F444814

General Info

Members Datasets Scaffolds Average Seq Length
442 171 884 126

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000398|Ga0070658_1000039818
Length 134
Sequence MSTQEVATMTTKDVANRFSELAQKGAFDKIQDELFSEDAVSIEPDSVAAMGSPVVVKGLAGIKEKAKKFNEMVEEMHGGWTSQPVVGGDYFSVAMGMDVTMKGMGRMNMDEVCVYRVQDGMIVSEQFFFTPGKM

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
168 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 10.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000398 3300005327 Bacteria 37864
2 MRS1b_contig_877338 2162886011 Bacteria 853
3 JGI25406J46586_10005898 3300003203 Bacteria 5669
4 Ga0065704_10513860 3300005289 Bacteria 626
5 Ga0065712_10017743 3300005290 Bacteria 1601
6 Ga0065712_10021007 3300005290 Bacteria 1486
7 Ga0065712_10211753 3300005290 Bacteria 1064
8 Ga0065715_10014705 3300005293 Unclassified 2118
9 Ga0065707_10190463 3300005295 Bacteria 1364
10 Ga0065707_10463657 3300005295 Bacteria 789
11 Ga0070658_10232022 3300005327 Bacteria 1563
12 Ga0070676_10047665 3300005328 Bacteria 2503
13 Ga0070676_10089088 3300005328 Bacteria 1887
14 Ga0070676_10605162 3300005328 Bacteria 791
15 Ga0070683_100114452 3300005329 Bacteria 2546
16 Ga0070670_100035570 3300005331 Bacteria 4287
17 Ga0070670_100113988 3300005331 Bacteria 2331
18 Ga0070670_100146322 3300005331 Unclassified 2044
19 Ga0070670_100147071 3300005331 Bacteria 2039
20 Ga0070670_100194212 3300005331 Bacteria 1763
21 Ga0070670_100971827 3300005331 Bacteria 772
22 Ga0068869_100086097 3300005334 Bacteria 2355
23 Ga0068869_100188587 3300005334 Bacteria 1620
24 Ga0068869_100379226 3300005334 Bacteria 1158
25 Ga0070666_10000272 3300005335 Bacteria 34340
26 Ga0070666_10454767 3300005335 Bacteria 925
27 Ga0070682_100000012 3300005337 Bacteria 265658
28 Ga0070682_100505156 3300005337 Bacteria 938
29 Ga0070682_100949214 3300005337 Bacteria 710
30 Ga0068868_100003557 3300005338 Bacteria 10858
31 Ga0068868_101270537 3300005338 Bacteria 683
32 Ga0068868_101278874 3300005338 Bacteria 681
33 Ga0070689_100079452 3300005340 Bacteria 2573
34 Ga0070689_100304383 3300005340 Bacteria 1327
35 Ga0070689_100939775 3300005340 Bacteria 767
36 Ga0070691_10339465 3300005341 Bacteria 831
37 Ga0070687_100062904 3300005343 Bacteria 1966
38 Ga0070687_100170413 3300005343 Bacteria 1295
39 Ga0070687_100222641 3300005343 Bacteria 1156
40 Ga0070661_100057754 3300005344 Bacteria 2843
41 Ga0070661_100447720 3300005344 Bacteria 1027
42 Ga0070668_100000154 3300005347 Bacteria 43788
43 Ga0070668_100077651 3300005347 Bacteria 2596
44 Ga0070668_100495241 3300005347 Bacteria 1057
45 Ga0070669_100004132 3300005353 Bacteria 10534
46 Ga0070669_100031386 3300005353 Bacteria 3838
47 Ga0070675_100049857 3300005354 Bacteria 3437
48 Ga0070675_100211582 3300005354 Bacteria 1685
49 Ga0070675_100305396 3300005354 Bacteria 1403
50 Ga0070675_100404255 3300005354 Bacteria 1219
51 Ga0070671_100051568 3300005355 Bacteria 3422
52 Ga0070671_100266791 3300005355 Bacteria 1455
53 Ga0070671_101585108 3300005355 Bacteria 580
54 Ga0070671_101937541 3300005355 Bacteria 524
55 Ga0070673_100000659 3300005364 Bacteria 18949
56 Ga0070673_100015190 3300005364 Bacteria 5399
57 Ga0070673_100249795 3300005364 Viruses 1545
58 Ga0070673_100556736 3300005364 Bacteria 1042
59 Ga0070673_102341345 3300005364 Bacteria 508
60 Ga0070688_100016320 3300005365 Bacteria 4244
61 Ga0070659_100266108 3300005366 Bacteria 1423
62 Ga0070667_100001281 3300005367 Bacteria 22751
63 Ga0070667_100508520 3300005367 Viruses 1105
64 Ga0070701_10227784 3300005438 Bacteria 1115
65 Ga0070700_100047049 3300005441 Unclassified 2668
66 Ga0070700_100319212 3300005441 Bacteria 1141
67 Ga0070700_100473038 3300005441 Bacteria 958
68 Ga0070708_100930098 3300005445 Bacteria 816
69 Ga0070663_100093874 3300005455 Bacteria 2227
70 Ga0070662_100004374 3300005457 Bacteria 8927
71 Ga0070662_100049257 3300005457 Unclassified 3038
72 Ga0070681_10501611 3300005458 Bacteria 1127
73 Ga0070681_10592433 3300005458 Bacteria 1023
74 Ga0070681_10908944 3300005458 Unclassified 799
75 Ga0070681_11150385 3300005458 Unclassified 697
76 Ga0068867_100002979 3300005459 Bacteria 11938
77 Ga0068867_100016941 3300005459 Bacteria 5178
78 Ga0068867_102397139 3300005459 Unclassified 502
79 Ga0070685_10188182 3300005466 Unclassified 1333
80 Ga0070706_100893317 3300005467 Bacteria 821
81 Ga0070707_101281752 3300005468 Bacteria 699
82 Ga0070698_100011891 3300005471 Bacteria 9234
83 Ga0070679_100410368 3300005530 Unclassified 1300
84 Ga0070679_100410718 3300005530 Bacteria 1299
85 Ga0070679_100432965 3300005530 Bacteria 1260
86 Ga0070684_100003999 3300005535 Bacteria 11159
87 Ga0068853_100061924 3300005539 Bacteria 3237
88 Ga0068853_100094822 3300005539 Bacteria 2630
89 Ga0068853_100545202 3300005539 Bacteria 1098
90 Ga0068853_100900323 3300005539 Bacteria 850
91 Ga0070672_100000048 3300005543 Bacteria 52547
92 Ga0070672_100106976 3300005543 Bacteria 2276
93 Ga0070672_100155709 3300005543 Bacteria 1893
94 Ga0070672_100324347 3300005543 Bacteria 1309
95 Ga0070672_100753912 3300005543 Bacteria 854
96 Ga0070672_101252393 3300005543 Bacteria 662
97 Ga0070686_100016862 3300005544 Bacteria 4256
98 Ga0070686_100375109 3300005544 Bacteria 1075
99 Ga0070665_100001032 3300005548 Bacteria 34883
100 Ga0068855_100001217 3300005563 Bacteria 31946
101 Ga0068855_100090831 3300005563 Bacteria 3523
102 Ga0068855_100294821 3300005563 Bacteria 1797
103 Ga0070664_100026062 3300005564 Bacteria 4848
104 Ga0070664_100035175 3300005564 Bacteria 4205
105 Ga0070664_100665009 3300005564 Bacteria 969
106 Ga0070664_101210069 3300005564 Bacteria 713
107 Ga0068857_100035349 3300005577 Bacteria 4425
108 Ga0068857_100164591 3300005577 Bacteria 2014
109 Ga0068857_100477282 3300005577 Bacteria 1168
110 Ga0068857_100738449 3300005577 Bacteria 937
111 Ga0068857_101097718 3300005577 Unclassified 768
112 Ga0068854_100616145 3300005578 Bacteria 928
113 Ga0068856_100166194 3300005614 Bacteria 2218
114 Ga0070702_101208713 3300005615 Viruses 610
115 Ga0068852_100026666 3300005616 Bacteria 4701
116 Ga0068852_100099800 3300005616 Bacteria 2618
117 Ga0068852_100375996 3300005616 Unclassified 1393
118 Ga0068852_100497358 3300005616 Bacteria 1214
119 Ga0068859_100026430 3300005617 Bacteria 5821
120 Ga0068859_100055912 3300005617 Bacteria 3971
121 Ga0068859_100069953 3300005617 Bacteria 3545
122 Ga0068859_100189681 3300005617 Bacteria 2140
123 Ga0068859_100200409 3300005617 Bacteria 2081
124 Ga0068859_101103507 3300005617 Bacteria 873
125 Ga0068864_100000537 3300005618 Bacteria 32549
126 Ga0068864_100103602 3300005618 Bacteria 2526
127 Ga0068864_100208753 3300005618 Bacteria 1797
128 Ga0068864_100418154 3300005618 Bacteria 1277
129 Ga0068864_100673807 3300005618 Bacteria 1008
130 Ga0068861_100001116 3300005719 Bacteria 16642
131 Ga0068861_100014031 3300005719 Bacteria 5619
132 Ga0068861_100025080 3300005719 Bacteria 4319
133 Ga0068861_100213622 3300005719 Bacteria 1626
134 Ga0068861_102217925 3300005719 Unclassified 550
135 Ga0068851_10000972 3300005834 Bacteria 12426
136 Ga0068851_10100608 3300005834 Bacteria 1533
137 Ga0068851_10142673 3300005834 Bacteria 1304
138 Ga0068851_10207530 3300005834 Bacteria 1096
139 Ga0068851_10552008 3300005834 Unclassified 696
140 Ga0068870_10080144 3300005840 Bacteria 1803
141 Ga0068870_10900474 3300005840 Bacteria 625
142 Ga0068863_100000750 3300005841 Bacteria 32439
143 Ga0068863_100182166 3300005841 Bacteria 2016
144 Ga0068863_100304453 3300005841 Bacteria 1546
145 Ga0068863_100679828 3300005841 Bacteria 1022
146 Ga0068863_100886937 3300005841 Bacteria 892
147 Ga0068863_101071046 3300005841 Bacteria 810
148 Ga0068858_100001076 3300005842 Bacteria 28272
149 Ga0068858_100415490 3300005842 Bacteria 1293
150 Ga0068858_101112610 3300005842 Bacteria 776
151 Ga0068860_100064383 3300005843 Bacteria 3482
152 Ga0068860_100129097 3300005843 Bacteria 2424
153 Ga0068860_100679830 3300005843 Bacteria 1038
154 Ga0068860_100733071 3300005843 Bacteria 999
155 Ga0068860_101010703 3300005843 Bacteria 850
156 Ga0068862_100016049 3300005844 Bacteria 6228
157 Ga0081539_10000925 3300005985 Bacteria 55202
158 Ga0070715_10096179 3300006163 Bacteria 1373
159 Ga0070715_10125327 3300006163 Unclassified 1229
160 Ga0070715_10539186 3300006163 Bacteria 674
161 Ga0070715_10782877 3300006163 Bacteria 577
162 Ga0097621_100002050 3300006237 Bacteria 13791
163 Ga0097621_100011509 3300006237 Bacteria 6519
164 Ga0097621_100037629 3300006237 Viruses 3879
165 Ga0097621_100123540 3300006237 Unclassified 2197
166 Ga0097621_101634956 3300006237 Bacteria 613
167 Ga0097621_102060025 3300006237 Bacteria 545
168 Ga0068871_100002809 3300006358 Bacteria 11913
169 Ga0068871_100072795 3300006358 Bacteria 2831
170 Ga0068871_100382527 3300006358 Bacteria 1250
171 Ga0068871_100443714 3300006358 Bacteria 1162
172 Ga0068871_100630550 3300006358 Bacteria 977
173 Ga0068871_100726545 3300006358 Bacteria 911
174 Ga0075428_102322616 3300006844 Bacteria 552
175 Ga0068865_100039098 3300006881 Bacteria 3216
176 Ga0068865_100649817 3300006881 Bacteria 896
177 Ga0097620_100026430 3300006931 Bacteria 5821
178 Ga0097620_100055911 3300006931 Bacteria 3971
179 Ga0097620_100069953 3300006931 Bacteria 3545
180 Ga0097620_100189679 3300006931 Bacteria 2140
181 Ga0097620_100200402 3300006931 Bacteria 2081
182 Ga0075435_100633293 3300007076 Bacteria 928
183 Ga0105240_10209840 3300009093 Bacteria 2277
184 Ga0105240_10218156 3300009093 Bacteria 2224
185 Ga0111539_10520454 3300009094 Unclassified 1386
186 Ga0111539_10674091 3300009094 Bacteria 1204
187 Ga0111539_10845635 3300009094 Unclassified 1065
188 Ga0105245_10022170 3300009098 Bacteria 5577
189 Ga0105247_11687041 3300009101 Unclassified 523
190 Ga0105243_10384548 3300009148 Bacteria 1299
191 Ga0105243_12759038 3300009148 Bacteria 532
192 Ga0105241_10289113 3300009174 Bacteria 1403
193 Ga0105241_10327890 3300009174 Bacteria 1322
194 Ga0105242_10013653 3300009176 Bacteria 6283
195 Ga0105242_11054279 3300009176 Bacteria 824
196 Ga0105242_11078568 3300009176 Bacteria 816
197 Ga0105248_10046457 3300009177 Bacteria 4866
198 Ga0105248_11069768 3300009177 Viruses 911
199 Ga0105237_10091667 3300009545 Bacteria 3028
200 Ga0105237_11124232 3300009545 Bacteria 792
201 Ga0105238_10498286 3300009551 Viruses 1218
202 Ga0105249_10003840 3300009553 Bacteria 12961
203 Ga0105249_10015267 3300009553 Bacteria 6798
204 Ga0105249_10036218 3300009553 Bacteria 4476
205 Ga0105249_10047325 3300009553 Bacteria 3918
206 Ga0105249_10508173 3300009553 Bacteria 1251
207 Ga0105249_11764536 3300009553 Bacteria 691
208 Ga0105239_10028973 3300010375 Bacteria 6086
209 Ga0105239_10180102 3300010375 Bacteria 2364
210 Ga0105246_10009854 3300011119 Bacteria 5891
211 Ga0105246_10166951 3300011119 Bacteria 1682
212 Ga0157373_10461314 3300013100 Unclassified 915
213 Ga0157371_10002637 3300013102 Bacteria 17016
214 Ga0157371_10106507 3300013102 Bacteria 1990
215 Ga0157371_10298373 3300013102 Bacteria 1166
216 Ga0157370_10090008 3300013104 Bacteria 2882
217 Ga0157370_10456923 3300013104 Bacteria 1174
218 Ga0157369_10042045 3300013105 Bacteria 4987
219 Ga0157369_10078500 3300013105 Bacteria 3537
220 Ga0157374_10000314 3300013296 Bacteria 44972
221 Ga0157374_10014794 3300013296 Bacteria 6834
222 Ga0157374_10080983 3300013296 Bacteria 3081
223 Ga0157374_11174225 3300013296 Unclassified 789
224 Ga0157378_10011389 3300013297 Bacteria 7786
225 Ga0157378_10157289 3300013297 Unclassified 2123
226 Ga0157378_10294627 3300013297 Bacteria 1568
227 Ga0163162_10000231 3300013306 Bacteria 51138
228 Ga0163162_10020750 3300013306 Bacteria 6459
229 Ga0163162_10024712 3300013306 Bacteria 5933
230 Ga0163162_10035044 3300013306 Bacteria 4996
231 Ga0163162_10464827 3300013306 Unclassified 1397
232 Ga0163162_10660533 3300013306 Bacteria 1169
233 Ga0163162_10663704 3300013306 Bacteria 1166
234 Ga0157372_10018692 3300013307 Bacteria 7457
235 Ga0157372_10026442 3300013307 Bacteria 6315
236 Ga0157372_10072035 3300013307 Bacteria 3893
237 Ga0157372_10153451 3300013307 Bacteria 2659
238 Ga0157372_10263853 3300013307 Bacteria 2000
239 Ga0157372_10699806 3300013307 Bacteria 1179
240 Ga0157372_11196992 3300013307 Bacteria 878
241 Ga0157375_10000272 3300013308 Bacteria 46932
242 Ga0157375_10168095 3300013308 Bacteria 2339
243 Ga0157375_10322314 3300013308 Bacteria 1710
244 Ga0157375_10346728 3300013308 Unclassified 1651
245 Ga0157375_10542895 3300013308 Bacteria 1325
246 Ga0157375_12168493 3300013308 Bacteria 662
247 Ga0157375_12322439 3300013308 Bacteria 640
248 Ga0163163_10000347 3300014325 Bacteria 44548
249 Ga0163163_10003656 3300014325 Bacteria 13077
250 Ga0163163_10097956 3300014325 Bacteria 2954
251 Ga0163163_10187745 3300014325 Bacteria 2115
252 Ga0163163_10247578 3300014325 Bacteria 1833
253 Ga0163163_10323635 3300014325 Bacteria 1595
254 Ga0163163_10851076 3300014325 Unclassified 975
255 Ga0163163_12304344 3300014325 Bacteria 597
256 Ga0157380_10023609 3300014326 Bacteria 4642
257 Ga0157380_10092305 3300014326 Bacteria 2501
258 Ga0157380_10200587 3300014326 Bacteria 1770
259 Ga0157380_11049994 3300014326 Bacteria 851
260 Ga0157377_10003057 3300014745 Bacteria 7504
261 Ga0157377_10011305 3300014745 Bacteria 4450
262 Ga0157377_10025169 3300014745 Bacteria 3172
263 Ga0157379_10000120 3300014968 Bacteria 54605
264 Ga0157379_10116521 3300014968 Bacteria 2403
265 Ga0157379_10566930 3300014968 Bacteria 1057
266 Ga0157376_10000271 3300014969 Bacteria 35219
267 Ga0157376_10004812 3300014969 Bacteria 9404
268 Ga0157376_10117634 3300014969 Bacteria 2350
269 Ga0157376_10748541 3300014969 Bacteria 986
270 Ga0163161_10149488 3300017792 Unclassified 1774
271 Ga0163161_10275893 3300017792 Bacteria 1317
272 Ga0163161_10618985 3300017792 Bacteria 894
273 Ga0163161_10723426 3300017792 Bacteria 830
274 Ga0163161_11084006 3300017792 Unclassified 688
275 Ga0207697_10027640 3300025315 Unclassified 2319
276 Ga0207697_10040285 3300025315 Bacteria 1918
277 Ga0207697_10059438 3300025315 Bacteria 1589
278 Ga0207656_10000986 3300025321 Bacteria 9287
279 Ga0207656_10017922 3300025321 Bacteria 2781
280 Ga0207656_10020175 3300025321 Viruses 2646
281 Ga0207656_10400498 3300025321 Bacteria 690
282 Ga0207710_10715808 3300025900 Unclassified 525
283 Ga0207680_10006645 3300025903 Bacteria 5611
284 Ga0207680_10883634 3300025903 Bacteria 641
285 Ga0207647_10145455 3300025904 Bacteria 1387
286 Ga0207647_10182555 3300025904 Bacteria 1218
287 Ga0207645_10052898 3300025907 Bacteria 2595
288 Ga0207645_10055344 3300025907 Bacteria 2533
289 Ga0207645_10156567 3300025907 Bacteria 1489
290 Ga0207643_10011494 3300025908 Bacteria 4781
291 Ga0207643_10014215 3300025908 Bacteria 4323
292 Ga0207705_10000725 3300025909 Bacteria 27178
293 Ga0207705_10093666 3300025909 Unclassified 2202
294 Ga0207707_10581003 3300025912 Bacteria 950
295 Ga0207707_11380374 3300025912 Unclassified 563
296 Ga0207707_11580464 3300025912 Bacteria 517
297 Ga0207695_10016793 3300025913 Bacteria 8547
298 Ga0207695_10257206 3300025913 Bacteria 1644
299 Ga0207671_10058929 3300025914 Bacteria 2847
300 Ga0207671_10979079 3300025914 Bacteria 667
301 Ga0207660_11194380 3300025917 Bacteria 619
302 Ga0207662_10147918 3300025918 Unclassified 1492
303 Ga0207662_10216509 3300025918 Bacteria 1245
304 Ga0207662_10519466 3300025918 Bacteria 822
305 Ga0207649_10234704 3300025920 Bacteria 1313
306 Ga0207649_10247310 3300025920 Bacteria 1283
307 Ga0207652_10447490 3300025921 Unclassified 1164
308 Ga0207652_10586758 3300025921 Bacteria 1000
309 Ga0207646_10478684 3300025922 Viruses 1123
310 Ga0207681_10153929 3300025923 Bacteria 1726
311 Ga0207681_10182345 3300025923 Bacteria 1600
312 Ga0207650_10009536 3300025925 Bacteria 6635
313 Ga0207650_10100474 3300025925 Bacteria 2226
314 Ga0207650_10123697 3300025925 Bacteria 2017
315 Ga0207650_10171621 3300025925 Bacteria 1724
316 Ga0207650_10246925 3300025925 Bacteria 1444
317 Ga0207650_10471196 3300025925 Unclassified 1047
318 Ga0207650_11464700 3300025925 Unclassified 581
319 Ga0207659_10095257 3300025926 Bacteria 2232
320 Ga0207659_10171843 3300025926 Bacteria 1710
321 Ga0207659_10612890 3300025926 Bacteria 928
322 Ga0207687_10031163 3300025927 Bacteria 3602
323 Ga0207706_10004110 3300025933 Bacteria 13738
324 Ga0207706_10005361 3300025933 Bacteria 11953
325 Ga0207706_10205773 3300025933 Bacteria 1726
326 Ga0207686_10001012 3300025934 Bacteria 16646
327 Ga0207686_10008710 3300025934 Bacteria 5481
328 Ga0207686_11217663 3300025934 Bacteria 617
329 Ga0207709_10523753 3300025935 Bacteria 928
330 Ga0207670_10008475 3300025936 Bacteria 5810
331 Ga0207670_10022841 3300025936 Unclassified 3883
332 Ga0207704_10001084 3300025938 Bacteria 12072
333 Ga0207704_10440440 3300025938 Bacteria 1038
334 Ga0207704_10551300 3300025938 Bacteria 937
335 Ga0207691_10000245 3300025940 Bacteria 53608
336 Ga0207691_10029071 3300025940 Bacteria 5170
337 Ga0207691_10118904 3300025940 Bacteria 2344
338 Ga0207691_10133249 3300025940 Bacteria 2193
339 Ga0207691_10390920 3300025940 Bacteria 1187
340 Ga0207711_10026764 3300025941 Bacteria 4841
341 Ga0207711_10742148 3300025941 Viruses 915
342 Ga0207689_10073992 3300025942 Bacteria 2799
343 Ga0207689_10134854 3300025942 Bacteria 2033
344 Ga0207661_10233261 3300025944 Bacteria 1630
345 Ga0207661_11137933 3300025944 Bacteria 719
346 Ga0207679_10028395 3300025945 Bacteria 3881
347 Ga0207679_10507305 3300025945 Bacteria 1077
348 Ga0207679_11769400 3300025945 Unclassified 565
349 Ga0207667_10026712 3300025949 Bacteria 6302
350 Ga0207667_10030259 3300025949 Bacteria 5859
351 Ga0207651_10002054 3300025960 Bacteria 9475
352 Ga0207651_10100000 3300025960 Bacteria 2149
353 Ga0207651_10165276 3300025960 Bacteria 1739
354 Ga0207651_10623089 3300025960 Bacteria 945
355 Ga0207651_10629167 3300025960 Bacteria 941
356 Ga0207712_10003365 3300025961 Bacteria 10116
357 Ga0207712_10005499 3300025961 Bacteria 7992
358 Ga0207712_10029383 3300025961 Bacteria 3686
359 Ga0207668_10000184 3300025972 Bacteria 42493
360 Ga0207668_10116417 3300025972 Bacteria 2015
361 Ga0207668_10962908 3300025972 Bacteria 762
362 Ga0207640_10908330 3300025981 Bacteria 769
363 Ga0207658_10000452 3300025986 Bacteria 38428
364 Ga0207658_10344772 3300025986 Viruses 1296
365 Ga0207677_10000771 3300026023 Bacteria 18415
366 Ga0207677_10042666 3300026023 Bacteria 3009
367 Ga0207677_10151513 3300026023 Bacteria 1790
368 Ga0207703_10000388 3300026035 Bacteria 47169
369 Ga0207703_10037091 3300026035 Bacteria 3883
370 Ga0207639_10045276 3300026041 Bacteria 3313
371 Ga0207639_10193342 3300026041 Bacteria 1739
372 Ga0207639_10698124 3300026041 Bacteria 941
373 Ga0207639_11201843 3300026041 Bacteria 712
374 Ga0207678_10113968 3300026067 Bacteria 2307
375 Ga0207708_10079376 3300026075 Unclassified 2521
376 Ga0207708_10097756 3300026075 Bacteria 2269
377 Ga0207708_10200377 3300026075 Bacteria 1592
378 Ga0207708_10259393 3300026075 Bacteria 1403
379 Ga0207702_10212916 3300026078 Bacteria 1797
380 Ga0207641_10000088 3300026088 Bacteria 131959
381 Ga0207641_10001293 3300026088 Bacteria 24895
382 Ga0207641_10060924 3300026088 Viruses 3217
383 Ga0207641_10283125 3300026088 Bacteria 1560
384 Ga0207648_10003392 3300026089 Bacteria 16725
385 Ga0207648_10020069 3300026089 Bacteria 6028
386 Ga0207648_10440452 3300026089 Bacteria 1185
387 Ga0207676_10001932 3300026095 Bacteria 15128
388 Ga0207676_10012158 3300026095 Bacteria 6163
389 Ga0207676_10922818 3300026095 Unclassified 857
390 Ga0207674_10008588 3300026116 Bacteria 11775
391 Ga0207674_10076254 3300026116 Bacteria 3361
392 Ga0207674_10348275 3300026116 Bacteria 1432
393 Ga0207674_11321946 3300026116 Unclassified 690
394 Ga0207675_100000051 3300026118 Bacteria 83288
395 Ga0207675_100002214 3300026118 Bacteria 19316
396 Ga0207675_100019200 3300026118 Bacteria 6378
397 Ga0207675_100057142 3300026118 Bacteria 3640
398 Ga0207675_100580301 3300026118 Bacteria 1123
399 Ga0207675_102318511 3300026118 Unclassified 550
400 Ga0207683_10278452 3300026121 Bacteria 1529
401 Ga0207698_10130365 3300026142 Bacteria 2147
402 Ga0207698_10288057 3300026142 Unclassified 1522
403 Ga0207698_10504381 3300026142 Bacteria 1178
404 Ga0207698_10906801 3300026142 Bacteria 889
405 Ga0207428_10009181 3300027907 Bacteria 8883
406 Ga0268266_10000928 3300028379 Bacteria 37520
407 Ga0268265_10018971 3300028380 Bacteria 4776
408 Ga0268265_10561603 3300028380 Viruses 1085
409 Ga0268264_10045352 3300028381 Bacteria 3649
410 Ga0268264_10184031 3300028381 Unclassified 1900
411 Ga0268264_10612904 3300028381 Bacteria 1074
412 Ga0268264_12581331 3300028381 Bacteria 513
413 Ga0395900_0042853 3300037418 Bacteria 4663
414 Ga0395905_0085022 3300037471 Unclassified 2965
415 Ga0395905_0330810 3300037471 Bacteria 1414
416 Ga0436365_0747781 3300039437 Bacteria 1293
417 Ga0439431_0271280 3300041997 Bacteria 507
418 Ga0453684_0464676 3300044712 Bacteria 1406
419 Ga0466959_0270340 3300045049 Bacteria 1168
420 Ga0466967_1599791 3300045976 Unclassified 649
421 Ga0495585_0000477 3300046492 Bacteria 38276
422 Ga0495606_0049472 3300046507 Bacteria 2756
423 Ga0495606_0061181 3300046507 Bacteria 2409
424 Ga0495621_0023151 3300046539 Bacteria 2065
425 Ga0495659_0501302 3300046664 Bacteria 532
426 Ga0495647_0416510 3300046681 Bacteria 619
427 Ga0495660_0002852 3300046810 Bacteria 10868
428 Ga0495686_0359519 3300047472 Unclassified 790
429 Ga0496102_0516359 3300048905 Bacteria 1117
430 Ga0496109_0034473 3300048912 Bacteria 4559
431 Ga0496109_1247676 3300048912 Bacteria 680
432 Ga0496109_1831304 3300048912 Bacteria 540
433 Ga0496111_1011542 3300048914 Bacteria 595
434 Ga0496114_0463942 3300048917 Bacteria 1121
435 Ga0501233_245073 3300049668 Bacteria 537
436 Ga0501268_142866 3300049765 Bacteria 547
437 nmdc:mga08y16_278625_c1 3300050511 Bacteria 1725
438 nmdc:mga08y16_32637_c1 3300050511 Bacteria 5473
439 nmdc:mga08y16_491685_c1 3300050511 Bacteria 1247
440 nmdc:mga08y16_663484_c1 3300050511 Unclassified 1046
441 nmdc:mga0rr50_880184_c1 3300050513 Bacteria 764
442 Ga0500628_092364 3300053129 Bacteria 790
443 Ga0070658_10000398
444 MRS1b_contig_877338
445 JGI25406J46586_10005898
446 Ga0065704_10513860
447 Ga0065712_10017743
448 Ga0065712_10021007
449 Ga0065712_10211753
450 Ga0065715_10014705
451 Ga0065707_10190463
452 Ga0065707_10463657
453 Ga0070658_10232022
454 Ga0070676_10047665
455 Ga0070676_10089088
456 Ga0070676_10605162
457 Ga0070683_100114452
458 Ga0070670_100035570
459 Ga0070670_100113988
460 Ga0070670_100146322
461 Ga0070670_100147071
462 Ga0070670_100194212
463 Ga0070670_100971827
464 Ga0068869_100086097
465 Ga0068869_100188587
466 Ga0068869_100379226
467 Ga0070666_10000272
468 Ga0070666_10454767
469 Ga0070682_100000012
470 Ga0070682_100505156
471 Ga0070682_100949214
472 Ga0068868_100003557
473 Ga0068868_101270537
474 Ga0068868_101278874
475 Ga0070689_100079452
476 Ga0070689_100304383
477 Ga0070689_100939775
478 Ga0070691_10339465
479 Ga0070687_100062904
480 Ga0070687_100170413
481 Ga0070687_100222641
482 Ga0070661_100057754
483 Ga0070661_100447720
484 Ga0070668_100000154
485 Ga0070668_100077651
486 Ga0070668_100495241
487 Ga0070669_100004132
488 Ga0070669_100031386
489 Ga0070675_100049857
490 Ga0070675_100211582
491 Ga0070675_100305396
492 Ga0070675_100404255
493 Ga0070671_100051568
494 Ga0070671_100266791
495 Ga0070671_101585108
496 Ga0070671_101937541
497 Ga0070673_100000659
498 Ga0070673_100015190
499 Ga0070673_100249795
500 Ga0070673_100556736
501 Ga0070673_102341345
502 Ga0070688_100016320
503 Ga0070659_100266108
504 Ga0070667_100001281
505 Ga0070667_100508520
506 Ga0070701_10227784
507 Ga0070700_100047049
508 Ga0070700_100319212
509 Ga0070700_100473038
510 Ga0070708_100930098
511 Ga0070663_100093874
512 Ga0070662_100004374
513 Ga0070662_100049257
514 Ga0070681_10501611
515 Ga0070681_10592433
516 Ga0070681_10908944
517 Ga0070681_11150385
518 Ga0068867_100002979
519 Ga0068867_100016941
520 Ga0068867_102397139
521 Ga0070685_10188182
522 Ga0070706_100893317
523 Ga0070707_101281752
524 Ga0070698_100011891
525 Ga0070679_100410368
526 Ga0070679_100410718
527 Ga0070679_100432965
528 Ga0070684_100003999
529 Ga0068853_100061924
530 Ga0068853_100094822
531 Ga0068853_100545202
532 Ga0068853_100900323
533 Ga0070672_100000048
534 Ga0070672_100106976
535 Ga0070672_100155709
536 Ga0070672_100324347
537 Ga0070672_100753912
538 Ga0070672_101252393
539 Ga0070686_100016862
540 Ga0070686_100375109
541 Ga0070665_100001032
542 Ga0068855_100001217
543 Ga0068855_100090831
544 Ga0068855_100294821
545 Ga0070664_100026062
546 Ga0070664_100035175
547 Ga0070664_100665009
548 Ga0070664_101210069
549 Ga0068857_100035349
550 Ga0068857_100164591
551 Ga0068857_100477282
552 Ga0068857_100738449
553 Ga0068857_101097718
554 Ga0068854_100616145
555 Ga0068856_100166194
556 Ga0070702_101208713
557 Ga0068852_100026666
558 Ga0068852_100099800
559 Ga0068852_100375996
560 Ga0068852_100497358
561 Ga0068859_100026430
562 Ga0068859_100055912
563 Ga0068859_100069953
564 Ga0068859_100189681
565 Ga0068859_100200409
566 Ga0068859_101103507
567 Ga0068864_100000537
568 Ga0068864_100103602
569 Ga0068864_100208753
570 Ga0068864_100418154
571 Ga0068864_100673807
572 Ga0068861_100001116
573 Ga0068861_100014031
574 Ga0068861_100025080
575 Ga0068861_100213622
576 Ga0068861_102217925
577 Ga0068851_10000972
578 Ga0068851_10100608
579 Ga0068851_10142673
580 Ga0068851_10207530
581 Ga0068851_10552008
582 Ga0068870_10080144
583 Ga0068870_10900474
584 Ga0068863_100000750
585 Ga0068863_100182166
586 Ga0068863_100304453
587 Ga0068863_100679828
588 Ga0068863_100886937
589 Ga0068863_101071046
590 Ga0068858_100001076
591 Ga0068858_100415490
592 Ga0068858_101112610
593 Ga0068860_100064383
594 Ga0068860_100129097
595 Ga0068860_100679830
596 Ga0068860_100733071
597 Ga0068860_101010703
598 Ga0068862_100016049
599 Ga0081539_10000925
600 Ga0070715_10096179
601 Ga0070715_10125327
602 Ga0070715_10539186
603 Ga0070715_10782877
604 Ga0097621_100002050
605 Ga0097621_100011509
606 Ga0097621_100037629
607 Ga0097621_100123540
608 Ga0097621_101634956
609 Ga0097621_102060025
610 Ga0068871_100002809
611 Ga0068871_100072795
612 Ga0068871_100382527
613 Ga0068871_100443714
614 Ga0068871_100630550
615 Ga0068871_100726545
616 Ga0075428_102322616
617 Ga0068865_100039098
618 Ga0068865_100649817
619 Ga0097620_100026430
620 Ga0097620_100055911
621 Ga0097620_100069953
622 Ga0097620_100189679
623 Ga0097620_100200402
624 Ga0075435_100633293
625 Ga0105240_10209840
626 Ga0105240_10218156
627 Ga0111539_10520454
628 Ga0111539_10674091
629 Ga0111539_10845635
630 Ga0105245_10022170
631 Ga0105247_11687041
632 Ga0105243_10384548
633 Ga0105243_12759038
634 Ga0105241_10289113
635 Ga0105241_10327890
636 Ga0105242_10013653
637 Ga0105242_11054279
638 Ga0105242_11078568
639 Ga0105248_10046457
640 Ga0105248_11069768
641 Ga0105237_10091667
642 Ga0105237_11124232
643 Ga0105238_10498286
644 Ga0105249_10003840
645 Ga0105249_10015267
646 Ga0105249_10036218
647 Ga0105249_10047325
648 Ga0105249_10508173
649 Ga0105249_11764536
650 Ga0105239_10028973
651 Ga0105239_10180102
652 Ga0105246_10009854
653 Ga0105246_10166951
654 Ga0157373_10461314
655 Ga0157371_10002637
656 Ga0157371_10106507
657 Ga0157371_10298373
658 Ga0157370_10090008
659 Ga0157370_10456923
660 Ga0157369_10042045
661 Ga0157369_10078500
662 Ga0157374_10000314
663 Ga0157374_10014794
664 Ga0157374_10080983
665 Ga0157374_11174225
666 Ga0157378_10011389
667 Ga0157378_10157289
668 Ga0157378_10294627
669 Ga0163162_10000231
670 Ga0163162_10020750
671 Ga0163162_10024712
672 Ga0163162_10035044
673 Ga0163162_10464827
674 Ga0163162_10660533
675 Ga0163162_10663704
676 Ga0157372_10018692
677 Ga0157372_10026442
678 Ga0157372_10072035
679 Ga0157372_10153451
680 Ga0157372_10263853
681 Ga0157372_10699806
682 Ga0157372_11196992
683 Ga0157375_10000272
684 Ga0157375_10168095
685 Ga0157375_10322314
686 Ga0157375_10346728
687 Ga0157375_10542895
688 Ga0157375_12168493
689 Ga0157375_12322439
690 Ga0163163_10000347
691 Ga0163163_10003656
692 Ga0163163_10097956
693 Ga0163163_10187745
694 Ga0163163_10247578
695 Ga0163163_10323635
696 Ga0163163_10851076
697 Ga0163163_12304344
698 Ga0157380_10023609
699 Ga0157380_10092305
700 Ga0157380_10200587
701 Ga0157380_11049994
702 Ga0157377_10003057
703 Ga0157377_10011305
704 Ga0157377_10025169
705 Ga0157379_10000120
706 Ga0157379_10116521
707 Ga0157379_10566930
708 Ga0157376_10000271
709 Ga0157376_10004812
710 Ga0157376_10117634
711 Ga0157376_10748541
712 Ga0163161_10149488
713 Ga0163161_10275893
714 Ga0163161_10618985
715 Ga0163161_10723426
716 Ga0163161_11084006
717 Ga0207697_10027640
718 Ga0207697_10040285
719 Ga0207697_10059438
720 Ga0207656_10000986
721 Ga0207656_10017922
722 Ga0207656_10020175
723 Ga0207656_10400498
724 Ga0207710_10715808
725 Ga0207680_10006645
726 Ga0207680_10883634
727 Ga0207647_10145455
728 Ga0207647_10182555
729 Ga0207645_10052898
730 Ga0207645_10055344
731 Ga0207645_10156567
732 Ga0207643_10011494
733 Ga0207643_10014215
734 Ga0207705_10000725
735 Ga0207705_10093666
736 Ga0207707_10581003
737 Ga0207707_11380374
738 Ga0207707_11580464
739 Ga0207695_10016793
740 Ga0207695_10257206
741 Ga0207671_10058929
742 Ga0207671_10979079
743 Ga0207660_11194380
744 Ga0207662_10147918
745 Ga0207662_10216509
746 Ga0207662_10519466
747 Ga0207649_10234704
748 Ga0207649_10247310
749 Ga0207652_10447490
750 Ga0207652_10586758
751 Ga0207646_10478684
752 Ga0207681_10153929
753 Ga0207681_10182345
754 Ga0207650_10009536
755 Ga0207650_10100474
756 Ga0207650_10123697
757 Ga0207650_10171621
758 Ga0207650_10246925
759 Ga0207650_10471196
760 Ga0207650_11464700
761 Ga0207659_10095257
762 Ga0207659_10171843
763 Ga0207659_10612890
764 Ga0207687_10031163
765 Ga0207706_10004110
766 Ga0207706_10005361
767 Ga0207706_10205773
768 Ga0207686_10001012
769 Ga0207686_10008710
770 Ga0207686_11217663
771 Ga0207709_10523753
772 Ga0207670_10008475
773 Ga0207670_10022841
774 Ga0207704_10001084
775 Ga0207704_10440440
776 Ga0207704_10551300
777 Ga0207691_10000245
778 Ga0207691_10029071
779 Ga0207691_10118904
780 Ga0207691_10133249
781 Ga0207691_10390920
782 Ga0207711_10026764
783 Ga0207711_10742148
784 Ga0207689_10073992
785 Ga0207689_10134854
786 Ga0207661_10233261
787 Ga0207661_11137933
788 Ga0207679_10028395
789 Ga0207679_10507305
790 Ga0207679_11769400
791 Ga0207667_10026712
792 Ga0207667_10030259
793 Ga0207651_10002054
794 Ga0207651_10100000
795 Ga0207651_10165276
796 Ga0207651_10623089
797 Ga0207651_10629167
798 Ga0207712_10003365
799 Ga0207712_10005499
800 Ga0207712_10029383
801 Ga0207668_10000184
802 Ga0207668_10116417
803 Ga0207668_10962908
804 Ga0207640_10908330
805 Ga0207658_10000452
806 Ga0207658_10344772
807 Ga0207677_10000771
808 Ga0207677_10042666
809 Ga0207677_10151513
810 Ga0207703_10000388
811 Ga0207703_10037091
812 Ga0207639_10045276
813 Ga0207639_10193342
814 Ga0207639_10698124
815 Ga0207639_11201843
816 Ga0207678_10113968
817 Ga0207708_10079376
818 Ga0207708_10097756
819 Ga0207708_10200377
820 Ga0207708_10259393
821 Ga0207702_10212916
822 Ga0207641_10000088
823 Ga0207641_10001293
824 Ga0207641_10060924
825 Ga0207641_10283125
826 Ga0207648_10003392
827 Ga0207648_10020069
828 Ga0207648_10440452
829 Ga0207676_10001932
830 Ga0207676_10012158
831 Ga0207676_10922818
832 Ga0207674_10008588
833 Ga0207674_10076254
834 Ga0207674_10348275
835 Ga0207674_11321946
836 Ga0207675_100000051
837 Ga0207675_100002214
838 Ga0207675_100019200
839 Ga0207675_100057142
840 Ga0207675_100580301
841 Ga0207675_102318511
842 Ga0207683_10278452
843 Ga0207698_10130365
844 Ga0207698_10288057
845 Ga0207698_10504381
846 Ga0207698_10906801
847 Ga0207428_10009181
848 Ga0268266_10000928
849 Ga0268265_10018971
850 Ga0268265_10561603
851 Ga0268264_10045352
852 Ga0268264_10184031
853 Ga0268264_10612904
854 Ga0268264_12581331
855 Ga0395900_0042853
856 Ga0395905_0085022
857 Ga0395905_0330810
858 Ga0436365_0747781
859 Ga0439431_0271280
860 Ga0453684_0464676
861 Ga0466959_0270340
862 Ga0466967_1599791
863 Ga0495585_0000477
864 Ga0495606_0049472
865 Ga0495606_0061181
866 Ga0495621_0023151
867 Ga0495659_0501302
868 Ga0495647_0416510
869 Ga0495660_0002852
870 Ga0495686_0359519
871 Ga0496102_0516359
872 Ga0496109_0034473
873 Ga0496109_1247676
874 Ga0496109_1831304
875 Ga0496111_1011542
876 Ga0496114_0463942
877 Ga0501233_245073
878 Ga0501268_142866
879 nmdc:mga08y16_278625_c1
880 nmdc:mga08y16_32637_c1
881 nmdc:mga08y16_491685_c1
882 nmdc:mga08y16_663484_c1
883 nmdc:mga0rr50_880184_c1
884 Ga0500628_092364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20409

SnoaL_5

SnoaL-like domain

9

129

0.97

PF12680

SnoaL_2

SnoaL-like domain

15

125

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9422 7 124
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9345 7 124
3ec9-assembly1.cif.gz_A crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution 0.8366 7 123
5tph-assembly1.cif.gz_A crystal structure of a de novo designed protein homodimer with curved beta-sheet 0.8215 1 122
3g8z-assembly1.cif.gz_A-2 crystal structure of protein of unknown function with cystatin-like fold (np_639274.1) from xanthomonas campestris at 1.90 a resolution 0.8205 7 123
ID Description Score Start End Superfamily
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9424 8 124 3.10.450.50
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9344 8 124 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8896 11 123 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8745 11 123 3.10.450.50
3ec9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8229 7 123 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3D2SBG4-F1-model_v4 SnoaL-like domain-containing protein 0.9979 7 124
AF-A0A3D2SBG4-F1-model_v4 SnoaL-like domain-containing protein 0.9895 7 124
AF-A0A7W1EDJ0-F1-model_v4 Nuclear transport factor 2 family protein 0.983 7 124
AF-A0A2T7QAL4-F1-model_v4 SnoaL-like domain-containing protein 0.981 7 124
AF-A0A7K1UCE6-F1-model_v4 Nuclear transport factor 2 family protein 0.981 7 124

Map