F444895

General Info

Members Datasets Scaffolds Average Seq Length
442 216 442 463

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10065760|Ga0207668_100657602
Length 535
Sequence MSPCLCRLKVISKRQRLRSHAAAKHIELGLSVLSESETAGDRFFSLVKSFRQVMESMRVAVVKVYLALLLTLLVGGPMLVGQKAMAQATTTASASPADRLAALEKQASDNATAIAAAQTSGDNAWMLVSAALVLMMSGPGLALFYAGLVRKKNVLGTMMQTFAMMAVITVLWAVVTYSLAFGEGNAFIGGFHNMFLRGVGLVPDVKYAATIPLQTFMVYQLMFAIITPALITGAFAERMKFSSMLVFMILWALFIYSPMAHMVWGKGGFLNAALGGRLPCLDFAGGTVVHVTSGVSALVTAIYLGKRLGYPKEPMPPHSVVLSFIGACLLWVGWFGFNAGSALSAGTLATSAFVATHFGAAAAAIGWSAAEWLRQGKASALGAISGXXXXLVAITPAAGFVTPMSGLWIGLIAGVFCYFMVVKVKALFGYDDSLDAFGVHGAGGTLGALLTGFFANSAINPIFGKDKPTGLFEGNWHQVLNQAAGVAIAWTISIVGTLIILFLVDKVMGLRVSVDDERDGLDLSQHGEEGYDWAH

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 3.62
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10065962 3300003316 Bacteria 3356
2 Ga0070658_10000007 3300005327 Bacteria 349444
3 Ga0070658_10016767 3300005327 Bacteria 5864
4 Ga0070658_10030777 3300005327 Bacteria 4311
5 Ga0070683_100000063 3300005329 Bacteria 79423
6 Ga0070683_100017801 3300005329 Bacteria 6279
7 Ga0070683_100027721 3300005329 Bacteria 5111
8 Ga0070683_100065441 3300005329 Bacteria 3384
9 Ga0070670_100022763 3300005331 Bacteria 5392
10 Ga0070670_100045281 3300005331 Bacteria 3781
11 Ga0070660_100009595 3300005339 Bacteria 6816
12 Ga0070660_100017843 3300005339 Bacteria 5177
13 Ga0070660_100098540 3300005339 Bacteria 2314
14 Ga0070661_100008049 3300005344 Bacteria 7278
15 Ga0070661_100115979 3300005344 Bacteria 2003
16 Ga0070692_10011885 3300005345 Bacteria 4014
17 Ga0070671_100000429 3300005355 Bacteria 29172
18 Ga0070659_100003992 3300005366 Bacteria 10505
19 Ga0070659_100033495 3300005366 Bacteria 3990
20 Ga0070659_100075807 3300005366 Bacteria 2681
21 Ga0070709_10001219 3300005434 Bacteria 14108
22 Ga0070709_10069120 3300005434 Bacteria 2274
23 Ga0070714_100076807 3300005435 Bacteria 2900
24 Ga0070714_100079446 3300005435 Bacteria 2852
25 Ga0070713_100000461 3300005436 Bacteria 25984
26 Ga0070713_100001905 3300005436 Bacteria 13442
27 Ga0070713_100029875 3300005436 Bacteria 4322
28 Ga0070713_100051997 3300005436 Bacteria 3390
29 Ga0070711_100052412 3300005439 Bacteria 2807
30 Ga0070711_100090159 3300005439 Bacteria 2207
31 Ga0070708_100007563 3300005445 Bacteria 8698
32 Ga0070663_100019462 3300005455 Bacteria 4475
33 Ga0070678_100019714 3300005456 Bacteria 4406
34 Ga0070678_100045787 3300005456 Bacteria 3132
35 Ga0070662_100077109 3300005457 Bacteria 2473
36 Ga0070662_100133781 3300005457 Bacteria 1915
37 Ga0070681_10007366 3300005458 Bacteria 10756
38 Ga0070681_10009425 3300005458 Bacteria 9608
39 Ga0070681_10023633 3300005458 Bacteria 6184
40 Ga0070681_10087148 3300005458 Bacteria 3075
41 Ga0070699_100000753 3300005518 Bacteria 29961
42 Ga0070699_100025672 3300005518 Bacteria 5079
43 Ga0070679_100002145 3300005530 Bacteria 17787
44 Ga0070679_100021139 3300005530 Bacteria 6349
45 Ga0070679_100097887 3300005530 Bacteria 2921
46 Ga0070679_100179955 3300005530 Bacteria 2087
47 Ga0070684_100000089 3300005535 Bacteria 59395
48 Ga0070684_100009023 3300005535 Bacteria 7834
49 Ga0070684_100032260 3300005535 Bacteria 4464
50 Ga0070684_100116079 3300005535 Bacteria 2404
51 Ga0068853_100025543 3300005539 Bacteria 4957
52 Ga0068853_100045286 3300005539 Bacteria 3767
53 Ga0068853_100091136 3300005539 Bacteria 2680
54 Ga0070665_100022304 3300005548 Bacteria 6371
55 Ga0070665_100025415 3300005548 Bacteria 5968
56 Ga0068855_100009876 3300005563 Bacteria 11511
57 Ga0068855_100030240 3300005563 Bacteria 6478
58 Ga0068855_100057365 3300005563 Bacteria 4565
59 Ga0070664_100013503 3300005564 Bacteria 6654
60 Ga0070664_100034658 3300005564 Bacteria 4234
61 Ga0068857_100025768 3300005577 Bacteria 5178
62 Ga0068854_100002891 3300005578 Bacteria 10676
63 Ga0068856_100017545 3300005614 Bacteria 6936
64 Ga0068856_100042762 3300005614 Bacteria 4458
65 Ga0068856_100046391 3300005614 Bacteria 4280
66 Ga0068852_100034025 3300005616 Bacteria 4238
67 Ga0068852_100038794 3300005616 Bacteria 4006
68 Ga0068852_100042908 3300005616 Bacteria 3832
69 Ga0068859_100016556 3300005617 Bacteria 7402
70 Ga0068864_100008637 3300005618 Bacteria 8405
71 Ga0068864_100019140 3300005618 Bacteria 5724
72 Ga0068864_100065073 3300005618 Bacteria 3163
73 Ga0068851_10003533 3300005834 Bacteria 6955
74 Ga0068863_100006574 3300005841 Bacteria 11408
75 Ga0068863_100020699 3300005841 Bacteria 6283
76 Ga0068858_100048646 3300005842 Bacteria 3927
77 Ga0068858_100237910 3300005842 Bacteria 1727
78 Ga0068860_100043909 3300005843 Bacteria 4262
79 Ga0081539_10001130 3300005985 Bacteria 48420
80 Ga0070717_10015061 3300006028 Bacteria 5962
81 Ga0070717_10033023 3300006028 Bacteria 4173
82 Ga0070717_10066758 3300006028 Bacteria 2992
83 Ga0070716_100056595 3300006173 Bacteria 2249
84 Ga0070712_100000506 3300006175 Bacteria 22281
85 Ga0070712_100045778 3300006175 Bacteria 3022
86 Ga0070712_100120836 3300006175 Bacteria 1970
87 Ga0097621_100026337 3300006237 Bacteria 4560
88 Ga0068871_100015595 3300006358 Bacteria 5694
89 Ga0075431_100006164 3300006847 Bacteria 11898
90 Ga0075431_100054603 3300006847 Bacteria 4119
91 Ga0075436_100026299 3300006914 Bacteria 4006
92 Ga0097620_100016557 3300006931 Bacteria 7402
93 Ga0075435_100049414 3300007076 Bacteria 3383
94 Ga0099794_10071565 3300007265 Bacteria 1699
95 Ga0105240_10000903 3300009093 Bacteria 53014
96 Ga0105240_10002616 3300009093 Bacteria 28749
97 Ga0105240_10021776 3300009093 Bacteria 8517
98 Ga0105240_10032891 3300009093 Bacteria 6707
99 Ga0105240_10072810 3300009093 Bacteria 4245
100 Ga0105240_10121221 3300009093 Bacteria 3148
101 Ga0105245_10002083 3300009098 Bacteria 18160
102 Ga0105245_10003047 3300009098 Bacteria 15009
103 Ga0105245_10010631 3300009098 Bacteria 8007
104 Ga0105245_10019206 3300009098 Bacteria 5985
105 Ga0105243_10020438 3300009148 Bacteria 5020
106 Ga0105243_10057967 3300009148 Bacteria 3085
107 Ga0105241_10033397 3300009174 Bacteria 3863
108 Ga0105248_10009955 3300009177 Bacteria 10467
109 Ga0105248_10018604 3300009177 Bacteria 7680
110 Ga0105248_10034546 3300009177 Bacteria 5655
111 Ga0105248_10048589 3300009177 Bacteria 4760
112 Ga0105248_10115869 3300009177 Bacteria 3022
113 Ga0105248_10173445 3300009177 Bacteria 2431
114 Ga0105248_10203335 3300009177 Bacteria 2232
115 Ga0105237_10006811 3300009545 Bacteria 12599
116 Ga0105237_10009958 3300009545 Bacteria 10142
117 Ga0105237_10036600 3300009545 Bacteria 4967
118 Ga0105237_10077921 3300009545 Bacteria 3304
119 Ga0105237_10194359 3300009545 Bacteria 2029
120 Ga0105237_10289760 3300009545 Bacteria 1640
121 Ga0105238_10006161 3300009551 Bacteria 11903
122 Ga0105238_10020785 3300009551 Bacteria 6686
123 Ga0105238_10090082 3300009551 Bacteria 3055
124 Ga0105239_10010040 3300010375 Bacteria 10614
125 Ga0105239_10017516 3300010375 Bacteria 7923
126 Ga0105239_10019392 3300010375 Bacteria 7509
127 Ga0105239_10119440 3300010375 Bacteria 2926
128 Ga0105239_10245070 3300010375 Bacteria 2012
129 Ga0105239_10412574 3300010375 Bacteria 1529
130 Ga0105246_10015230 3300011119 Bacteria 4852
131 Ga0105246_10112136 3300011119 Bacteria 2005
132 Ga0157370_10001720 3300013104 Bacteria 26945
133 Ga0157370_10005842 3300013104 Bacteria 13747
134 Ga0157370_10043585 3300013104 Bacteria 4316
135 Ga0157370_10054800 3300013104 Bacteria 3801
136 Ga0157370_10096396 3300013104 Bacteria 2775
137 Ga0157370_10146565 3300013104 Bacteria 2198
138 Ga0157370_10205463 3300013104 Bacteria 1826
139 Ga0157369_10004154 3300013105 Bacteria 17157
140 Ga0157369_10006100 3300013105 Bacteria 13992
141 Ga0157369_10013784 3300013105 Bacteria 9138
142 Ga0157369_10016811 3300013105 Bacteria 8223
143 Ga0157369_10017943 3300013105 Bacteria 7945
144 Ga0157369_10027593 3300013105 Bacteria 6291
145 Ga0157369_10030064 3300013105 Bacteria 5994
146 Ga0157369_10040564 3300013105 Bacteria 5081
147 Ga0157369_10118784 3300013105 Bacteria 2806
148 Ga0157369_10140129 3300013105 Bacteria 2559
149 Ga0157374_10003180 3300013296 Bacteria 13792
150 Ga0157374_10018388 3300013296 Bacteria 6166
151 Ga0157374_10019202 3300013296 Bacteria 6048
152 Ga0157378_10007993 3300013297 Bacteria 9233
153 Ga0157378_10017818 3300013297 Bacteria 6235
154 Ga0157378_10152434 3300013297 Bacteria 2154
155 Ga0157378_10167812 3300013297 Bacteria 2057
156 Ga0157378_10170110 3300013297 Bacteria 2043
157 Ga0163162_10003253 3300013306 Bacteria 15534
158 Ga0157372_10017408 3300013307 Bacteria 7713
159 Ga0157372_10025905 3300013307 Bacteria 6378
160 Ga0157372_10062938 3300013307 Bacteria 4158
161 Ga0157372_10088297 3300013307 Bacteria 3520
162 Ga0157372_10121594 3300013307 Bacteria 2999
163 Ga0157372_10165997 3300013307 Bacteria 2553
164 Ga0157372_10192188 3300013307 Bacteria 2364
165 Ga0157375_10019887 3300013308 Bacteria 6121
166 Ga0163163_10012609 3300014325 Bacteria 7707
167 Ga0163163_10312399 3300014325 Bacteria 1625
168 Ga0182008_10038939 3300014497 Bacteria 2376
169 Ga0157376_10017455 3300014969 Bacteria 5475
170 Ga0157376_10026840 3300014969 Bacteria 4556
171 Ga0157376_10033123 3300014969 Bacteria 4156
172 Ga0157376_10050613 3300014969 Bacteria 3447
173 Ga0182007_10006890 3300015262 Bacteria 4831
174 Ga0213872_10000901 3300021361 Bacteria 21377
175 Ga0213872_10002030 3300021361 Bacteria 12297
176 Ga0213872_10012963 3300021361 Bacteria 3910
177 Ga0213876_10002419 3300021384 Bacteria 10974
178 Ga0213875_10000769 3300021388 Bacteria 24016
179 Ga0207647_10001523 3300025904 Bacteria 17820
180 Ga0207699_10033347 3300025906 Bacteria 2910
181 Ga0207699_10037468 3300025906 Bacteria 2772
182 Ga0207705_10000013 3300025909 Bacteria 451680
183 Ga0207705_10000585 3300025909 Bacteria 30596
184 Ga0207705_10018627 3300025909 Bacteria 4964
185 Ga0207654_10002229 3300025911 Bacteria 9952
186 Ga0207654_10102072 3300025911 Unclassified 1769
187 Ga0207707_10030731 3300025912 Bacteria 4698
188 Ga0207707_10031492 3300025912 Bacteria 4641
189 Ga0207707_10041436 3300025912 Bacteria 4022
190 Ga0207707_10114360 3300025912 Bacteria 2358
191 Ga0207695_10003059 3300025913 Bacteria 23974
192 Ga0207695_10103576 3300025913 Bacteria 2837
193 Ga0207671_10007472 3300025914 Bacteria 9479
194 Ga0207671_10051340 3300025914 Bacteria 3056
195 Ga0207693_10000065 3300025915 Bacteria 91476
196 Ga0207693_10001204 3300025915 Bacteria 23045
197 Ga0207693_10026042 3300025915 Bacteria 4632
198 Ga0207693_10041550 3300025915 Bacteria 3620
199 Ga0207663_10054316 3300025916 Bacteria 2507
200 Ga0207663_10085139 3300025916 Bacteria 2081
201 Ga0207660_10018579 3300025917 Bacteria 4636
202 Ga0207660_10033768 3300025917 Bacteria 3542
203 Ga0207657_10000099 3300025919 Bacteria 83148
204 Ga0207657_10002042 3300025919 Bacteria 21838
205 Ga0207657_10029142 3300025919 Bacteria 5029
206 Ga0207649_10005481 3300025920 Bacteria 6866
207 Ga0207649_10083726 3300025920 Bacteria 2071
208 Ga0207652_10003176 3300025921 Bacteria 13673
209 Ga0207694_10009253 3300025924 Bacteria 7433
210 Ga0207650_10108040 3300025925 Bacteria 2150
211 Ga0207687_10004086 3300025927 Bacteria 9783
212 Ga0207687_10011383 3300025927 Bacteria 5815
213 Ga0207687_10017958 3300025927 Bacteria 4667
214 Ga0207687_10024489 3300025927 Bacteria 4033
215 Ga0207687_10026348 3300025927 Bacteria 3892
216 Ga0207700_10000988 3300025928 Bacteria 16396
217 Ga0207700_10002339 3300025928 Bacteria 10874
218 Ga0207700_10005050 3300025928 Bacteria 7849
219 Ga0207700_10028324 3300025928 Bacteria 3937
220 Ga0207700_10036669 3300025928 Bacteria 3544
221 Ga0207700_10071426 3300025928 Bacteria 2673
222 Ga0207664_10041378 3300025929 Bacteria 3589
223 Ga0207664_10126320 3300025929 Bacteria 2148
224 Ga0207690_10024883 3300025932 Bacteria 3753
225 Ga0207690_10049728 3300025932 Bacteria 2796
226 Ga0207706_10002670 3300025933 Bacteria 17375
227 Ga0207686_10025498 3300025934 Bacteria 3439
228 Ga0207709_10077688 3300025935 Bacteria 2129
229 Ga0207665_10011868 3300025939 Bacteria 5721
230 Ga0207665_10019608 3300025939 Unclassified 4447
231 Ga0207691_10203264 3300025940 Bacteria 1723
232 Ga0207711_10007259 3300025941 Bacteria 9285
233 Ga0207711_10008123 3300025941 Bacteria 8785
234 Ga0207711_10088678 3300025941 Bacteria 2716
235 Ga0207711_10097773 3300025941 Bacteria 2592
236 Ga0207711_10181977 3300025941 Bacteria 1912
237 Ga0207689_10033911 3300025942 Bacteria 4240
238 Ga0207661_10000020 3300025944 Bacteria 216011
239 Ga0207661_10033518 3300025944 Bacteria 3987
240 Ga0207661_10175872 3300025944 Bacteria 1866
241 Ga0207667_10015158 3300025949 Bacteria 8765
242 Ga0207667_10017720 3300025949 Bacteria 8011
243 Ga0207667_10022987 3300025949 Bacteria 6872
244 Ga0207667_10075770 3300025949 Bacteria 3492
245 Ga0207668_10065760 3300025972 Bacteria 2568
246 Ga0207640_10020019 3300025981 Bacteria 3965
247 Ga0207677_10127546 3300026023 Bacteria 1925
248 Ga0207703_10017507 3300026035 Bacteria 5593
249 Ga0207703_10263718 3300026035 Bacteria 1558
250 Ga0207678_10003651 3300026067 Bacteria 13832
251 Ga0207678_10010640 3300026067 Bacteria 8082
252 Ga0207702_10134627 3300026078 Bacteria 2228
253 Ga0207641_10013496 3300026088 Bacteria 6700
254 Ga0207648_10047101 3300026089 Bacteria 3780
255 Ga0207676_10017137 3300026095 Bacteria 5248
256 Ga0207676_10050011 3300026095 Bacteria 3256
257 Ga0207676_10116418 3300026095 Bacteria 2246
258 Ga0207674_10005608 3300026116 Bacteria 14880
259 Ga0207683_10085124 3300026121 Bacteria 2811
260 Ga0207698_10028258 3300026142 Bacteria 3997
261 Ga0207698_10036137 3300026142 Bacteria 3623
262 Ga0268266_10000895 3300028379 Bacteria 38492
263 Ga0268266_10002668 3300028379 Bacteria 18781
264 Ga0268266_10004148 3300028379 Bacteria 13990
265 Ga0268266_10011773 3300028379 Bacteria 7585
266 Ga0268266_10069904 3300028379 Bacteria 3043
267 Ga0265338_10008294 3300028800 Bacteria 12644
268 Ga0265338_10037616 3300028800 Bacteria 4602
269 Ga0265320_10000655 3300031240 Bacteria 26440
270 Ga0265325_10002348 3300031241 Bacteria 12809
271 Ga0265325_10067996 3300031241 Bacteria 1794
272 Ga0265340_10032792 3300031247 Bacteria 2591
273 Ga0265339_10019402 3300031249 Bacteria 3992
274 Ga0265331_10002620 3300031250 Bacteria 12070
275 Ga0265331_10009609 3300031250 Bacteria 5419
276 Ga0265316_10003196 3300031344 Bacteria 16651
277 Ga0265316_10024356 3300031344 Bacteria 5074
278 Ga0265313_10024272 3300031595 Bacteria 3242
279 Ga0265314_10006088 3300031711 Bacteria 10720
280 Ga0265342_10026325 3300031712 Bacteria 3646
281 Ga0307510_10138407 3300033180 Bacteria 2085
282 Ga0373926_0001437 3300035083 Bacteria 7245
283 Ga0373926_0006952 3300035083 Bacteria 3761
284 Ga0373936_0011473 3300035113 Bacteria 3354
285 Ga0373954_0001548 3300035118 Bacteria 9372
286 Ga0373943_0006986 3300035170 Bacteria 5064
287 Ga0373955_0030623 3300035172 Bacteria 2811
288 Ga0373955_0032365 3300035172 Bacteria 2744
289 Ga0373955_0049618 3300035172 Bacteria 2279
290 Ga0316574_0139593 3300035398 Bacteria 1561
291 Ga0373924_0000010 3300035410 Bacteria 49782
292 Ga0373935_0133606 3300035692 Bacteria 1670
293 Ga0373927_0004655 3300035695 Bacteria 9565
294 Ga0373927_0035711 3300035695 Bacteria 3232
295 Ga0373947_0010835 3300035725 Bacteria 5232
296 Ga0373947_0020284 3300035725 Bacteria 3836
297 Ga0373947_0055007 3300035725 Unclassified 2403
298 Ga0373937_0000132 3300036401 Bacteria 72758
299 Ga0373937_0114044 3300036401 Bacteria 2515
300 Ga0373925_0001957 3300037068 Bacteria 17042
301 Ga0436364_0197022 3300037853 Bacteria 80312
302 Ga0436364_0309225 3300037853 Bacteria 9567
303 Ga0436364_1321514 3300037853 Bacteria 1880
304 Ga0436365_0420090 3300039437 Bacteria 19560
305 Ga0436365_1233600 3300039437 Bacteria 3192
306 Ga0436360_0027910 3300039438 Bacteria 1815
307 Ga0436360_0161883 3300039438 Bacteria 14356
308 Ga0436360_1036151 3300039438 Bacteria 10193
309 Ga0436361_0307406 3300039447 Bacteria 13409
310 Ga0436361_0696344 3300039447 Bacteria 16797
311 Ga0436361_0779674 3300039447 Bacteria 61407
312 Ga0436363_0145130 3300039450 Bacteria 3725
313 Ga0436363_1107018 3300039450 Bacteria 2784
314 Ga0436363_1371418 3300039450 Bacteria 2109
315 Ga0436363_1403142 3300039450 Bacteria 4242
316 Ga0436362_0525229 3300039453 Bacteria 2693
317 Ga0436362_1239677 3300039453 Bacteria 5399
318 Ga0466964_0046345 3300044706 Bacteria 1772
319 Ga0466959_0057283 3300045049 Bacteria 2841
320 Ga0466967_0144534 3300045976 Bacteria 2218
321 Ga0495603_0039861 3300046455 Bacteria 2813
322 Ga0495629_0006654 3300046459 Bacteria 8553
323 Ga0495629_0025160 3300046459 Bacteria 4234
324 Ga0495638_0075905 3300046460 Bacteria 2048
325 Ga0495650_0000038 3300046471 Bacteria 377530
326 Ga0495650_0006759 3300046471 Bacteria 7093
327 Ga0495650_0006951 3300046471 Bacteria 6921
328 Ga0495580_0001231 3300046472 Bacteria 22586
329 Ga0495580_0001517 3300046472 Bacteria 20424
330 Ga0495580_0001935 3300046472 Bacteria 18202
331 Ga0495580_0007097 3300046472 Bacteria 9027
332 Ga0495580_0083582 3300046472 Bacteria 2224
333 Ga0495582_0000405 3300046473 Bacteria 23553
334 Ga0495582_0003388 3300046473 Bacteria 8971
335 Ga0495582_0039217 3300046473 Bacteria 2608
336 Ga0495582_0123463 3300046473 Bacteria 1460
337 Ga0495639_0001954 3300046475 Bacteria 9140
338 Ga0495662_0001280 3300046476 Bacteria 12438
339 Ga0495664_0009472 3300046477 Bacteria 5451
340 Ga0495594_0000395 3300046499 Bacteria 21937
341 Ga0495594_0000883 3300046499 Bacteria 15463
342 Ga0495594_0010925 3300046499 Bacteria 4713
343 Ga0495583_0016461 3300046506 Bacteria 3972
344 Ga0495606_0060363 3300046507 Bacteria 2429
345 Ga0495608_0046086 3300046511 Bacteria 2903
346 Ga0495616_0053817 3300046513 Bacteria 1999
347 Ga0495644_0000219 3300046523 Bacteria 26962
348 Ga0495666_0000810 3300046526 Bacteria 14490
349 Ga0495652_0006431 3300046529 Bacteria 10927
350 Ga0495652_0007766 3300046529 Bacteria 9859
351 Ga0495652_0061067 3300046529 Bacteria 3183
352 Ga0495652_0073899 3300046529 Bacteria 2837
353 Ga0495652_0104318 3300046529 Bacteria 2293
354 Ga0495665_0002595 3300046531 Bacteria 9747
355 Ga0495665_0041815 3300046531 Bacteria 2440
356 Ga0495665_0049962 3300046531 Bacteria 2217
357 Ga0495640_0007633 3300046533 Bacteria 8502
358 Ga0495586_0002392 3300046535 Bacteria 10193
359 Ga0495587_0083537 3300046536 Bacteria 1850
360 Ga0495645_0002780 3300046543 Bacteria 11868
361 Ga0495645_0014391 3300046543 Bacteria 5613
362 Ga0495645_0117287 3300046543 Bacteria 1878
363 Ga0495633_0034650 3300046558 Bacteria 2427
364 Ga0495667_0003008 3300046559 Bacteria 11307
365 Ga0495667_0014467 3300046559 Bacteria 5331
366 Ga0495667_0072599 3300046559 Bacteria 2243
367 Ga0495667_0170482 3300046559 Bacteria 1398
368 Ga0495634_0008727 3300046642 Bacteria 7516
369 Ga0495625_0024832 3300046660 Bacteria 4553
370 Ga0495625_0039604 3300046660 Bacteria 3440
371 Ga0495635_0011585 3300046663 Bacteria 6181
372 Ga0495659_0019591 3300046664 Bacteria 2264
373 Ga0495661_0020075 3300046665 Bacteria 4370
374 Ga0495599_0004912 3300046678 Bacteria 7944
375 Ga0495623_0014292 3300046679 Bacteria 5141
376 Ga0495613_0004130 3300046689 Bacteria 10864
377 Ga0495613_0058484 3300046689 Bacteria 2829
378 Ga0495624_0003027 3300046690 Bacteria 12587
379 Ga0495649_0007234 3300046694 Bacteria 6800
380 Ga0495600_0050474 3300046809 Bacteria 2715
381 Ga0495581_0012382 3300047315 Bacteria 4941
382 Ga0495604_0015963 3300047317 Bacteria 5995
383 Ga0495604_0021328 3300047317 Bacteria 5171
384 Ga0495674_0017116 3300047319 Bacteria 6751
385 Ga0495674_0038007 3300047319 Bacteria 4324
386 Ga0495674_0052634 3300047319 Bacteria 3581
387 Ga0495674_0192236 3300047319 Bacteria 1696
388 Ga0495676_0005277 3300047321 Bacteria 11829
389 Ga0495680_0024503 3300047322 Bacteria 5005
390 Ga0495675_0026103 3300047444 Bacteria 3724
391 Ga0495677_0025532 3300047445 Bacteria 2144
392 Ga0495684_0014270 3300047471 Bacteria 6113
393 Ga0495686_0000031 3300047472 Bacteria 350171
394 Ga0495686_0002398 3300047472 Bacteria 17807
395 Ga0495686_0003361 3300047472 Bacteria 13943
396 Ga0495686_0007930 3300047472 Bacteria 7882
397 Ga0495602_0039630 3300048088 Bacteria 4336
398 Ga0495602_0069298 3300048088 Bacteria 3024
399 Ga0496100_0115006 3300048903 Bacteria 1875
400 Ga0496102_0099614 3300048905 Bacteria 2698
401 Ga0496103_0026334 3300048906 Bacteria 3521
402 Ga0496104_0000276 3300048907 Bacteria 45779
403 Ga0496104_0094575 3300048907 Bacteria 2859
404 Ga0496104_0357333 3300048907 Bacteria 1373
405 Ga0496105_0004114 3300048908 Bacteria 10907
406 Ga0496105_0049696 3300048908 Bacteria 3463
407 Ga0496105_0081353 3300048908 Bacteria 2675
408 Ga0496108_0028874 3300048911 Bacteria 4590
409 Ga0496112_0014614 3300048915 Bacteria 7295
410 Ga0496112_0020790 3300048915 Bacteria 6229
411 Ga0496112_0066646 3300048915 Bacteria 3553
412 Ga0496112_0205666 3300048915 Bacteria 1927
413 Ga0496113_0009235 3300048916 Bacteria 6469
414 Ga0496115_0194455 3300048918 Bacteria 1676
415 Ga0496126_0000004 3300048929 Bacteria 925026
416 Ga0496126_0000150 3300048929 Bacteria 162748
417 Ga0496126_0000770 3300048929 Bacteria 57986
418 Ga0496126_0010867 3300048929 Bacteria 9487
419 Ga0496126_0055369 3300048929 Bacteria 3589
420 Ga0501036_0003961 3300049572 Bacteria 11901
421 Ga0501037_0007912 3300049573 Bacteria 7791
422 Ga0501043_0003276 3300049579 Bacteria 13348
423 Ga0501046_0002059 3300049580 Bacteria 19089
424 Ga0501047_0011843 3300049581 Bacteria 8248
425 Ga0501047_0147313 3300049581 Bacteria 2230
426 Ga0501048_0126374 3300049582 Bacteria 1808
427 Ga0501073_0031613 3300049589 Bacteria 3776
428 Ga0501073_0064891 3300049589 Bacteria 2546
429 Ga0501074_0107651 3300049590 Bacteria 1995
430 Ga0501080_0010542 3300049742 Bacteria 8464
431 Ga0501035_0030526 3300049822 Bacteria 4911
432 Ga0501035_0194021 3300049822 Bacteria 1745
433 Ga0501044_0044860 3300049823 Bacteria 4584
434 nmdc:mga06r32_10934_c1 3300050510 Bacteria 8173
435 nmdc:mga0n895_195090_c1 3300050512 Bacteria 2056
436 nmdc:mga0rr50_23467_c1 3300050513 Bacteria 4254
437 nmdc:mga08x19_170_c1 3300050514 Bacteria 54086
438 nmdc:mga08x19_53719_c1 3300050514 Bacteria 2592
439 Ga0495601_0021899 3300053077 Bacteria 3920
440 Ga0500651_0000005 3300053093 Bacteria 384761
441 Ga0500595_000011 3300053119 Bacteria 268589
442 Ga0501082_0024694 3300060353 Bacteria 5180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031240 Ga0265320_10000655 Ga0265320_1000065514 386
2 3300031241 Ga0265325_10067996 Ga0265325_100679962 386
3 3300031250 Ga0265331_10002620 Ga0265331_100026202 386
4 3300031711 Ga0265314_10006088 Ga0265314_100060889 386
5 3300031344 Ga0265316_10003196 Ga0265316_1000319610 389
6 3300050514 nmdc:mga08x19_170_c1 nmdc:mga08x19_170_c1_22496_23785 397
7 3300035083 Ga0373926_0001437 Ga0373926_0001437_5768_7069 399
8 3300035172 Ga0373955_0032365 Ga0373955_0032365_88_1440 399
9 3300035695 Ga0373927_0035711 Ga0373927_0035711_596_1897 399
10 3300035725 Ga0373947_0010835 Ga0373947_0010835_521_1822 399
11 3300037068 Ga0373925_0001957 Ga0373925_0001957_4148_5449 399
12 3300046473 Ga0495582_0123463 Ga0495582_0123463_121_1437 403
13 3300046529 Ga0495652_0061067 Ga0495652_0061067_403_1794 403
14 3300046536 Ga0495587_0083537 Ga0495587_0083537_311_1702 403
15 3300046543 Ga0495645_0002780 Ga0495645_0002780_2508_3899 403
16 3300046809 Ga0495600_0050474 Ga0495600_0050474_516_1907 403
17 3300047317 Ga0495604_0015963 Ga0495604_0015963_1121_2512 403
18 3300047319 Ga0495674_0192236 Ga0495674_0192236_219_1610 403
19 3300048088 Ga0495602_0069298 Ga0495602_0069298_1493_2884 403
20 3300048907 Ga0496104_0357333 Ga0496104_0357333_99_1352 405
21 3300046471 Ga0495650_0006951 Ga0495650_0006951_2340_3701 408
22 3300046559 Ga0495667_0072599 Ga0495667_0072599_58_1302 410
23 3300046559 Ga0495667_0170482 Ga0495667_0170482_16_1260 410
24 3300009148 Ga0105243_10057967 Ga0105243_100579672 411
25 3300028800 Ga0265338_10037616 Ga0265338_100376162 411
26 3300031241 Ga0265325_10002348 Ga0265325_1000234810 411
27 3300035170 Ga0373943_0006986 Ga0373943_0006986_1143_2567 411
28 3300035695 Ga0373927_0004655 Ga0373927_0004655_1589_3013 411
29 3300035725 Ga0373947_0020284 Ga0373947_0020284_1888_3312 411
30 3300006028 Ga0070717_10066758 Ga0070717_100667582 413
31 3300005434 Ga0070709_10001219 Ga0070709_100012194 415
32 3300009545 Ga0105237_10194359 Ga0105237_101943591 415
33 3300025915 Ga0207693_10000065 Ga0207693_1000006558 415
34 3300025928 Ga0207700_10000988 Ga0207700_1000098814 415
35 3300005548 Ga0070665_100022304 Ga0070665_1000223043 416
36 3300009098 Ga0105245_10002083 Ga0105245_100020837 416
37 3300028379 Ga0268266_10000895 Ga0268266_1000089539 416
38 3300035172 Ga0373955_0030623 Ga0373955_0030623_736_2130 416
39 3300005436 Ga0070713_100000461 Ga0070713_10000046118 417
40 3300005457 Ga0070662_100133781 Ga0070662_1001337812 417
41 3300005563 Ga0068855_100030240 Ga0068855_1000302405 417
42 3300006358 Ga0068871_100015595 Ga0068871_1000155957 417
43 3300009148 Ga0105243_10020438 Ga0105243_100204382 417
44 3300009177 Ga0105248_10009955 Ga0105248_100099555 417
45 3300010375 Ga0105239_10010040 Ga0105239_1001004011 417
46 3300013296 Ga0157374_10019202 Ga0157374_100192024 417
47 3300025906 Ga0207699_10033347 Ga0207699_100333471 417
48 3300025919 Ga0207657_10029142 Ga0207657_100291426 417
49 3300025927 Ga0207687_10024489 Ga0207687_100244894 417
50 3300025935 Ga0207709_10077688 Ga0207709_100776882 417
51 3300025941 Ga0207711_10007259 Ga0207711_100072595 417
52 3300026023 Ga0207677_10127546 Ga0207677_101275461 417
53 3300031344 Ga0265316_10024356 Ga0265316_100243565 417
54 3300048915 Ga0496112_0205666 Ga0496112_0205666_248_1696 417
55 3300009093 Ga0105240_10002616 Ga0105240_1000261611 418
56 3300010375 Ga0105239_10019392 Ga0105239_100193923 418
57 3300013104 Ga0157370_10005842 Ga0157370_100058423 418
58 3300013105 Ga0157369_10004154 Ga0157369_100041546 418
59 3300013296 Ga0157374_10018388 Ga0157374_100183886 418
60 3300014325 Ga0163163_10012609 Ga0163163_100126092 418
61 3300014325 Ga0163163_10312399 Ga0163163_103123992 418
62 3300025949 Ga0207667_10022987 Ga0207667_100229875 418
63 3300005842 Ga0068858_100048646 Ga0068858_1000486464 419
64 3300009093 Ga0105240_10000903 Ga0105240_1000090338 419
65 3300009545 Ga0105237_10006811 Ga0105237_100068119 419
66 3300009545 Ga0105237_10289760 Ga0105237_102897601 419
67 3300009551 Ga0105238_10090082 Ga0105238_100900822 419
68 3300011119 Ga0105246_10015230 Ga0105246_100152305 419
69 3300013308 Ga0157375_10019887 Ga0157375_100198874 419
70 3300025913 Ga0207695_10003059 Ga0207695_1000305911 419
71 3300025914 Ga0207671_10007472 Ga0207671_100074724 419
72 3300025927 Ga0207687_10017958 Ga0207687_100179583 419
73 3300025941 Ga0207711_10008123 Ga0207711_100081238 419
74 3300026035 Ga0207703_10017507 Ga0207703_100175073 419
75 3300046472 Ga0495580_0001517 Ga0495580_0001517_7611_8912 419
76 3300046473 Ga0495582_0000405 Ga0495582_0000405_10642_11943 419
77 3300006237 Ga0097621_100026337 Ga0097621_1000263372 420
78 3300013104 Ga0157370_10054800 Ga0157370_100548002 420
79 3300013105 Ga0157369_10140129 Ga0157369_101401291 420
80 3300046460 Ga0495638_0075905 Ga0495638_0075905_397_1788 420
81 3300046471 Ga0495650_0000038 Ga0495650_0000038_132171_133595 420
82 3300005618 Ga0068864_100008637 Ga0068864_1000086372 421
83 3300005841 Ga0068863_100020699 Ga0068863_1000206993 421
84 3300009098 Ga0105245_10010631 Ga0105245_100106316 421
85 3300009177 Ga0105248_10203335 Ga0105248_102033351 421
86 3300013297 Ga0157378_10007993 Ga0157378_100079937 421
87 3300013297 Ga0157378_10152434 Ga0157378_101524342 421
88 3300025927 Ga0207687_10004086 Ga0207687_100040864 421
89 3300026088 Ga0207641_10013496 Ga0207641_100134963 421
90 3300026095 Ga0207676_10017137 Ga0207676_100171375 421
91 3300031250 Ga0265331_10009609 Ga0265331_100096092 421
92 3300005535 Ga0070684_100116079 Ga0070684_1001160793 422
93 3300005618 Ga0068864_100065073 Ga0068864_1000650731 422
94 3300009098 Ga0105245_10003047 Ga0105245_1000304711 422
95 3300010375 Ga0105239_10119440 Ga0105239_101194403 422
96 3300013105 Ga0157369_10030064 Ga0157369_100300641 422
97 3300025940 Ga0207691_10203264 Ga0207691_102032641 422
98 3300005329 Ga0070683_100065441 Ga0070683_1000654412 423
99 3300005366 Ga0070659_100075807 Ga0070659_1000758071 423
100 3300005456 Ga0070678_100019714 Ga0070678_1000197146 423
101 3300005535 Ga0070684_100009023 Ga0070684_1000090233 423
102 3300005564 Ga0070664_100034658 Ga0070664_1000346583 423
103 3300005843 Ga0068860_100043909 Ga0068860_1000439093 423
104 3300025911 Ga0207654_10002229 Ga0207654_100022297 423
105 3300025924 Ga0207694_10009253 Ga0207694_100092537 423
106 3300025932 Ga0207690_10049728 Ga0207690_100497283 423
107 3300025942 Ga0207689_10033911 Ga0207689_100339113 423
108 3300026121 Ga0207683_10085124 Ga0207683_100851243 423
109 3300039450 Ga0436363_1107018 Ga0436363_1107018_1234_2568 423
110 3300048905 Ga0496102_0099614 Ga0496102_0099614_562_2088 423
111 3300050512 nmdc:mga0n895_195090_c1 nmdc:mga0n895_195090_c1_145_1671 423
112 3300005329 Ga0070683_100000063 Ga0070683_10000006368 424
113 3300005329 Ga0070683_100027721 Ga0070683_1000277213 424
114 3300005535 Ga0070684_100000089 Ga0070684_10000008930 424
115 3300005614 Ga0068856_100046391 Ga0068856_1000463912 424
116 3300009174 Ga0105241_10033397 Ga0105241_100333973 424
117 3300010375 Ga0105239_10412574 Ga0105239_104125741 424
118 3300014969 Ga0157376_10050613 Ga0157376_100506133 424
119 3300025944 Ga0207661_10000020 Ga0207661_1000002068 424
120 3300026078 Ga0207702_10134627 Ga0207702_101346272 424
121 3300026089 Ga0207648_10047101 Ga0207648_100471011 424
122 3300048929 Ga0496126_0055369 Ga0496126_0055369_2207_3559 424
123 3300049582 Ga0501048_0126374 Ga0501048_0126374_21_1397 424
124 3300005327 Ga0070658_10030777 Ga0070658_100307773 425
125 3300005331 Ga0070670_100022763 Ga0070670_1000227632 425
126 3300035410 Ga0373924_0000010 Ga0373924_0000010_35924_37348 425
127 3300013296 Ga0157374_10003180 Ga0157374_100031802 426
128 3300048929 Ga0496126_0000150 Ga0496126_0000150_65326_66759 426
129 3300006175 Ga0070712_100000506 Ga0070712_10000050619 427
130 3300011119 Ga0105246_10112136 Ga0105246_101121362 427
131 3300025934 Ga0207686_10025498 Ga0207686_100254983 427
132 3300046529 Ga0495652_0006431 Ga0495652_0006431_2790_4244 427
133 3300006847 Ga0075431_100054603 Ga0075431_1000546033 428
134 3300021388 Ga0213875_10000769 Ga0213875_1000076918 428
135 3300031249 Ga0265339_10019402 Ga0265339_100194022 428
136 3300037853 Ga0436364_0197022 Ga0436364_0197022_19039_20427 428
137 3300060353 Ga0501082_0024694 Ga0501082_0024694_2927_4291 428
138 3300005518 Ga0070699_100025672 Ga0070699_1000256724 429
139 3300005530 Ga0070679_100097887 Ga0070679_1000978872 429
140 3300005616 Ga0068852_100034025 Ga0068852_1000340252 429
141 3300009177 Ga0105248_10173445 Ga0105248_101734452 429
142 3300013104 Ga0157370_10001720 Ga0157370_1000172020 429
143 3300013105 Ga0157369_10006100 Ga0157369_100061007 429
144 3300013297 Ga0157378_10170110 Ga0157378_101701102 429
145 3300013307 Ga0157372_10121594 Ga0157372_101215942 429
146 3300025917 Ga0207660_10018579 Ga0207660_100185792 429
147 3300005539 Ga0068853_100091136 Ga0068853_1000911362 430
148 3300006028 Ga0070717_10015061 Ga0070717_100150612 430
149 3300046472 Ga0495580_0007097 Ga0495580_0007097_3621_5051 430
150 3300048907 Ga0496104_0000276 Ga0496104_0000276_2973_4427 430
151 3300009093 Ga0105240_10121221 Ga0105240_101212213 431
152 3300009545 Ga0105237_10009958 Ga0105237_100099588 431
153 3300014969 Ga0157376_10026840 Ga0157376_100268403 431
154 3300031712 Ga0265342_10026325 Ga0265342_100263254 431
155 3300046472 Ga0495580_0001231 Ga0495580_0001231_15701_17092 431
156 3300046531 Ga0495665_0049962 Ga0495665_0049962_224_1615 431
157 3300046559 Ga0495667_0003008 Ga0495667_0003008_789_2180 431
158 3300046679 Ga0495623_0014292 Ga0495623_0014292_3522_4913 431
159 3300047444 Ga0495675_0026103 Ga0495675_0026103_290_1681 431
160 3300047471 Ga0495684_0014270 Ga0495684_0014270_3294_4685 431
161 3300048088 Ga0495602_0039630 Ga0495602_0039630_87_1478 431
162 3300005535 Ga0070684_100032260 Ga0070684_1000322604 432
163 3300013104 Ga0157370_10043585 Ga0157370_100435853 432
164 3300025927 Ga0207687_10026348 Ga0207687_100263483 432
165 3300025944 Ga0207661_10033518 Ga0207661_100335182 432
166 3300044706 Ga0466964_0046345 Ga0466964_0046345_169_1602 432
167 3300045976 Ga0466967_0144534 Ga0466967_0144534_687_2120 432
168 3300013104 Ga0157370_10205463 Ga0157370_102054632 433
169 3300005458 Ga0070681_10009425 Ga0070681_100094253 434
170 3300005530 Ga0070679_100179955 Ga0070679_1001799552 434
171 3300005616 Ga0068852_100038794 Ga0068852_1000387943 434
172 3300005842 Ga0068858_100237910 Ga0068858_1002379101 434
173 3300005985 Ga0081539_10001130 Ga0081539_100011302 434
174 3300009177 Ga0105248_10048589 Ga0105248_100485893 434
175 3300025912 Ga0207707_10041436 Ga0207707_100414363 434
176 3300026035 Ga0207703_10263718 Ga0207703_102637182 434
177 3300026142 Ga0207698_10036137 Ga0207698_100361373 434
178 3300031247 Ga0265340_10032792 Ga0265340_100327922 434
179 3300035118 Ga0373954_0001548 Ga0373954_0001548_2209_3675 434
180 3300035172 Ga0373955_0049618 Ga0373955_0049618_730_2196 434
181 3300036401 Ga0373937_0114044 Ga0373937_0114044_642_2108 434
182 3300037853 Ga0436364_0309225 Ga0436364_0309225_7901_9289 434
183 3300039450 Ga0436363_0145130 Ga0436363_0145130_698_2086 434
184 3300046529 Ga0495652_0073899 Ga0495652_0073899_168_1634 434
185 3300047472 Ga0495686_0007930 Ga0495686_0007930_4716_6110 434
186 3300005445 Ga0070708_100007563 Ga0070708_1000075638 435
187 3300006028 Ga0070717_10033023 Ga0070717_100330234 435
188 3300006847 Ga0075431_100006164 Ga0075431_1000061643 435
189 3300013105 Ga0157369_10013784 Ga0157369_100137842 435
190 3300013105 Ga0157369_10118784 Ga0157369_101187843 435
191 3300021361 Ga0213872_10000901 Ga0213872_100009016 435
192 3300037853 Ga0436364_1321514 Ga0436364_1321514_42_1433 435
193 3300039437 Ga0436365_1233600 Ga0436365_1233600_1279_2670 435
194 3300039447 Ga0436361_0779674 Ga0436361_0779674_14175_15566 435
195 3300039450 Ga0436363_1403142 Ga0436363_1403142_819_2210 435
196 3300047472 Ga0495686_0002398 Ga0495686_0002398_14023_15423 435
197 3300048918 Ga0496115_0194455 Ga0496115_0194455_23_1417 435
198 3300050510 nmdc:mga06r32_10934_c1 nmdc:mga06r32_10934_c1_102_1592 435
199 3300009177 Ga0105248_10115869 Ga0105248_101158692 436
200 3300025941 Ga0207711_10181977 Ga0207711_101819772 436
201 3300028379 Ga0268266_10011773 Ga0268266_100117733 436
202 3300035083 Ga0373926_0006952 Ga0373926_0006952_798_2309 436
203 3300035725 Ga0373947_0055007 Ga0373947_0055007_309_1742 436
204 3300046473 Ga0495582_0039217 Ga0495582_0039217_437_1948 436
205 3300053119 Ga0500595_000011 Ga0500595_000011_18802_20250 436
206 3300005563 Ga0068855_100057365 Ga0068855_1000573652 437
207 3300013307 Ga0157372_10025905 Ga0157372_100259054 437
208 3300021384 Ga0213876_10002419 Ga0213876_100024195 437
209 3300025906 Ga0207699_10037468 Ga0207699_100374682 437
210 3300025927 Ga0207687_10011383 Ga0207687_100113832 437
211 3300025928 Ga0207700_10028324 Ga0207700_100283243 437
212 3300025929 Ga0207664_10041378 Ga0207664_100413782 437
213 3300025939 Ga0207665_10019608 Ga0207665_100196083 437
214 3300039437 Ga0436365_0420090 Ga0436365_0420090_7781_9178 437
215 3300039453 Ga0436362_1239677 Ga0436362_1239677_3052_4449 437
216 3300048929 Ga0496126_0000770 Ga0496126_0000770_17347_18837 437
217 3300005530 Ga0070679_100002145 Ga0070679_1000021455 438
218 3300009545 Ga0105237_10036600 Ga0105237_100366002 438
219 3300025921 Ga0207652_10003176 Ga0207652_100031769 438
220 3300046694 Ga0495649_0007234 Ga0495649_0007234_2403_3839 438
221 3300048929 Ga0496126_0000004 Ga0496126_0000004_707277_708716 438
222 3300031595 Ga0265313_10024272 Ga0265313_100242722 439
223 3300046543 Ga0495645_0117287 Ga0495645_0117287_166_1617 439
224 3300005355 Ga0070671_100000429 Ga0070671_1000004298 440
225 3300005618 Ga0068864_100019140 Ga0068864_1000191403 440
226 3300014969 Ga0157376_10017455 Ga0157376_100174556 440
227 3300025925 Ga0207650_10108040 Ga0207650_101080402 440
228 3300025941 Ga0207711_10097773 Ga0207711_100977732 440
229 3300026095 Ga0207676_10050011 Ga0207676_100500113 440
230 3300028379 Ga0268266_10069904 Ga0268266_100699041 440
231 3300046531 Ga0495665_0041815 Ga0495665_0041815_908_2323 440
232 3300047472 Ga0495686_0000031 Ga0495686_0000031_73619_75073 440
233 3300005344 Ga0070661_100115979 Ga0070661_1001159791 441
234 3300005345 Ga0070692_10011885 Ga0070692_100118853 441
235 3300005548 Ga0070665_100025415 Ga0070665_1000254155 441
236 3300005617 Ga0068859_100016556 Ga0068859_1000165566 441
237 3300006931 Ga0097620_100016557 Ga0097620_1000165576 441
238 3300025949 Ga0207667_10075770 Ga0207667_100757703 441
239 3300028379 Ga0268266_10002668 Ga0268266_100026688 441
240 3300050514 nmdc:mga08x19_53719_c1 nmdc:mga08x19_53719_c1_639_2087 441
241 3300005327 Ga0070658_10000007 Ga0070658_10000007135 442
242 3300005329 Ga0070683_100017801 Ga0070683_1000178013 442
243 3300005331 Ga0070670_100045281 Ga0070670_1000452812 442
244 3300005339 Ga0070660_100009595 Ga0070660_1000095953 442
245 3300005339 Ga0070660_100017843 Ga0070660_1000178435 442
246 3300005344 Ga0070661_100008049 Ga0070661_1000080496 442
247 3300005366 Ga0070659_100003992 Ga0070659_1000039925 442
248 3300005366 Ga0070659_100033495 Ga0070659_1000334953 442
249 3300005435 Ga0070714_100079446 Ga0070714_1000794462 442
250 3300005455 Ga0070663_100019462 Ga0070663_1000194623 442
251 3300005457 Ga0070662_100077109 Ga0070662_1000771091 442
252 3300005458 Ga0070681_10023633 Ga0070681_100236334 442
253 3300005458 Ga0070681_10087148 Ga0070681_100871483 442
254 3300005530 Ga0070679_100021139 Ga0070679_1000211393 442
255 3300005539 Ga0068853_100025543 Ga0068853_1000255433 442
256 3300005539 Ga0068853_100045286 Ga0068853_1000452862 442
257 3300005564 Ga0070664_100013503 Ga0070664_1000135033 442
258 3300005577 Ga0068857_100025768 Ga0068857_1000257685 442
259 3300005578 Ga0068854_100002891 Ga0068854_1000028917 442
260 3300005614 Ga0068856_100017545 Ga0068856_1000175453 442
261 3300005614 Ga0068856_100042762 Ga0068856_1000427622 442
262 3300005834 Ga0068851_10003533 Ga0068851_100035333 442
263 3300007265 Ga0099794_10071565 Ga0099794_100715651 442
264 3300009093 Ga0105240_10021776 Ga0105240_100217765 442
265 3300009177 Ga0105248_10018604 Ga0105248_100186046 442
266 3300009177 Ga0105248_10034546 Ga0105248_100345463 442
267 3300009545 Ga0105237_10077921 Ga0105237_100779212 442
268 3300009551 Ga0105238_10020785 Ga0105238_100207855 442
269 3300010375 Ga0105239_10017516 Ga0105239_100175165 442
270 3300013105 Ga0157369_10017943 Ga0157369_100179433 442
271 3300013105 Ga0157369_10040564 Ga0157369_100405642 442
272 3300013297 Ga0157378_10017818 Ga0157378_100178183 442
273 3300013307 Ga0157372_10017408 Ga0157372_100174084 442
274 3300013307 Ga0157372_10088297 Ga0157372_100882973 442
275 3300013307 Ga0157372_10192188 Ga0157372_101921882 442
276 3300014497 Ga0182008_10038939 Ga0182008_100389393 442
277 3300015262 Ga0182007_10006890 Ga0182007_100068902 442
278 3300025904 Ga0207647_10001523 Ga0207647_1000152313 442
279 3300025909 Ga0207705_10000013 Ga0207705_1000001372 442
280 3300025909 Ga0207705_10000585 Ga0207705_1000058522 442
281 3300025911 Ga0207654_10102072 Ga0207654_101020721 442
282 3300025912 Ga0207707_10030731 Ga0207707_100307313 442
283 3300025912 Ga0207707_10114360 Ga0207707_101143602 442
284 3300025914 Ga0207671_10051340 Ga0207671_100513402 442
285 3300025917 Ga0207660_10033768 Ga0207660_100337683 442
286 3300025919 Ga0207657_10000099 Ga0207657_100000995 442
287 3300025919 Ga0207657_10002042 Ga0207657_1000204214 442
288 3300025920 Ga0207649_10005481 Ga0207649_100054816 442
289 3300025920 Ga0207649_10083726 Ga0207649_100837262 442
290 3300025932 Ga0207690_10024883 Ga0207690_100248833 442
291 3300025933 Ga0207706_10002670 Ga0207706_100026703 442
292 3300025941 Ga0207711_10088678 Ga0207711_100886783 442
293 3300025944 Ga0207661_10175872 Ga0207661_101758721 442
294 3300025949 Ga0207667_10017720 Ga0207667_100177205 442
295 3300025981 Ga0207640_10020019 Ga0207640_100200193 442
296 3300026067 Ga0207678_10010640 Ga0207678_100106406 442
297 3300026095 Ga0207676_10116418 Ga0207676_101164182 442
298 3300026116 Ga0207674_10005608 Ga0207674_100056089 442
299 3300046459 Ga0495629_0006654 Ga0495629_0006654_3689_5140 442
300 3300046459 Ga0495629_0025160 Ga0495629_0025160_2661_4112 442
301 3300046472 Ga0495580_0083582 Ga0495580_0083582_205_1656 442
302 3300046473 Ga0495582_0003388 Ga0495582_0003388_6770_8221 442
303 3300046475 Ga0495639_0001954 Ga0495639_0001954_2819_4270 442
304 3300046476 Ga0495662_0001280 Ga0495662_0001280_8674_10125 442
305 3300046477 Ga0495664_0009472 Ga0495664_0009472_820_2271 442
306 3300046499 Ga0495594_0000395 Ga0495594_0000395_10979_12430 442
307 3300046499 Ga0495594_0000883 Ga0495594_0000883_1326_2777 442
308 3300046526 Ga0495666_0000810 Ga0495666_0000810_9243_10694 442
309 3300046529 Ga0495652_0007766 Ga0495652_0007766_1374_2825 442
310 3300046531 Ga0495665_0002595 Ga0495665_0002595_6859_8310 442
311 3300046533 Ga0495640_0007633 Ga0495640_0007633_6301_7752 442
312 3300046535 Ga0495586_0002392 Ga0495586_0002392_3618_5069 442
313 3300046543 Ga0495645_0014391 Ga0495645_0014391_3781_5232 442
314 3300046559 Ga0495667_0014467 Ga0495667_0014467_1387_2838 442
315 3300046642 Ga0495634_0008727 Ga0495634_0008727_2504_3955 442
316 3300046663 Ga0495635_0011585 Ga0495635_0011585_2902_4353 442
317 3300046678 Ga0495599_0004912 Ga0495599_0004912_172_1623 442
318 3300046689 Ga0495613_0004130 Ga0495613_0004130_7599_9050 442
319 3300046690 Ga0495624_0003027 Ga0495624_0003027_1934_3385 442
320 3300047315 Ga0495581_0012382 Ga0495581_0012382_1439_2890 442
321 3300047317 Ga0495604_0021328 Ga0495604_0021328_2116_3567 442
322 3300047319 Ga0495674_0052634 Ga0495674_0052634_1439_2890 442
323 3300047321 Ga0495676_0005277 Ga0495676_0005277_7880_9331 442
324 3300047322 Ga0495680_0024503 Ga0495680_0024503_390_1841 442
325 3300048903 Ga0496100_0115006 Ga0496100_0115006_172_1608 442
326 3300048906 Ga0496103_0026334 Ga0496103_0026334_1623_3059 442
327 3300048911 Ga0496108_0028874 Ga0496108_0028874_1282_2718 442
328 3300049581 Ga0501047_0147313 Ga0501047_0147313_368_1792 442
329 3300049589 Ga0501073_0064891 Ga0501073_0064891_394_1818 442
330 3300049822 Ga0501035_0194021 Ga0501035_0194021_259_1683 442
331 3300039438 Ga0436360_0027910 Ga0436360_0027910_129_1556 443
332 3300046471 Ga0495650_0006759 Ga0495650_0006759_4327_5877 443
333 3300049572 Ga0501036_0003961 Ga0501036_0003961_7014_8453 443
334 3300049573 Ga0501037_0007912 Ga0501037_0007912_2971_4410 443
335 3300049579 Ga0501043_0003276 Ga0501043_0003276_6015_7454 443
336 3300049580 Ga0501046_0002059 Ga0501046_0002059_13840_15279 443
337 3300049581 Ga0501047_0011843 Ga0501047_0011843_6615_8054 443
338 3300049589 Ga0501073_0031613 Ga0501073_0031613_2008_3447 443
339 3300049590 Ga0501074_0107651 Ga0501074_0107651_226_1665 443
340 3300049742 Ga0501080_0010542 Ga0501080_0010542_497_1936 443
341 3300049822 Ga0501035_0030526 Ga0501035_0030526_734_2173 443
342 3300049823 Ga0501044_0044860 Ga0501044_0044860_249_1688 443
343 3300005616 Ga0068852_100042908 Ga0068852_1000429083 444
344 3300013104 Ga0157370_10096396 Ga0157370_100963963 444
345 3300013297 Ga0157378_10167812 Ga0157378_101678121 444
346 3300013307 Ga0157372_10062938 Ga0157372_100629383 444
347 3300021361 Ga0213872_10002030 Ga0213872_100020306 444
348 3300021361 Ga0213872_10012963 Ga0213872_100129633 444
349 3300026067 Ga0207678_10003651 Ga0207678_100036519 444
350 3300026142 Ga0207698_10028258 Ga0207698_100282583 444
351 3300033180 Ga0307510_10138407 Ga0307510_101384072 444
352 3300035692 Ga0373935_0133606 Ga0373935_0133606_73_1545 444
353 3300036401 Ga0373937_0000132 Ga0373937_0000132_15887_17386 444
354 3300039438 Ga0436360_0161883 Ga0436360_0161883_10137_11540 444
355 3300039438 Ga0436360_1036151 Ga0436360_1036151_2936_4339 444
356 3300039447 Ga0436361_0307406 Ga0436361_0307406_8907_10310 444
357 3300039447 Ga0436361_0696344 Ga0436361_0696344_7626_9029 444
358 3300046506 Ga0495583_0016461 Ga0495583_0016461_977_2413 444
359 3300046660 Ga0495625_0039604 Ga0495625_0039604_260_1693 444
360 3300046665 Ga0495661_0020075 Ga0495661_0020075_2087_3520 444
361 3300046689 Ga0495613_0058484 Ga0495613_0058484_479_1951 444
362 3300047319 Ga0495674_0017116 Ga0495674_0017116_2149_3579 444
363 3300047472 Ga0495686_0003361 Ga0495686_0003361_6256_7665 444
364 3300053093 Ga0500651_0000005 Ga0500651_0000005_220977_222410 444
365 3300005518 Ga0070699_100000753 Ga0070699_10000075317 445
366 3300006914 Ga0075436_100026299 Ga0075436_1000262993 445
367 3300007076 Ga0075435_100049414 Ga0075435_1000494141 445
368 3300050513 nmdc:mga0rr50_23467_c1 nmdc:mga0rr50_23467_c1_2506_3918 445
369 3300039450 Ga0436363_1371418 Ga0436363_1371418_663_2093 446
370 3300039453 Ga0436362_0525229 Ga0436362_0525229_111_1541 446
371 3300048929 Ga0496126_0010867 Ga0496126_0010867_1924_3423 446
372 3300005456 Ga0070678_100045787 Ga0070678_1000457873 447
373 3300005841 Ga0068863_100006574 Ga0068863_1000065746 447
374 3300025928 Ga0207700_10071426 Ga0207700_100714263 447
375 3300028379 Ga0268266_10004148 Ga0268266_100041482 447
376 3300045049 Ga0466959_0057283 Ga0466959_0057283_584_2020 447
377 3300013306 Ga0163162_10003253 Ga0163162_1000325310 448
378 3300014969 Ga0157376_10033123 Ga0157376_100331233 448
379 3300035398 Ga0316574_0139593 Ga0316574_0139593_113_1546 448
380 3300046472 Ga0495580_0001935 Ga0495580_0001935_7595_9007 448
381 3300046529 Ga0495652_0104318 Ga0495652_0104318_444_1889 448
382 3300047319 Ga0495674_0038007 Ga0495674_0038007_298_1743 448
383 3300048907 Ga0496104_0094575 Ga0496104_0094575_391_1836 448
384 3300048908 Ga0496105_0081353 Ga0496105_0081353_804_2249 448
385 3300005339 Ga0070660_100098540 Ga0070660_1000985402 449
386 3300005439 Ga0070711_100090159 Ga0070711_1000901592 449
387 3300005458 Ga0070681_10007366 Ga0070681_100073665 449
388 3300010375 Ga0105239_10245070 Ga0105239_102450701 449
389 3300025909 Ga0207705_10018627 Ga0207705_100186272 449
390 3300025912 Ga0207707_10031492 Ga0207707_100314925 449
391 3300025915 Ga0207693_10026042 Ga0207693_100260426 449
392 3300025972 Ga0207668_10065760 Ga0207668_100657602 449
393 3300046507 Ga0495606_0060363 Ga0495606_0060363_910_2358 449
394 3300048915 Ga0496112_0014614 Ga0496112_0014614_2517_3929 449
395 3300005434 Ga0070709_10069120 Ga0070709_100691202 450
396 3300005435 Ga0070714_100076807 Ga0070714_1000768071 450
397 3300005436 Ga0070713_100051997 Ga0070713_1000519972 450
398 3300005439 Ga0070711_100052412 Ga0070711_1000524124 450
399 3300005563 Ga0068855_100009876 Ga0068855_10000987612 450
400 3300006173 Ga0070716_100056595 Ga0070716_1000565952 450
401 3300006175 Ga0070712_100045778 Ga0070712_1000457781 450
402 3300006175 Ga0070712_100120836 Ga0070712_1001208361 450
403 3300009098 Ga0105245_10019206 Ga0105245_100192062 450
404 3300025915 Ga0207693_10001204 Ga0207693_100012046 450
405 3300025915 Ga0207693_10041550 Ga0207693_100415504 450
406 3300025916 Ga0207663_10054316 Ga0207663_100543163 450
407 3300025928 Ga0207700_10002339 Ga0207700_1000233911 450
408 3300025929 Ga0207664_10126320 Ga0207664_101263201 450
409 3300025939 Ga0207665_10011868 Ga0207665_100118683 450
410 3300025949 Ga0207667_10015158 Ga0207667_100151582 450
411 3300035113 Ga0373936_0011473 Ga0373936_0011473_238_1749 450
412 3300046455 Ga0495603_0039861 Ga0495603_0039861_445_1896 450
413 3300046499 Ga0495594_0010925 Ga0495594_0010925_883_2334 450
414 3300046511 Ga0495608_0046086 Ga0495608_0046086_987_2498 450
415 3300046513 Ga0495616_0053817 Ga0495616_0053817_427_1878 450
416 3300046523 Ga0495644_0000219 Ga0495644_0000219_13768_15219 450
417 3300046558 Ga0495633_0034650 Ga0495633_0034650_158_1609 450
418 3300046660 Ga0495625_0024832 Ga0495625_0024832_177_1628 450
419 3300046664 Ga0495659_0019591 Ga0495659_0019591_316_1767 450
420 3300047445 Ga0495677_0025532 Ga0495677_0025532_52_1503 450
421 3300048908 Ga0496105_0004114 Ga0496105_0004114_109_1608 450
422 3300048908 Ga0496105_0049696 Ga0496105_0049696_1399_2910 450
423 3300048915 Ga0496112_0020790 Ga0496112_0020790_3226_4737 450
424 3300048915 Ga0496112_0066646 Ga0496112_0066646_43_1524 450
425 3300048916 Ga0496113_0009235 Ga0496113_0009235_2440_3951 450
426 3300053077 Ga0495601_0021899 Ga0495601_0021899_1367_2878 450
427 3300005327 Ga0070658_10016767 Ga0070658_100167674 451
428 3300009093 Ga0105240_10072810 Ga0105240_100728103 451
429 3300009551 Ga0105238_10006161 Ga0105238_100061616 451
430 3300013104 Ga0157370_10146565 Ga0157370_101465653 451
431 3300013105 Ga0157369_10016811 Ga0157369_100168114 451
432 3300013307 Ga0157372_10165997 Ga0157372_101659972 451
433 3300025913 Ga0207695_10103576 Ga0207695_101035764 451
434 3300009093 Ga0105240_10032891 Ga0105240_100328913 453
435 3300013105 Ga0157369_10027593 Ga0157369_100275933 453
436 3300028800 Ga0265338_10008294 Ga0265338_100082949 453
437 3300005436 Ga0070713_100001905 Ga0070713_1000019057 454
438 3300005436 Ga0070713_100029875 Ga0070713_1000298753 454
439 3300025916 Ga0207663_10085139 Ga0207663_100851391 454
440 3300025928 Ga0207700_10005050 Ga0207700_100050504 454
441 3300025928 Ga0207700_10036669 Ga0207700_100366692 454
442 3300003316 rootH1_10065962 rootH1_100659623 455

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00909

Ammonium_transp

Ammonium Transporter Family

124

531

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c1h-assembly1.cif.gz_A substrate binding, deprotonation and selectivity at the periplasmic entrance of the e. coli ammonia channel amtb 0.9597 35 430
2npg-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.957 35 430
3c1i-assembly1.cif.gz_A substrate binding, deprotonation and selectivity at the periplasmic entrance of the e. coli ammonia channel amtb 0.9562 35 430
2npe-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9559 35 430
2npj-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9551 35 430
ID Description Score Start End Superfamily
af_Q2FWL9_1_414_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9673 38 450 1.10.3430.10
2npdA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.954 35 430 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9536 37 449 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9465 37 449 1.10.3430.10
2npdA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9464 35 430 1.10.3430.10
ID Description Score Start End GO Terms
AF-A0A522YD66-F1-model_v4 Ammonium transporter 0.9919 37 182 GO:0005886
GO:0008519
AF-A0A6C8EDF1-F1-model_v4 Ammonium transporter 0.9793 39 449 GO:0005886
GO:0008519
AF-A0A519UQN0-F1-model_v4 Ammonium transporter 0.9791 39 259 GO:0005886
GO:0008519
AF-A0A380H119-F1-model_v4 Probabale ammonium transporter 0.9788 39 188 GO:0005886
GO:0008519
AF-A0A4R6ZME6-F1-model_v4 Ammonium transporter 0.9786 39 449 GO:0005886
GO:0008519

Feature Viewer

pLDDT pTM Quality
86.91 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map