F444643

General Info

Members Datasets Scaffolds Average Seq Length
441 219 882 270

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10008383|Ga0105243_100083838
Length 304
Sequence VLSLLEATSALQSLPFKFARSGSKRMPDLMTGEKRDLMAKFFAITIIVIAIASAIPILRHSWPEPQDISVHGHLIDEQMSETMAEAGISFLAAQFILAFFIWKFSNRPKDAKIGKFPGGARGLVIAAFLLVGTEVLALGIFGTRAWASVYFTPPAADAMPIQVQAGQFAFYFRYPGPDGKFGPLHPSLISESDANFFGLDLTNDQDSKDDIVTAEMAIPVNHEIHLLMHAKDVGHSFYVPELRVQQDFVPGLDLSIHFTATKTGRYEIVCTQLCGLGHYNMKAYLSVLSQTDFDDWLKKQAALQ

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
96 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
146 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 3.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.76
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 14.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10008383 3300009148 Bacteria 7931
2 MRS1b_contig_100842 2162886011 Bacteria 2269
3 MBSR1b_contig_2896016 2162886012 Bacteria 1416
4 LJNas_1000011 3300000546 Bacteria 24110
5 Ga0065712_10071007 3300005290 Bacteria 5538
6 Ga0065715_10155006 3300005293 Bacteria 1683
7 Ga0070658_10021175 3300005327 Bacteria 5208
8 Ga0070658_10501999 3300005327 Bacteria 1048
9 Ga0070676_10072050 3300005328 Bacteria 2076
10 Ga0070683_100015619 3300005329 Bacteria 6673
11 Ga0070683_100052639 3300005329 Bacteria 3772
12 Ga0070690_100029450 3300005330 Unclassified 3406
13 Ga0068869_100025322 3300005334 Unclassified 4118
14 Ga0070666_10007783 3300005335 Bacteria 6618
15 Ga0070666_10087604 3300005335 Bacteria 2134
16 Ga0070682_100006143 3300005337 Bacteria 6728
17 Ga0070660_100006565 3300005339 Bacteria 8071
18 Ga0070660_100030206 3300005339 Bacteria 4064
19 Ga0070687_100178616 3300005343 Bacteria 1270
20 Ga0070661_100016822 3300005344 Bacteria 5176
21 Ga0070661_100024111 3300005344 Bacteria 4364
22 Ga0070668_100012175 3300005347 Bacteria 6406
23 Ga0070669_100019337 3300005353 Bacteria 4865
24 Ga0070671_100072264 3300005355 Unclassified 2880
25 Ga0070674_100288764 3300005356 Bacteria 1303
26 Ga0070659_100003966 3300005366 Bacteria 10534
27 Ga0070659_100028456 3300005366 Bacteria 4316
28 Ga0070667_100014654 3300005367 Bacteria 6478
29 Ga0070709_10001253 3300005434 Bacteria 13892
30 Ga0070709_10076988 3300005434 Bacteria 2167
31 Ga0070709_10106250 3300005434 Bacteria 1879
32 Ga0070709_10127651 3300005434 Bacteria 1732
33 Ga0070714_100001108 3300005435 Bacteria 19307
34 Ga0070714_100021048 3300005435 Bacteria 5332
35 Ga0070714_100085964 3300005435 Bacteria 2748
36 Ga0070714_100172395 3300005435 Bacteria 1964
37 Ga0070714_100698049 3300005435 Unclassified 979
38 Ga0070713_100000034 3300005436 Bacteria 86671
39 Ga0070713_100002283 3300005436 Bacteria 12462
40 Ga0070713_100049829 3300005436 Bacteria 3457
41 Ga0070713_100066700 3300005436 Bacteria 3027
42 Ga0070713_100189328 3300005436 Unclassified 1853
43 Ga0070713_100523401 3300005436 Unclassified 1121
44 Ga0070710_10001688 3300005437 Bacteria 10408
45 Ga0070711_100000764 3300005439 Bacteria 16749
46 Ga0070711_100023678 3300005439 Bacteria 3997
47 Ga0070711_100051542 3300005439 Bacteria 2827
48 Ga0070711_100071094 3300005439 Bacteria 2451
49 Ga0070711_100178659 3300005439 Unclassified 1624
50 Ga0070700_100023373 3300005441 Bacteria 3614
51 Ga0070708_100002775 3300005445 Bacteria 13598
52 Ga0070708_100009489 3300005445 Bacteria 7843
53 Ga0070708_100084478 3300005445 Bacteria 2879
54 Ga0070708_100093920 3300005445 Bacteria 2736
55 Ga0070708_100109065 3300005445 Bacteria 2543
56 Ga0070708_100163490 3300005445 Bacteria 2075
57 Ga0070708_100396993 3300005445 Bacteria 1300
58 Ga0070708_100483125 3300005445 Unclassified 1169
59 Ga0070663_100036460 3300005455 Bacteria 3417
60 Ga0070663_100040510 3300005455 Bacteria 3262
61 Ga0070662_100013600 3300005457 Bacteria 5418
62 Ga0070662_100013902 3300005457 Bacteria 5362
63 Ga0070681_10013124 3300005458 Bacteria 8230
64 Ga0070681_10125491 3300005458 Bacteria 2499
65 Ga0068867_100009407 3300005459 Bacteria 6895
66 Ga0068867_100336231 3300005459 Bacteria 1256
67 Ga0070706_100020116 3300005467 Bacteria 6151
68 Ga0070706_100099032 3300005467 Bacteria 2709
69 Ga0070707_100036629 3300005468 Bacteria 4681
70 Ga0070707_100042899 3300005468 Bacteria 4331
71 Ga0070707_100063346 3300005468 Bacteria 3549
72 Ga0070707_100067329 3300005468 Bacteria 3445
73 Ga0070707_100067482 3300005468 Bacteria 3441
74 Ga0070698_100028556 3300005471 Bacteria 5793
75 Ga0070698_100227850 3300005471 Bacteria 1797
76 Ga0070698_100303006 3300005471 Bacteria 1529
77 Ga0070699_100019787 3300005518 Bacteria 5802
78 Ga0070699_100024249 3300005518 Bacteria 5226
79 Ga0070699_100040227 3300005518 Unclassified 4048
80 Ga0070699_100204955 3300005518 Bacteria 1754
81 Ga0070699_100435451 3300005518 Bacteria 1188
82 Ga0070679_100131109 3300005530 Unclassified 2488
83 Ga0070679_100131224 3300005530 Unclassified 2487
84 Ga0070684_100005526 3300005535 Bacteria 9699
85 Ga0070697_100000015 3300005536 Bacteria 143397
86 Ga0070697_100002018 3300005536 Bacteria 15534
87 Ga0070697_100021297 3300005536 Bacteria 5136
88 Ga0070697_100049834 3300005536 Bacteria 3398
89 Ga0070697_100064202 3300005536 Bacteria 2999
90 Ga0068853_100007807 3300005539 Bacteria 8581
91 Ga0068853_100013721 3300005539 Bacteria 6618
92 Ga0070695_100008138 3300005545 Bacteria 6215
93 Ga0070696_100109693 3300005546 Bacteria 1986
94 Ga0070693_100005545 3300005547 Bacteria 6070
95 Ga0070693_100025953 3300005547 Bacteria 3157
96 Ga0070665_100022707 3300005548 Bacteria 6315
97 Ga0068855_100060799 3300005563 Bacteria 4416
98 Ga0068855_100153955 3300005563 Bacteria 2613
99 Ga0068855_100286833 3300005563 Bacteria 1826
100 Ga0070664_100044955 3300005564 Unclassified 3729
101 Ga0068857_100035315 3300005577 Bacteria 4427
102 Ga0068857_100059823 3300005577 Bacteria 3385
103 Ga0068854_100031855 3300005578 Bacteria 3666
104 Ga0068854_100067665 3300005578 Bacteria 2602
105 Ga0068856_100000875 3300005614 Bacteria 32269
106 Ga0068856_100012828 3300005614 Bacteria 8110
107 Ga0068856_100037346 3300005614 Bacteria 4767
108 Ga0068856_100206146 3300005614 Bacteria 1981
109 Ga0068856_100219145 3300005614 Viruses 1918
110 Ga0068852_100011726 3300005616 Bacteria 6615
111 Ga0068859_100019934 3300005617 Bacteria 6732
112 Ga0068864_100150090 3300005618 Bacteria 2110
113 Ga0068866_10019725 3300005718 Bacteria 3076
114 Ga0068866_10024454 3300005718 Bacteria 2825
115 Ga0068863_100026936 3300005841 Bacteria 5481
116 Ga0068858_100017361 3300005842 Bacteria 6750
117 Ga0068858_100163679 3300005842 Bacteria 2095
118 Ga0068858_100216294 3300005842 Bacteria 1814
119 Ga0068860_100016831 3300005843 Bacteria 7127
120 Ga0070717_10001493 3300006028 Bacteria 16171
121 Ga0070717_10006463 3300006028 Bacteria 8622
122 Ga0070717_10026008 3300006028 Bacteria 4665
123 Ga0070717_10077194 3300006028 Bacteria 2788
124 Ga0070717_10212883 3300006028 Unclassified 1697
125 Ga0070717_10214500 3300006028 Bacteria 1690
126 Ga0070717_10230594 3300006028 Bacteria 1630
127 Ga0070717_10452701 3300006028 Unclassified 1157
128 Ga0070715_10018318 3300006163 Bacteria 2666
129 Ga0070716_100002333 3300006173 Bacteria 8736
130 Ga0070716_100039708 3300006173 Bacteria 2614
131 Ga0070716_100081424 3300006173 Bacteria 1933
132 Ga0070716_100102478 3300006173 Unclassified 1758
133 Ga0070716_100238850 3300006173 Bacteria 1231
134 Ga0070712_100000020 3300006175 Bacteria 84120
135 Ga0070712_100000696 3300006175 Bacteria 19839
136 Ga0070712_100009979 3300006175 Bacteria 5986
137 Ga0070712_100033767 3300006175 Bacteria 3463
138 Ga0070712_100064323 3300006175 Unclassified 2601
139 Ga0070712_100176480 3300006175 Bacteria 1662
140 Ga0070712_100328083 3300006175 Bacteria 1246
141 Ga0097621_100010461 3300006237 Bacteria 6795
142 Ga0097621_100064238 3300006237 Bacteria 3018
143 Ga0097621_100112938 3300006237 Unclassified 2298
144 Ga0068871_100384451 3300006358 Unclassified 1247
145 Ga0075434_100146114 3300006871 Bacteria 2385
146 Ga0075436_100004989 3300006914 Bacteria 9121
147 Ga0097620_100019934 3300006931 Bacteria 6732
148 Ga0075435_100008155 3300007076 Bacteria 7502
149 Ga0099794_10032001 3300007265 Bacteria 2466
150 Ga0099794_10034015 3300007265 Bacteria 2399
151 Ga0099794_10042479 3300007265 Bacteria 2168
152 Ga0099794_10073337 3300007265 Bacteria 1680
153 Ga0099795_10020010 3300007788 Bacteria 2174
154 Ga0105240_10011801 3300009093 Bacteria 12136
155 Ga0105240_10019833 3300009093 Bacteria 8980
156 Ga0105240_10033865 3300009093 Bacteria 6597
157 Ga0105241_10003292 3300009174 Bacteria 12023
158 Ga0105241_10465369 3300009174 Unclassified 1121
159 Ga0105242_10007812 3300009176 Bacteria 8231
160 Ga0105242_10008505 3300009176 Bacteria 7879
161 Ga0105248_10024246 3300009177 Bacteria 6745
162 Ga0105237_10037253 3300009545 Bacteria 4918
163 Ga0105237_10170849 3300009545 Unclassified 2174
164 Ga0105238_10026509 3300009551 Bacteria 5910
165 Ga0105238_10046295 3300009551 Bacteria 4390
166 Ga0105238_10270391 3300009551 Bacteria 1680
167 Ga0105249_10023998 3300009553 Bacteria 5477
168 Ga0105239_10021569 3300010375 Bacteria 7103
169 Ga0105239_10443265 3300010375 Unclassified 1473
170 Ga0105246_10033127 3300011119 Unclassified 3432
171 Ga0157373_10004742 3300013100 Bacteria 10230
172 Ga0157373_10023429 3300013100 Bacteria 4476
173 Ga0157371_10009162 3300013102 Bacteria 7817
174 Ga0157370_10086633 3300013104 Bacteria 2942
175 Ga0157369_10006401 3300013105 Bacteria 13649
176 Ga0157369_10021915 3300013105 Bacteria 7141
177 Ga0157369_10039962 3300013105 Bacteria 5124
178 Ga0157369_10045511 3300013105 Bacteria 4772
179 Ga0157369_10260797 3300013105 Bacteria 1807
180 Ga0157374_10003717 3300013296 Bacteria 12825
181 Ga0157374_10044436 3300013296 Bacteria 4107
182 Ga0157374_10051117 3300013296 Bacteria 3845
183 Ga0157374_10421346 3300013296 Bacteria 1334
184 Ga0157378_10104866 3300013297 Bacteria 2584
185 Ga0157378_10200569 3300013297 Bacteria 1887
186 Ga0163162_10028620 3300013306 Bacteria 5514
187 Ga0157372_10001648 3300013307 Bacteria 24237
188 Ga0157372_10002687 3300013307 Bacteria 19230
189 Ga0157372_10015499 3300013307 Bacteria 8172
190 Ga0157372_10033050 3300013307 Bacteria 5678
191 Ga0157372_10033653 3300013307 Bacteria 5632
192 Ga0157372_10040708 3300013307 Bacteria 5134
193 Ga0157372_10078654 3300013307 Bacteria 3727
194 Ga0157375_10014488 3300013308 Bacteria 7035
195 Ga0163163_10035702 3300014325 Bacteria 4824
196 Ga0163163_10199206 3300014325 Bacteria 2051
197 Ga0182008_10008077 3300014497 Bacteria 5765
198 Ga0157376_10075030 3300014969 Bacteria 2885
199 Ga0182006_1086673 3300015261 Bacteria 1133
200 Ga0182007_10003880 3300015262 Bacteria 6934
201 Ga0182005_1007418 3300015265 Bacteria 3291
202 Ga0213874_10014097 3300021377 Bacteria 2084
203 Ga0224570_100005 3300022730 Bacteria 8903
204 Ga0224571_100152 3300022734 Bacteria 3063
205 Ga0224572_1010716 3300024225 Bacteria 1728
206 Ga0224572_1012973 3300024225 Bacteria 1588
207 Ga0224572_1016408 3300024225 Bacteria 1420
208 Ga0228598_1000082 3300024227 Bacteria 14801
209 Ga0228598_1000153 3300024227 Bacteria 12012
210 Ga0228598_1000815 3300024227 Bacteria 6717
211 Ga0207697_10063254 3300025315 Bacteria 1542
212 Ga0207692_10000642 3300025898 Bacteria 12296
213 Ga0207692_10026503 3300025898 Bacteria 2719
214 Ga0207642_10167860 3300025899 Bacteria 1184
215 Ga0207647_10058666 3300025904 Bacteria 2356
216 Ga0207699_10003370 3300025906 Bacteria 7616
217 Ga0207699_10003622 3300025906 Bacteria 7388
218 Ga0207699_10057221 3300025906 Bacteria 2327
219 Ga0207699_10179663 3300025906 Bacteria 1422
220 Ga0207684_10017655 3300025910 Bacteria 6121
221 Ga0207684_10320859 3300025910 Bacteria 1335
222 Ga0207654_10003092 3300025911 Bacteria 8426
223 Ga0207654_10022080 3300025911 Bacteria 3391
224 Ga0207654_10125400 3300025911 Bacteria 1618
225 Ga0207707_10099166 3300025912 Bacteria 2546
226 Ga0207695_10040776 3300025913 Bacteria 4973
227 Ga0207695_10057846 3300025913 Bacteria 4027
228 Ga0207695_10077876 3300025913 Bacteria 3366
229 Ga0207671_10070045 3300025914 Bacteria 2614
230 Ga0207671_10107199 3300025914 Bacteria 2122
231 Ga0207671_10129347 3300025914 Unclassified 1937
232 Ga0207693_10000080 3300025915 Bacteria 86060
233 Ga0207693_10001336 3300025915 Bacteria 21795
234 Ga0207693_10005678 3300025915 Bacteria 10373
235 Ga0207693_10050025 3300025915 Unclassified 3282
236 Ga0207693_10058740 3300025915 Bacteria 3013
237 Ga0207693_10071740 3300025915 Unclassified 2711
238 Ga0207663_10000723 3300025916 Bacteria 14736
239 Ga0207663_10038792 3300025916 Bacteria 2882
240 Ga0207663_10050635 3300025916 Bacteria 2582
241 Ga0207663_10170892 3300025916 Bacteria 1544
242 Ga0207660_10183025 3300025917 Bacteria 1628
243 Ga0207662_10180038 3300025918 Bacteria 1360
244 Ga0207657_10002282 3300025919 Bacteria 20782
245 Ga0207657_10004823 3300025919 Bacteria 14205
246 Ga0207649_10137758 3300025920 Bacteria 1666
247 Ga0207652_10032261 3300025921 Bacteria 4401
248 Ga0207652_10092098 3300025921 Bacteria 2666
249 Ga0207652_10100537 3300025921 Bacteria 2553
250 Ga0207646_10008803 3300025922 Bacteria 10072
251 Ga0207646_10040791 3300025922 Bacteria 4174
252 Ga0207646_10114466 3300025922 Bacteria 2422
253 Ga0207646_10187041 3300025922 Bacteria 1871
254 Ga0207646_10221300 3300025922 Bacteria 1710
255 Ga0207646_10433547 3300025922 Bacteria 1186
256 Ga0207694_10022047 3300025924 Bacteria 4830
257 Ga0207694_10041123 3300025924 Bacteria 3561
258 Ga0207650_10056117 3300025925 Bacteria 2926
259 Ga0207687_10149641 3300025927 Bacteria 1780
260 Ga0207700_10000364 3300025928 Bacteria 26445
261 Ga0207700_10019576 3300025928 Bacteria 4574
262 Ga0207700_10036867 3300025928 Bacteria 3536
263 Ga0207700_10233268 3300025928 Bacteria 1565
264 Ga0207700_10513646 3300025928 Unclassified 1061
265 Ga0207664_10000217 3300025929 Bacteria 43328
266 Ga0207664_10155387 3300025929 Bacteria 1947
267 Ga0207664_10218041 3300025929 Bacteria 1653
268 Ga0207664_10262679 3300025929 Bacteria 1510
269 Ga0207664_10388143 3300025929 Unclassified 1240
270 Ga0207644_10025834 3300025931 Bacteria 4041
271 Ga0207690_10021996 3300025932 Bacteria 3961
272 Ga0207706_10000964 3300025933 Bacteria 29432
273 Ga0207706_10013489 3300025933 Bacteria 7426
274 Ga0207709_10101029 3300025935 Bacteria 1907
275 Ga0207669_10257110 3300025937 Unclassified 1304
276 Ga0207704_10118501 3300025938 Bacteria 1806
277 Ga0207665_10000263 3300025939 Bacteria 36526
278 Ga0207665_10007874 3300025939 Bacteria 7040
279 Ga0207665_10024800 3300025939 Bacteria 3955
280 Ga0207665_10057536 3300025939 Bacteria 2626
281 Ga0207665_10061213 3300025939 Unclassified 2551
282 Ga0207711_10508871 3300025941 Bacteria 1122
283 Ga0207689_10004641 3300025942 Bacteria 12429
284 Ga0207661_10259338 3300025944 Bacteria 1548
285 Ga0207679_10064274 3300025945 Bacteria 2742
286 Ga0207667_10008795 3300025949 Bacteria 11955
287 Ga0207667_10057999 3300025949 Bacteria 4062
288 Ga0207667_10194648 3300025949 Bacteria 2080
289 Ga0207668_10022883 3300025972 Bacteria 4007
290 Ga0207640_10012213 3300025981 Bacteria 4887
291 Ga0207640_10393549 3300025981 Unclassified 1126
292 Ga0207658_10010474 3300025986 Bacteria 6297
293 Ga0207703_10324614 3300026035 Bacteria 1410
294 Ga0207639_10131679 3300026041 Bacteria 2071
295 Ga0207678_10008488 3300026067 Bacteria 9055
296 Ga0207702_10001397 3300026078 Bacteria 24081
297 Ga0207702_10053206 3300026078 Bacteria 3427
298 Ga0207702_10053993 3300026078 Bacteria 3403
299 Ga0207702_10095246 3300026078 Bacteria 2615
300 Ga0207702_10100930 3300026078 Bacteria 2547
301 Ga0207648_10009505 3300026089 Bacteria 9303
302 Ga0207648_10090344 3300026089 Bacteria 2676
303 Ga0207674_10085674 3300026116 Bacteria 3145
304 Ga0207683_10236190 3300026121 Bacteria 1667
305 Ga0209588_1014422 3300027671 Bacteria 2419
306 Ga0209588_1043017 3300027671 Unclassified 1459
307 Ga0265354_1000010 3300028016 Bacteria 29992
308 Ga0265354_1000588 3300028016 Bacteria 6130
309 Ga0265354_1009031 3300028016 Unclassified 958
310 Ga0265356_1012342 3300028017 Unclassified 939
311 Ga0268266_10000194 3300028379 Bacteria 106020
312 Ga0265338_10006373 3300028800 Bacteria 15060
313 Ga0265338_10009636 3300028800 Bacteria 11462
314 Ga0265338_10032282 3300028800 Bacteria 5112
315 Ga0265338_10034235 3300028800 Bacteria 4913
316 Ga0265338_10038124 3300028800 Bacteria 4559
317 Ga0265338_10281447 3300028800 Bacteria 1215
318 Ga0265338_10295106 3300028800 Unclassified 1180
319 Ga0265762_1003954 3300030760 Bacteria 2655
320 Ga0265770_1001855 3300030878 Bacteria 2879
321 Ga0265770_1002249 3300030878 Bacteria 2628
322 Ga0265765_1000287 3300030879 Unclassified 3688
323 Ga0265760_10000128 3300031090 Bacteria 19350
324 Ga0265760_10000341 3300031090 Bacteria 13032
325 Ga0265760_10000890 3300031090 Bacteria 8636
326 Ga0265760_10011178 3300031090 Bacteria 2566
327 Ga0265760_10011183 3300031090 Bacteria 2566
328 Ga0265760_10012396 3300031090 Unclassified 2438
329 Ga0265760_10030691 3300031090 Bacteria 1583
330 Ga0265760_10032040 3300031090 Unclassified 1551
331 Ga0265760_10086599 3300031090 Bacteria 976
332 Ga0265325_10001581 3300031241 Bacteria 15865
333 Ga0265325_10022845 3300031241 Bacteria 3422
334 Ga0265340_10094430 3300031247 Bacteria 1395
335 Ga0265339_10009874 3300031249 Bacteria 5961
336 Ga0265339_10073309 3300031249 Unclassified 1821
337 Ga0265339_10123729 3300031249 Unclassified 1327
338 Ga0265339_10143442 3300031249 Viruses 1213
339 Ga0265316_10013230 3300031344 Bacteria 7346
340 Ga0265314_10059980 3300031711 Bacteria 2599
341 Ga0247548_100353 3300031814 Unclassified 1569
342 Ga0316212_1001614 3300033547 Bacteria 3101
343 Ga0316212_1004382 3300033547 Bacteria 2050
344 Ga0373934_0066095 3300035086 Bacteria 1444
345 Ga0373923_0003085 3300035111 Bacteria 5279
346 Ga0373936_0002999 3300035113 Bacteria 6311
347 Ga0373957_0007273 3300035120 Bacteria 3538
348 Ga0373943_0000183 3300035170 Bacteria 25076
349 Ga0373943_0130611 3300035170 Bacteria 1344
350 Ga0373946_0005626 3300035171 Unclassified 4527
351 Ga0373946_0029963 3300035171 Bacteria 2170
352 Ga0373955_0215267 3300035172 Unclassified 1146
353 Ga0373955_0237471 3300035172 Bacteria 1091
354 Ga0373935_0023204 3300035692 Bacteria 3811
355 Ga0373935_0084061 3300035692 Unclassified 2073
356 Ga0373935_0253775 3300035692 Unclassified 1231
357 Ga0373927_0000056 3300035695 Bacteria 81041
358 Ga0373927_0174806 3300035695 Bacteria 1408
359 Ga0373927_0315459 3300035695 Unclassified 1029
360 Ga0373933_0250960 3300035724 Unclassified 1140
361 Ga0373947_0001091 3300035725 Bacteria 16647
362 Ga0373937_0037474 3300036401 Bacteria 4419
363 Ga0373937_0109315 3300036401 Bacteria 2571
364 Ga0373937_0111273 3300036401 Bacteria 2547
365 Ga0373937_0133847 3300036401 Archaea 2317
366 Ga0373937_0502056 3300036401 Unclassified 1152
367 Ga0373925_0003123 3300037068 Bacteria 13002
368 Ga0373925_0003837 3300037068 Bacteria 11531
369 Ga0373925_0207944 3300037068 Bacteria 1558
370 Ga0373925_0212302 3300037068 Bacteria 1542
371 Ga0373925_0225199 3300037068 Bacteria 1498
372 Ga0373925_0245882 3300037068 Bacteria 1434
373 Ga0373925_0423390 3300037068 Unclassified 1088
374 Ga0395905_0294192 3300037471 Bacteria 1511
375 Ga0436360_1355452 3300039438 Unclassified 873
376 Ga0436363_0640600 3300039450 Bacteria 1135
377 Ga0436363_0971557 3300039450 Bacteria 14307
378 Ga0436362_1113368 3300039453 Bacteria 8064
379 Ga0466966_0160662 3300044684 Unclassified 1368
380 Ga0466963_0175103 3300044694 Unclassified 1497
381 Ga0466964_0029260 3300044706 Bacteria 2174
382 Ga0466967_0100858 3300045976 Bacteria 2638
383 Ga0495592_0273389 3300046454 Bacteria 1108
384 Ga0495603_0128843 3300046455 Bacteria 1474
385 Ga0495651_0184992 3300046462 Bacteria 1471
386 Ga0495580_0000530 3300046472 Bacteria 32278
387 Ga0495580_0006109 3300046472 Bacteria 9850
388 Ga0495580_0059354 3300046472 Bacteria 2688
389 Ga0495580_0151920 3300046472 Bacteria 1604
390 Ga0495580_0323954 3300046472 Unclassified 1047
391 Ga0495664_0021849 3300046477 Bacteria 3699
392 Ga0495608_0357968 3300046511 Bacteria 897
393 Ga0495628_0125021 3300046516 Bacteria 1971
394 Ga0495630_0072464 3300046517 Bacteria 2593
395 Ga0495630_0104644 3300046517 Unclassified 2142
396 Ga0495630_0284545 3300046517 Unclassified 1263
397 Ga0495652_0141552 3300046529 Unclassified 1891
398 Ga0495665_0046491 3300046531 Bacteria 2304
399 Ga0495645_0060605 3300046543 Bacteria 2743
400 Ga0495645_0065765 3300046543 Bacteria 2623
401 Ga0495645_0077232 3300046543 Bacteria 2395
402 Ga0495659_0048420 3300046664 Bacteria 1540
403 Ga0495599_0131066 3300046678 Bacteria 1557
404 Ga0495623_0224880 3300046679 Unclassified 1067
405 Ga0495669_0141227 3300046684 Unclassified 1137
406 Ga0495624_0072152 3300046690 Unclassified 2148
407 Ga0495604_0097779 3300047317 Unclassified 2164
408 Ga0495604_0196600 3300047317 Bacteria 1402
409 Ga0495674_0011828 3300047319 Bacteria 8228
410 Ga0495674_0030630 3300047319 Bacteria 4891
411 Ga0495674_0031467 3300047319 Bacteria 4820
412 Ga0495684_0263737 3300047471 Bacteria 1249
413 Ga0495602_0080064 3300048088 Bacteria 2753
414 Ga0495602_0081284 3300048088 Bacteria 2725
415 Ga0496102_0010639 3300048905 Bacteria 7925
416 Ga0496102_0053200 3300048905 Unclassified 3691
417 Ga0496102_0563419 3300048905 Unclassified 1062
418 Ga0496103_0014249 3300048906 Bacteria 4720
419 Ga0496104_0095570 3300048907 Bacteria 2843
420 Ga0496104_0115797 3300048907 Bacteria 2572
421 Ga0496104_0175271 3300048907 Unclassified 2055
422 Ga0496105_0129491 3300048908 Bacteria 2081
423 Ga0496106_0159886 3300048909 Bacteria 1781
424 Ga0496107_0048966 3300048910 Bacteria 3045
425 Ga0496108_0035479 3300048911 Bacteria 4146
426 Ga0496109_0026273 3300048912 Bacteria 5191
427 Ga0496110_0007736 3300048913 Bacteria 8603
428 Ga0496111_0032510 3300048914 Bacteria 3720
429 Ga0496112_0012157 3300048915 Bacteria 7901
430 Ga0496112_0120154 3300048915 Bacteria 2597
431 Ga0496112_0155960 3300048915 Bacteria 2250
432 Ga0496112_0238081 3300048915 Bacteria 1773
433 Ga0496113_0046390 3300048916 Bacteria 3225
434 Ga0496115_0018172 3300048918 Bacteria 5392
435 Ga0496115_0285902 3300048918 Bacteria 1353
436 nmdc:mga0n895_15372_c1 3300050512 Bacteria 6976
437 nmdc:mga0rr50_20855_c1 3300050513 Bacteria 4461
438 nmdc:mga08x19_103364_c1 3300050514 Bacteria 1893
439 nmdc:mga0a205_7291_c1 3300050515 Bacteria 10004
440 Ga0495601_0211707 3300053077 Bacteria 1266
441 Ga0495619_0210225 3300053085 Bacteria 1347
442 Ga0105243_10008383
443 MRS1b_contig_100842
444 MBSR1b_contig_2896016
445 LJNas_1000011
446 Ga0065712_10071007
447 Ga0065715_10155006
448 Ga0070658_10021175
449 Ga0070658_10501999
450 Ga0070676_10072050
451 Ga0070683_100015619
452 Ga0070683_100052639
453 Ga0070690_100029450
454 Ga0068869_100025322
455 Ga0070666_10007783
456 Ga0070666_10087604
457 Ga0070682_100006143
458 Ga0070660_100006565
459 Ga0070660_100030206
460 Ga0070687_100178616
461 Ga0070661_100016822
462 Ga0070661_100024111
463 Ga0070668_100012175
464 Ga0070669_100019337
465 Ga0070671_100072264
466 Ga0070674_100288764
467 Ga0070659_100003966
468 Ga0070659_100028456
469 Ga0070667_100014654
470 Ga0070709_10001253
471 Ga0070709_10076988
472 Ga0070709_10106250
473 Ga0070709_10127651
474 Ga0070714_100001108
475 Ga0070714_100021048
476 Ga0070714_100085964
477 Ga0070714_100172395
478 Ga0070714_100698049
479 Ga0070713_100000034
480 Ga0070713_100002283
481 Ga0070713_100049829
482 Ga0070713_100066700
483 Ga0070713_100189328
484 Ga0070713_100523401
485 Ga0070710_10001688
486 Ga0070711_100000764
487 Ga0070711_100023678
488 Ga0070711_100051542
489 Ga0070711_100071094
490 Ga0070711_100178659
491 Ga0070700_100023373
492 Ga0070708_100002775
493 Ga0070708_100009489
494 Ga0070708_100084478
495 Ga0070708_100093920
496 Ga0070708_100109065
497 Ga0070708_100163490
498 Ga0070708_100396993
499 Ga0070708_100483125
500 Ga0070663_100036460
501 Ga0070663_100040510
502 Ga0070662_100013600
503 Ga0070662_100013902
504 Ga0070681_10013124
505 Ga0070681_10125491
506 Ga0068867_100009407
507 Ga0068867_100336231
508 Ga0070706_100020116
509 Ga0070706_100099032
510 Ga0070707_100036629
511 Ga0070707_100042899
512 Ga0070707_100063346
513 Ga0070707_100067329
514 Ga0070707_100067482
515 Ga0070698_100028556
516 Ga0070698_100227850
517 Ga0070698_100303006
518 Ga0070699_100019787
519 Ga0070699_100024249
520 Ga0070699_100040227
521 Ga0070699_100204955
522 Ga0070699_100435451
523 Ga0070679_100131109
524 Ga0070679_100131224
525 Ga0070684_100005526
526 Ga0070697_100000015
527 Ga0070697_100002018
528 Ga0070697_100021297
529 Ga0070697_100049834
530 Ga0070697_100064202
531 Ga0068853_100007807
532 Ga0068853_100013721
533 Ga0070695_100008138
534 Ga0070696_100109693
535 Ga0070693_100005545
536 Ga0070693_100025953
537 Ga0070665_100022707
538 Ga0068855_100060799
539 Ga0068855_100153955
540 Ga0068855_100286833
541 Ga0070664_100044955
542 Ga0068857_100035315
543 Ga0068857_100059823
544 Ga0068854_100031855
545 Ga0068854_100067665
546 Ga0068856_100000875
547 Ga0068856_100012828
548 Ga0068856_100037346
549 Ga0068856_100206146
550 Ga0068856_100219145
551 Ga0068852_100011726
552 Ga0068859_100019934
553 Ga0068864_100150090
554 Ga0068866_10019725
555 Ga0068866_10024454
556 Ga0068863_100026936
557 Ga0068858_100017361
558 Ga0068858_100163679
559 Ga0068858_100216294
560 Ga0068860_100016831
561 Ga0070717_10001493
562 Ga0070717_10006463
563 Ga0070717_10026008
564 Ga0070717_10077194
565 Ga0070717_10212883
566 Ga0070717_10214500
567 Ga0070717_10230594
568 Ga0070717_10452701
569 Ga0070715_10018318
570 Ga0070716_100002333
571 Ga0070716_100039708
572 Ga0070716_100081424
573 Ga0070716_100102478
574 Ga0070716_100238850
575 Ga0070712_100000020
576 Ga0070712_100000696
577 Ga0070712_100009979
578 Ga0070712_100033767
579 Ga0070712_100064323
580 Ga0070712_100176480
581 Ga0070712_100328083
582 Ga0097621_100010461
583 Ga0097621_100064238
584 Ga0097621_100112938
585 Ga0068871_100384451
586 Ga0075434_100146114
587 Ga0075436_100004989
588 Ga0097620_100019934
589 Ga0075435_100008155
590 Ga0099794_10032001
591 Ga0099794_10034015
592 Ga0099794_10042479
593 Ga0099794_10073337
594 Ga0099795_10020010
595 Ga0105240_10011801
596 Ga0105240_10019833
597 Ga0105240_10033865
598 Ga0105241_10003292
599 Ga0105241_10465369
600 Ga0105242_10007812
601 Ga0105242_10008505
602 Ga0105248_10024246
603 Ga0105237_10037253
604 Ga0105237_10170849
605 Ga0105238_10026509
606 Ga0105238_10046295
607 Ga0105238_10270391
608 Ga0105249_10023998
609 Ga0105239_10021569
610 Ga0105239_10443265
611 Ga0105246_10033127
612 Ga0157373_10004742
613 Ga0157373_10023429
614 Ga0157371_10009162
615 Ga0157370_10086633
616 Ga0157369_10006401
617 Ga0157369_10021915
618 Ga0157369_10039962
619 Ga0157369_10045511
620 Ga0157369_10260797
621 Ga0157374_10003717
622 Ga0157374_10044436
623 Ga0157374_10051117
624 Ga0157374_10421346
625 Ga0157378_10104866
626 Ga0157378_10200569
627 Ga0163162_10028620
628 Ga0157372_10001648
629 Ga0157372_10002687
630 Ga0157372_10015499
631 Ga0157372_10033050
632 Ga0157372_10033653
633 Ga0157372_10040708
634 Ga0157372_10078654
635 Ga0157375_10014488
636 Ga0163163_10035702
637 Ga0163163_10199206
638 Ga0182008_10008077
639 Ga0157376_10075030
640 Ga0182006_1086673
641 Ga0182007_10003880
642 Ga0182005_1007418
643 Ga0213874_10014097
644 Ga0224570_100005
645 Ga0224571_100152
646 Ga0224572_1010716
647 Ga0224572_1012973
648 Ga0224572_1016408
649 Ga0228598_1000082
650 Ga0228598_1000153
651 Ga0228598_1000815
652 Ga0207697_10063254
653 Ga0207692_10000642
654 Ga0207692_10026503
655 Ga0207642_10167860
656 Ga0207647_10058666
657 Ga0207699_10003370
658 Ga0207699_10003622
659 Ga0207699_10057221
660 Ga0207699_10179663
661 Ga0207684_10017655
662 Ga0207684_10320859
663 Ga0207654_10003092
664 Ga0207654_10022080
665 Ga0207654_10125400
666 Ga0207707_10099166
667 Ga0207695_10040776
668 Ga0207695_10057846
669 Ga0207695_10077876
670 Ga0207671_10070045
671 Ga0207671_10107199
672 Ga0207671_10129347
673 Ga0207693_10000080
674 Ga0207693_10001336
675 Ga0207693_10005678
676 Ga0207693_10050025
677 Ga0207693_10058740
678 Ga0207693_10071740
679 Ga0207663_10000723
680 Ga0207663_10038792
681 Ga0207663_10050635
682 Ga0207663_10170892
683 Ga0207660_10183025
684 Ga0207662_10180038
685 Ga0207657_10002282
686 Ga0207657_10004823
687 Ga0207649_10137758
688 Ga0207652_10032261
689 Ga0207652_10092098
690 Ga0207652_10100537
691 Ga0207646_10008803
692 Ga0207646_10040791
693 Ga0207646_10114466
694 Ga0207646_10187041
695 Ga0207646_10221300
696 Ga0207646_10433547
697 Ga0207694_10022047
698 Ga0207694_10041123
699 Ga0207650_10056117
700 Ga0207687_10149641
701 Ga0207700_10000364
702 Ga0207700_10019576
703 Ga0207700_10036867
704 Ga0207700_10233268
705 Ga0207700_10513646
706 Ga0207664_10000217
707 Ga0207664_10155387
708 Ga0207664_10218041
709 Ga0207664_10262679
710 Ga0207664_10388143
711 Ga0207644_10025834
712 Ga0207690_10021996
713 Ga0207706_10000964
714 Ga0207706_10013489
715 Ga0207709_10101029
716 Ga0207669_10257110
717 Ga0207704_10118501
718 Ga0207665_10000263
719 Ga0207665_10007874
720 Ga0207665_10024800
721 Ga0207665_10057536
722 Ga0207665_10061213
723 Ga0207711_10508871
724 Ga0207689_10004641
725 Ga0207661_10259338
726 Ga0207679_10064274
727 Ga0207667_10008795
728 Ga0207667_10057999
729 Ga0207667_10194648
730 Ga0207668_10022883
731 Ga0207640_10012213
732 Ga0207640_10393549
733 Ga0207658_10010474
734 Ga0207703_10324614
735 Ga0207639_10131679
736 Ga0207678_10008488
737 Ga0207702_10001397
738 Ga0207702_10053206
739 Ga0207702_10053993
740 Ga0207702_10095246
741 Ga0207702_10100930
742 Ga0207648_10009505
743 Ga0207648_10090344
744 Ga0207674_10085674
745 Ga0207683_10236190
746 Ga0209588_1014422
747 Ga0209588_1043017
748 Ga0265354_1000010
749 Ga0265354_1000588
750 Ga0265354_1009031
751 Ga0265356_1012342
752 Ga0268266_10000194
753 Ga0265338_10006373
754 Ga0265338_10009636
755 Ga0265338_10032282
756 Ga0265338_10034235
757 Ga0265338_10038124
758 Ga0265338_10281447
759 Ga0265338_10295106
760 Ga0265762_1003954
761 Ga0265770_1001855
762 Ga0265770_1002249
763 Ga0265765_1000287
764 Ga0265760_10000128
765 Ga0265760_10000341
766 Ga0265760_10000890
767 Ga0265760_10011178
768 Ga0265760_10011183
769 Ga0265760_10012396
770 Ga0265760_10030691
771 Ga0265760_10032040
772 Ga0265760_10086599
773 Ga0265325_10001581
774 Ga0265325_10022845
775 Ga0265340_10094430
776 Ga0265339_10009874
777 Ga0265339_10073309
778 Ga0265339_10123729
779 Ga0265339_10143442
780 Ga0265316_10013230
781 Ga0265314_10059980
782 Ga0247548_100353
783 Ga0316212_1001614
784 Ga0316212_1004382
785 Ga0373934_0066095
786 Ga0373923_0003085
787 Ga0373936_0002999
788 Ga0373957_0007273
789 Ga0373943_0000183
790 Ga0373943_0130611
791 Ga0373946_0005626
792 Ga0373946_0029963
793 Ga0373955_0215267
794 Ga0373955_0237471
795 Ga0373935_0023204
796 Ga0373935_0084061
797 Ga0373935_0253775
798 Ga0373927_0000056
799 Ga0373927_0174806
800 Ga0373927_0315459
801 Ga0373933_0250960
802 Ga0373947_0001091
803 Ga0373937_0037474
804 Ga0373937_0109315
805 Ga0373937_0111273
806 Ga0373937_0133847
807 Ga0373937_0502056
808 Ga0373925_0003123
809 Ga0373925_0003837
810 Ga0373925_0207944
811 Ga0373925_0212302
812 Ga0373925_0225199
813 Ga0373925_0245882
814 Ga0373925_0423390
815 Ga0395905_0294192
816 Ga0436360_1355452
817 Ga0436363_0640600
818 Ga0436363_0971557
819 Ga0436362_1113368
820 Ga0466966_0160662
821 Ga0466963_0175103
822 Ga0466964_0029260
823 Ga0466967_0100858
824 Ga0495592_0273389
825 Ga0495603_0128843
826 Ga0495651_0184992
827 Ga0495580_0000530
828 Ga0495580_0006109
829 Ga0495580_0059354
830 Ga0495580_0151920
831 Ga0495580_0323954
832 Ga0495664_0021849
833 Ga0495608_0357968
834 Ga0495628_0125021
835 Ga0495630_0072464
836 Ga0495630_0104644
837 Ga0495630_0284545
838 Ga0495652_0141552
839 Ga0495665_0046491
840 Ga0495645_0060605
841 Ga0495645_0065765
842 Ga0495645_0077232
843 Ga0495659_0048420
844 Ga0495599_0131066
845 Ga0495623_0224880
846 Ga0495669_0141227
847 Ga0495624_0072152
848 Ga0495604_0097779
849 Ga0495604_0196600
850 Ga0495674_0011828
851 Ga0495674_0030630
852 Ga0495674_0031467
853 Ga0495684_0263737
854 Ga0495602_0080064
855 Ga0495602_0081284
856 Ga0496102_0010639
857 Ga0496102_0053200
858 Ga0496102_0563419
859 Ga0496103_0014249
860 Ga0496104_0095570
861 Ga0496104_0115797
862 Ga0496104_0175271
863 Ga0496105_0129491
864 Ga0496106_0159886
865 Ga0496107_0048966
866 Ga0496108_0035479
867 Ga0496109_0026273
868 Ga0496110_0007736
869 Ga0496111_0032510
870 Ga0496112_0012157
871 Ga0496112_0120154
872 Ga0496112_0155960
873 Ga0496112_0238081
874 Ga0496113_0046390
875 Ga0496115_0018172
876 Ga0496115_0285902
877 nmdc:mga0n895_15372_c1
878 nmdc:mga0rr50_20855_c1
879 nmdc:mga08x19_103364_c1
880 nmdc:mga0a205_7291_c1
881 Ga0495601_0211707
882 Ga0495619_0210225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

191

287

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bqs-assembly1.cif.gz_Db cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.8927 175 262
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.8907 175 259
1fwx-assembly2.cif.gz_D crystal structure of nitrous oxide reductase from p. denitrificans 0.8843 178 250
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.877 116 252
6y71-assembly1.cif.gz_A pseudomonas stutzeri nitrous oxide reductase mutant, h130a 0.8625 178 252
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.935 178 259 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9056 117 261 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9049 175 258 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8984 178 251 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8681 113 262 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A537CA45-F1-model_v4 C-type cytochrome 0.9579 178 262 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A6M0AKU6-F1-model_v4 Cytochrome c oxidase subunit II 0.9577 178 264 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A529M468-F1-model_v4 C-type cytochrome 0.9469 173 264 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A2V5UWG5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9446 171 266 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A523JYJ2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9426 178 266 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Map