga0495584_0014036
568 Ga0495584_0016500
569 Ga0495584_0040714
570 Ga0495584_0155588
571 Ga0495585_0000807
572 Ga0495585_0002717
573 Ga0495585_0020730
574 Ga0495585_0024470
575 Ga0495585_0033028
576 Ga0495585_0042172
577 Ga0495585_0066996
578 Ga0495585_0083484
579 Ga0495585_0183014
580 Ga0495585_0331717
581 Ga0495594_0007941
582 Ga0495594_0010603
583 Ga0495594_0014861
584 Ga0495594_0077309
585 Ga0495594_0117575
586 Ga0495596_0000315
587 Ga0495596_0001158
588 Ga0495596_0001621
589 Ga0495596_0007423
590 Ga0495596_0010862
591 Ga0495596_0012083
592 Ga0495596_0013029
593 Ga0495596_0013088
594 Ga0495596_0017474
595 Ga0495596_0035062
596 Ga0495596_0057962
597 Ga0495596_0108523
598 Ga0495596_0109044
599 Ga0495607_0001333
600 Ga0495607_0009047
601 Ga0495607_0019358
602 Ga0495607_0053376
603 Ga0495583_0000217
604 Ga0495583_0000654
605 Ga0495583_0001243
606 Ga0495583_0001592
607 Ga0495583_0009165
608 Ga0495583_0107723
609 Ga0495606_0001555
610 Ga0495606_0019610
611 Ga0495606_0026382
612 Ga0495606_0046548
613 Ga0495606_0148341
614 Ga0495610_0001254
615 Ga0495616_0000634
616 Ga0495616_0002542
617 Ga0495616_0012675
618 Ga0495616_0013331
619 Ga0495616_0018315
620 Ga0495616_0021860
621 Ga0495616_0024932
622 Ga0495616_0029326
623 Ga0495616_0029625
624 Ga0495616_0037521
625 Ga0495616_0061623
626 Ga0495616_0164093
627 Ga0495630_0025408
628 Ga0495631_0000172
629 Ga0495631_0001269
630 Ga0495631_0002189
631 Ga0495631_0013375
632 Ga0495631_0016214
633 Ga0495631_0024367
634 Ga0495631_0028609
635 Ga0495631_0035139
636 Ga0495631_0059978
637 Ga0495631_0100418
638 Ga0495632_0000073
639 Ga0495632_0000203
640 Ga0495632_0000225
641 Ga0495632_0043046
642 Ga0495637_0000009
643 Ga0495643_0000416
644 Ga0495643_0071054
645 Ga0495644_0004502
646 Ga0495644_0007109
647 Ga0495644_0007793
648 Ga0495644_0010192
649 Ga0495644_0059356
650 Ga0495648_0000290
651 Ga0495648_0000863
652 Ga0495648_0006749
653 Ga0495648_0015517
654 Ga0495648_0120336
655 Ga0495663_0001833
656 Ga0495663_0004646
657 Ga0495666_0000106
658 Ga0495666_0004466
659 Ga0495642_0000859
660 Ga0495642_0002452
661 Ga0495642_0004793
662 Ga0495642_0012470
663 Ga0495642_0022131
664 Ga0495642_0053433
665 Ga0495642_0055022
666 Ga0495642_0058765
667 Ga0495642_0103319
668 Ga0495652_0006446
669 Ga0495654_0002046
670 Ga0495654_0016255
671 Ga0495654_0018509
672 Ga0495654_0021884
673 Ga0495654_0048991
674 Ga0495665_0010278
675 Ga0495665_0017925
676 Ga0495665_0121621
677 Ga0495665_0143732
678 Ga0495640_0014111
679 Ga0495586_0003342
680 Ga0495586_0010194
681 Ga0495609_0000030
682 Ga0495609_0000365
683 Ga0495609_0005387
684 Ga0495609_0006674
685 Ga0495609_0010420
686 Ga0495609_0022350
687 Ga0495609_0073333
688 Ga0495597_0000219
689 Ga0495597_0000609
690 Ga0495597_0000620
691 Ga0495597_0008193
692 Ga0495597_0051090
693 Ga0495597_0094251
694 Ga0495645_0105164
695 Ga0495645_0352246
696 Ga0495622_0015581
697 Ga0495622_0016620
698 Ga0495622_0043338
699 Ga0495633_0001168
700 Ga0495633_0001683
701 Ga0495633_0024340
702 Ga0495633_0175272
703 Ga0495656_0001345
704 Ga0495656_0003825
705 Ga0495668_0000366
706 Ga0495668_0001472
707 Ga0495668_0002624
708 Ga0495668_0003610
709 Ga0495668_0020100
710 Ga0495668_0080931
711 Ga0495668_0089616
712 Ga0495634_0013235
713 Ga0495611_0000202
714 Ga0495611_0002118
715 Ga0495611_0009765
716 Ga0495611_0033155
717 Ga0495611_0084438
718 Ga0495611_0106603
719 Ga0495611_0139630
720 Ga0495625_0007131
721 Ga0495625_0075052
722 Ga0495625_0082792
723 Ga0495625_0263178
724 Ga0495635_0011829
725 Ga0495659_0001489
726 Ga0495659_0122304
727 Ga0495661_0000209
728 Ga0495661_0000949
729 Ga0495661_0000954
730 Ga0495661_0001862
731 Ga0495661_0022890
732 Ga0495661_0055074
733 Ga0495661_0057352
734 Ga0495661_0106622
735 Ga0495661_0125558
736 Ga0495588_0013104
737 Ga0495588_0031808
738 Ga0495588_0042664
739 Ga0495588_0084522
740 Ga0495588_0225218
741 Ga0495588_0281973
742 Ga0495623_0004664
743 Ga0495623_0012165
744 Ga0495623_0100002
745 Ga0495646_0130030
746 Ga0495669_0000206
747 Ga0495669_0000930
748 Ga0495669_0019025
749 Ga0495669_0030342
750 Ga0495669_0096203
751 Ga0495613_0021149
752 Ga0495613_0031028
753 Ga0495670_0002680
754 Ga0495670_0015186
755 Ga0495670_0015766
756 Ga0495670_0138999
757 Ga0495671_0000777
758 Ga0495671_0003195
759 Ga0495671_0005354
760 Ga0495671_0055958
761 Ga0495671_0205257
762 Ga0495649_0000742
763 Ga0495649_0033591
764 Ga0495649_0123576
765 Ga0495589_0000021
766 Ga0495589_0000505
767 Ga0495589_0000598
768 Ga0495589_0002745
769 Ga0495589_0009424
770 Ga0495589_0010296
771 Ga0495589_0012203
772 Ga0495589_0053102
773 Ga0495600_0065405
774 Ga0495660_0000337
775 Ga0495660_0006888
776 Ga0495660_0009542
777 Ga0495660_0010295
778 Ga0495660_0019644
779 Ga0495660_0045580
780 Ga0495604_0005157
781 Ga0495604_0020398
782 Ga0495636_0001963
783 Ga0495636_0004008
784 Ga0495636_0074845
785 Ga0495636_0082527
786 Ga0495636_0127691
787 Ga0495672_0000055
788 Ga0495672_0000438
789 Ga0495672_0006889
790 Ga0495672_0011561
791 Ga0495672_0048154
792 Ga0495672_0065226
793 Ga0495676_0000100
794 Ga0495676_0112340
795 Ga0495680_0091495
796 Ga0495683_0000240
797 Ga0495683_0004693
798 Ga0495683_0011606
799 Ga0495683_0135152
800 Ga0495687_000012
801 Ga0495687_000276
802 Ga0495687_000545
803 Ga0495687_003737
804 Ga0495675_0001311
805 Ga0495675_0025498
806 Ga0495677_0000050
807 Ga0495677_0000125
808 Ga0495677_0001806
809 Ga0495677_0004244
810 Ga0495677_0024395
811 Ga0495677_0094637
812 Ga0495679_004579
813 Ga0495679_021074
814 Ga0495685_007289
815 Ga0495685_022923
816 Ga0495685_030299
817 Ga0495685_039556
818 Ga0495681_0000251
819 Ga0495681_0000744
820 Ga0495681_0003067
821 Ga0495681_0003256
822 Ga0495681_0024606
823 Ga0495681_0124447
824 Ga0495681_0202950
825 Ga0495686_0000474
826 Ga0495686_0075320
827 Ga0495686_0079640
828 Ga0495593_0001135
829 Ga0495602_0007171
830 Ga0495614_0003384
831 Ga0495614_0005298
832 Ga0495615_0002981
833 Ga0495626_0000425
834 Ga0495626_0003605
835 Ga0495626_0003989
836 Ga0495626_0011179
837 Ga0495626_0014933
838 Ga0495626_0021032
839 Ga0495626_0025839
840 Ga0495626_0028170
841 Ga0495626_0053868
842 Ga0495626_0132535
843 Ga0496100_0260832
844 Ga0496101_0011618
845 Ga0496102_0000343
846 Ga0496102_0000598
847 Ga0496102_0022575
848 Ga0496102_0031136
849 Ga0496102_0292582
850 Ga0496102_0357155
851 Ga0496102_0491975
852 Ga0496103_0003240
853 Ga0496103_0053175
854 Ga0496103_0305501
855 Ga0496108_0272564
856 Ga0496109_0017700
857 Ga0496110_0000070
858 Ga0496110_0032042
859 Ga0496113_0000875
860 Ga0496115_0046362
861 Ga0496116_0156973
862 Ga0496122_0000452
863 Ga0496123_0000514
864 Ga0496124_0045813
865 Ga0496125_0000572
866 Ga0495678_000025
867 Ga0495678_000293
868 Ga0495678_001013
869 Ga0495678_001856
870 Ga0495678_083435
871 Ga0495682_0000509
872 Ga0495682_0006816
873 Ga0495682_0012952
874 Ga0495682_0020235
875 Ga0495682_0025644
876 Ga0501035_0003407
877 nmdc:mga00v17_12119_c1
878 nmdc:mga0yw44_105408_c1
879 nmdc:mga06z11_1721_c1
880 nmdc:mga06r32_193032_c1
881 nmdc:mga08y16_17757_c1
882 nmdc:mga0rr50_79146_c1
883 nmdc:mga0a205_354713_c1
884 2857558378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18917

LiaI-LiaF-like_TM1

LiaI-LiaF-like transmembrane region

84

125

0.95

PF22570

LiaF-TM

LiaF transmembrane domain

34

132

0.95

PF18917

LiaI-LiaF-like_TM1

LiaI-LiaF-like transmembrane region

33

75

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nch-assembly1.cif.gz_B crystal structure of cdp-chase: raster data collection 0.8036 40 83
6nci-assembly1.cif.gz_B crystal structure of cdp-chase: vector data collection 0.8024 40 80
3m1g-assembly2.cif.gz_C the structure of a putative glutathione s-transferase from corynebacterium glutamicum 0.7936 46 84
7s5c-assembly1.cif.gz_E m. xanthus ferritin-like protein encb 0.7794 45 86
7s5c-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.7713 45 87
ID Description Score Start End Superfamily
6nciB01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8272 44 75 6.10.250.1120
af_Q4D4F2_2_196_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.815 45 80 1.25.10.10
3m1gC02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.7936 46 84 1.20.1050.10
5ffdA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7933 45 86 1.20.1260.10
af_Q01992_71_189_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.793 45 79 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A2V8LIQ0-F1-model_v4 Uncharacterized protein 0.9733 163 234
AF-B9THN5-F1-model_v4 Uncharacterized protein 0.9695 138 223
AF-A0A3N5ZKF6-F1-model_v4 Uncharacterized protein 0.9685 120 234
AF-A0A350JJY1-F1-model_v4 Uncharacterized protein 0.9645 128 233
AF-A0A258BK88-F1-model_v4 Cell wall-active antibiotics response LiaF-like C-terminal domain-containing protein 0.9628 163 234

Map