F444565

General Info

Members Datasets Scaffolds Average Seq Length
441 237 882 324

Family's Representative Sequence

Representative Sequence 3300002074|JGI24748J21848_1002025|JGI24748J21848_10020251
Length 345
Sequence MTHSGLRHAFSVLDCPHMKRREFITVIGGAAVWPVSARAQQPERVRRIGVLLPGAAGDVEFQTRVGAFQQGLQQAGWTIGRNVRIDTRWATTDAAEIRKHAAELAALAPDVILAQGTSSVGPLLQATRAVPIVFVIVVDPVGAGFVASLARPGGNATGFMQFEYSLSAKWPELLKEIAPGVTRVAVLRDHTIASGIGQFGAIQSAAPSLRMEAIPINVRDAGEIELDIAAFARSSNGGVIVTSGPLAQSHSDLIVTLAARHRLPAISSGRQFVAGGGLISYGTNLADQYRRAADYVDRILKGEKPADLPVQAPTKFDLVINLTTAKALGLDVPPALLARADEVIE

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.87
Rhizosphere 83.45
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1002025 3300002074 Bacteria 2263
2 JGI24752J21851_1010497 3300001976 Bacteria 1208
3 JGI24742J22300_10003574 3300002244 Bacteria 2526
4 JGI24742J22300_10017542 3300002244 Unclassified 1211
5 JGI24751J29686_10024286 3300002459 Bacteria 1257
6 Ga0070676_10009223 3300005328 Bacteria 5333
7 Ga0070690_100088856 3300005330 Bacteria 2032
8 Ga0068869_100036904 3300005334 Bacteria 3472
9 Ga0068869_100136633 3300005334 Bacteria 1889
10 Ga0070666_10020221 3300005335 Bacteria 4302
11 Ga0070666_10034888 3300005335 Bacteria 3334
12 Ga0070660_100202681 3300005339 Bacteria 1609
13 Ga0070660_100283963 3300005339 Bacteria 1355
14 Ga0070689_100005437 3300005340 Bacteria 8698
15 Ga0070689_100018418 3300005340 Bacteria 5144
16 Ga0070689_100171721 3300005340 Bacteria 1757
17 Ga0070691_10037611 3300005341 Bacteria 2284
18 Ga0070687_100211695 3300005343 Bacteria 1181
19 Ga0070668_100155993 3300005347 Bacteria 1849
20 Ga0070675_100021043 3300005354 Bacteria 5208
21 Ga0070671_100027634 3300005355 Bacteria 4671
22 Ga0070671_100161807 3300005355 Bacteria 1892
23 Ga0070674_100003043 3300005356 Bacteria 9325
24 Ga0070674_100044630 3300005356 Bacteria 3023
25 Ga0070674_100092203 3300005356 Bacteria 2189
26 Ga0070673_100109337 3300005364 Bacteria 2290
27 Ga0070673_100173626 3300005364 Bacteria 1841
28 Ga0070673_100186205 3300005364 Bacteria 1780
29 Ga0070688_100089458 3300005365 Bacteria 2009
30 Ga0070659_100009935 3300005366 Bacteria 6999
31 Ga0070659_100079351 3300005366 Bacteria 2620
32 Ga0070667_100433501 3300005367 Bacteria 1199
33 Ga0070709_10056965 3300005434 Bacteria 2474
34 Ga0070709_10259861 3300005434 Bacteria 1254
35 Ga0070709_10269316 3300005434 Bacteria 1234
36 Ga0070714_100036279 3300005435 Unclassified 4134
37 Ga0070714_100075967 3300005435 Bacteria 2916
38 Ga0070714_100262911 3300005435 Bacteria 1598
39 Ga0070714_100478958 3300005435 Unclassified 1185
40 Ga0070713_100096552 3300005436 Unclassified 2552
41 Ga0070713_100301776 3300005436 Bacteria 1474
42 Ga0070710_10012875 3300005437 Unclassified 4169
43 Ga0070710_10028150 3300005437 Unclassified 3003
44 Ga0070711_100013527 3300005439 Bacteria 5124
45 Ga0070711_100022190 3300005439 Bacteria 4112
46 Ga0070711_100040238 3300005439 Bacteria 3151
47 Ga0070711_100459181 3300005439 Unclassified 1044
48 Ga0070700_100009802 3300005441 Bacteria 5268
49 Ga0070694_100068823 3300005444 Bacteria 2433
50 Ga0070678_100022728 3300005456 Bacteria 4162
51 Ga0070678_100025456 3300005456 Bacteria 3981
52 Ga0070678_100205441 3300005456 Bacteria 1628
53 Ga0070662_100016243 3300005457 Bacteria 4995
54 Ga0068867_100003627 3300005459 Bacteria 10857
55 Ga0070685_10016165 3300005466 Bacteria 3972
56 Ga0070685_10128411 3300005466 Bacteria 1582
57 Ga0070706_100114993 3300005467 Unclassified 2505
58 Ga0070706_100147343 3300005467 Bacteria 2198
59 Ga0070706_100329204 3300005467 Bacteria 1424
60 Ga0070707_100069509 3300005468 Unclassified 3390
61 Ga0070698_100075104 3300005471 Bacteria 3385
62 Ga0070698_100451354 3300005471 Bacteria 1221
63 Ga0070699_100008511 3300005518 Bacteria 8893
64 Ga0070679_100358707 3300005530 Unclassified 1405
65 Ga0070684_100053473 3300005535 Bacteria 3515
66 Ga0070697_100012739 3300005536 Bacteria 6585
67 Ga0070697_100206446 3300005536 Bacteria 1671
68 Ga0068853_100084970 3300005539 Bacteria 2773
69 Ga0068853_100147104 3300005539 Bacteria 2118
70 Ga0070672_100012994 3300005543 Bacteria 5868
71 Ga0070672_100285099 3300005543 Bacteria 1397
72 Ga0070686_100229306 3300005544 Bacteria 1346
73 Ga0070686_100384904 3300005544 Bacteria 1063
74 Ga0070665_100120341 3300005548 Bacteria 2627
75 Ga0070665_100138075 3300005548 Bacteria 2441
76 Ga0070665_100345472 3300005548 Bacteria 1493
77 Ga0070664_100044956 3300005564 Bacteria 3729
78 Ga0070664_100062026 3300005564 Bacteria 3187
79 Ga0070664_100069474 3300005564 Bacteria 3014
80 Ga0068854_100020604 3300005578 Bacteria 4465
81 Ga0068856_100302700 3300005614 Bacteria 1617
82 Ga0070702_100007296 3300005615 Bacteria 5287
83 Ga0070702_100011802 3300005615 Bacteria 4357
84 Ga0068852_100009812 3300005616 Bacteria 7119
85 Ga0068859_100098270 3300005617 Bacteria 2981
86 Ga0068859_100228994 3300005617 Bacteria 1946
87 Ga0068864_100064819 3300005618 Bacteria 3169
88 Ga0068864_100106891 3300005618 Bacteria 2489
89 Ga0068866_10005589 3300005718 Bacteria 5199
90 Ga0068866_10097338 3300005718 Bacteria 1616
91 Ga0068863_100023783 3300005841 Bacteria 5846
92 Ga0068858_100009285 3300005842 Bacteria 9390
93 Ga0068860_100007881 3300005843 Bacteria 10634
94 Ga0068860_100028077 3300005843 Bacteria 5418
95 Ga0068862_100028919 3300005844 Bacteria 4668
96 Ga0068862_100167172 3300005844 Bacteria 1967
97 Ga0081455_10002117 3300005937 Bacteria 23638
98 Ga0081455_10049340 3300005937 Bacteria 3629
99 Ga0081455_10123552 3300005937 Bacteria 2036
100 Ga0081540_1004550 3300005983 Bacteria 10512
101 Ga0070717_10474368 3300006028 Bacteria 1129
102 Ga0070715_10133413 3300006163 Unclassified 1198
103 Ga0070716_100058489 3300006173 Bacteria 2219
104 Ga0070716_100096265 3300006173 Unclassified 1804
105 Ga0070712_100017688 3300006175 Unclassified 4618
106 Ga0070712_100185433 3300006175 Bacteria 1624
107 Ga0070712_100262046 3300006175 Unclassified 1385
108 Ga0097621_100018809 3300006237 Bacteria 5287
109 Ga0097621_100031136 3300006237 Bacteria 4231
110 Ga0068871_100309022 3300006358 Bacteria 1389
111 Ga0068871_100328906 3300006358 Bacteria 1348
112 Ga0075428_100055319 3300006844 Bacteria 4347
113 Ga0075428_100121563 3300006844 Bacteria 2843
114 Ga0075430_100038856 3300006846 Bacteria 4030
115 Ga0075430_100101569 3300006846 Bacteria 2401
116 Ga0075431_100064101 3300006847 Bacteria 3794
117 Ga0075431_100138893 3300006847 Bacteria 2505
118 Ga0075431_100148411 3300006847 Bacteria 2415
119 Ga0075433_10037527 3300006852 Bacteria 4181
120 Ga0075433_10098635 3300006852 Bacteria 2586
121 Ga0075434_100008816 3300006871 Bacteria 9386
122 Ga0075429_100012794 3300006880 Bacteria 7279
123 Ga0075429_100106344 3300006880 Bacteria 2451
124 Ga0068865_100026936 3300006881 Bacteria 3793
125 Ga0068865_100030720 3300006881 Bacteria 3575
126 Ga0097620_100098274 3300006931 Bacteria 2981
127 Ga0097620_100228985 3300006931 Bacteria 1946
128 Ga0075435_100335231 3300007076 Unclassified 1296
129 Ga0105251_10125175 3300009011 Bacteria 1167
130 Ga0105250_10087498 3300009092 Bacteria 1265
131 Ga0105240_10092405 3300009093 Bacteria 3695
132 Ga0111539_10026706 3300009094 Bacteria 7056
133 Ga0111539_10030804 3300009094 Bacteria 6521
134 Ga0105245_10005603 3300009098 Bacteria 11032
135 Ga0105247_10046000 3300009101 Bacteria 2678
136 Ga0105247_10083893 3300009101 Bacteria 2013
137 Ga0105247_10173128 3300009101 Bacteria 1436
138 Ga0114129_10042530 3300009147 Bacteria 6398
139 Ga0114129_10102000 3300009147 Bacteria 3969
140 Ga0114129_10544160 3300009147 Bacteria 1511
141 Ga0105243_10001839 3300009148 Bacteria 18151
142 Ga0105243_10028655 3300009148 Unclassified 4276
143 Ga0105243_10154067 3300009148 Bacteria 1974
144 Ga0105243_10229101 3300009148 Bacteria 1647
145 Ga0105241_10083423 3300009174 Bacteria 2507
146 Ga0105241_10430468 3300009174 Bacteria 1163
147 Ga0105242_10010169 3300009176 Bacteria 7207
148 Ga0105242_10024066 3300009176 Bacteria 4807
149 Ga0105248_10017126 3300009177 Bacteria 7983
150 Ga0105248_10019613 3300009177 Bacteria 7484
151 Ga0105248_10032019 3300009177 Bacteria 5875
152 Ga0105248_10049605 3300009177 Bacteria 4708
153 Ga0105248_10433884 3300009177 Bacteria 1480
154 Ga0105248_10454714 3300009177 Bacteria 1443
155 Ga0105249_10008501 3300009553 Bacteria 8947
156 Ga0105239_10062414 3300010375 Bacteria 4090
157 Ga0105246_10001905 3300011119 Bacteria 12566
158 Ga0105246_10113191 3300011119 Bacteria 1997
159 Ga0105246_10121016 3300011119 Bacteria 1940
160 Ga0157374_10016109 3300013296 Bacteria 6568
161 Ga0157374_10025162 3300013296 Bacteria 5341
162 Ga0157378_10025116 3300013297 Bacteria 5249
163 Ga0157378_10040475 3300013297 Bacteria 4133
164 Ga0157378_10479784 3300013297 Bacteria 1239
165 Ga0163162_10090760 3300013306 Bacteria 3137
166 Ga0163162_10129647 3300013306 Bacteria 2630
167 Ga0163162_10184466 3300013306 Bacteria 2213
168 Ga0157375_10001511 3300013308 Bacteria 19994
169 Ga0163163_10054902 3300014325 Bacteria 3936
170 Ga0163163_10080292 3300014325 Bacteria 3261
171 Ga0163163_10099679 3300014325 Bacteria 2927
172 Ga0157380_10052795 3300014326 Bacteria 3220
173 Ga0157377_10081802 3300014745 Bacteria 1890
174 Ga0157379_10257195 3300014968 Bacteria 1586
175 Ga0157376_10002710 3300014969 Bacteria 12063
176 Ga0157376_10069080 3300014969 Plasmid 2994
177 Ga0163161_10011624 3300017792 Bacteria 6113
178 Ga0163161_10117887 3300017792 Bacteria 1992
179 Ga0163161_10243453 3300017792 Bacteria 1400
180 Ga0207692_10014175 3300025898 Bacteria 3478
181 Ga0207692_10076491 3300025898 Unclassified 1778
182 Ga0207692_10093560 3300025898 Bacteria 1635
183 Ga0207642_10050026 3300025899 Bacteria 1883
184 Ga0207688_10018109 3300025901 Bacteria 3834
185 Ga0207680_10023245 3300025903 Bacteria 3382
186 Ga0207680_10067753 3300025903 Bacteria 2200
187 Ga0207647_10027138 3300025904 Bacteria 3736
188 Ga0207685_10050981 3300025905 Bacteria 1597
189 Ga0207684_10002447 3300025910 Bacteria 18730
190 Ga0207684_10144915 3300025910 Bacteria 2043
191 Ga0207693_10107846 3300025915 Bacteria 2185
192 Ga0207693_10111703 3300025915 Unclassified 2144
193 Ga0207693_10164888 3300025915 Bacteria 1744
194 Ga0207693_10183888 3300025915 Bacteria 1645
195 Ga0207693_10235948 3300025915 Bacteria 1436
196 Ga0207663_10017142 3300025916 Bacteria 4029
197 Ga0207663_10018236 3300025916 Unclassified 3929
198 Ga0207662_10065041 3300025918 Bacteria 2195
199 Ga0207657_10192279 3300025919 Bacteria 1645
200 Ga0207649_10250120 3300025920 Bacteria 1276
201 Ga0207646_10048890 3300025922 Unclassified 3790
202 Ga0207659_10304494 3300025926 Bacteria 1310
203 Ga0207687_10025468 3300025927 Unclassified 3958
204 Ga0207700_10071607 3300025928 Bacteria 2670
205 Ga0207700_10115142 3300025928 Bacteria 2170
206 Ga0207700_10126380 3300025928 Bacteria 2081
207 Ga0207644_10023184 3300025931 Bacteria 4248
208 Ga0207644_10101265 3300025931 Bacteria 2164
209 Ga0207644_10153214 3300025931 Bacteria 1785
210 Ga0207690_10036710 3300025932 Bacteria 3175
211 Ga0207706_10025667 3300025933 Bacteria 5279
212 Ga0207706_10043468 3300025933 Bacteria 3981
213 Ga0207686_10008662 3300025934 Bacteria 5494
214 Ga0207686_10015714 3300025934 Bacteria 4238
215 Ga0207686_10025607 3300025934 Bacteria 3434
216 Ga0207709_10009877 3300025935 Bacteria 5254
217 Ga0207709_10135070 3300025935 Bacteria 1687
218 Ga0207709_10291052 3300025935 Bacteria 1210
219 Ga0207670_10022927 3300025936 Bacteria 3878
220 Ga0207670_10080232 3300025936 Bacteria 2280
221 Ga0207670_10093456 3300025936 Bacteria 2131
222 Ga0207669_10010525 3300025937 Bacteria 4456
223 Ga0207669_10062632 3300025937 Bacteria 2292
224 Ga0207704_10013267 3300025938 Bacteria 4118
225 Ga0207665_10024630 3300025939 Bacteria 3969
226 Ga0207665_10138362 3300025939 Bacteria 1734
227 Ga0207691_10069588 3300025940 Bacteria 3179
228 Ga0207711_10088657 3300025941 Bacteria 2717
229 Ga0207711_10105571 3300025941 Bacteria 2498
230 Ga0207689_10022442 3300025942 Bacteria 5308
231 Ga0207689_10063001 3300025942 Bacteria 3050
232 Ga0207679_10059808 3300025945 Bacteria 2828
233 Ga0207679_10186387 3300025945 Bacteria 1721
234 Ga0207668_10368578 3300025972 Bacteria 1205
235 Ga0207658_10172078 3300025986 Bacteria 1785
236 Ga0207658_10295272 3300025986 Bacteria 1394
237 Ga0207703_10037899 3300026035 Bacteria 3843
238 Ga0207703_10053159 3300026035 Bacteria 3292
239 Ga0207639_10044498 3300026041 Bacteria 3339
240 Ga0207678_10023036 3300026067 Bacteria 5449
241 Ga0207678_10061922 3300026067 Bacteria 3218
242 Ga0207678_10132477 3300026067 Bacteria 2127
243 Ga0207678_10319550 3300026067 Bacteria 1336
244 Ga0207708_10006668 3300026075 Bacteria 8540
245 Ga0207702_10113930 3300026078 Bacteria 2409
246 Ga0207641_10019477 3300026088 Bacteria 5572
247 Ga0207641_10026985 3300026088 Bacteria 4743
248 Ga0207676_10006636 3300026095 Bacteria 8181
249 Ga0207676_10053849 3300026095 Bacteria 3150
250 Ga0207676_10117458 3300026095 Bacteria 2237
251 Ga0207683_10013872 3300026121 Bacteria 6871
252 Ga0207683_10019032 3300026121 Bacteria 5861
253 Ga0207683_10248006 3300026121 Bacteria 1625
254 Ga0207428_10006720 3300027907 Bacteria 10560
255 Ga0207428_10072520 3300027907 Bacteria 2703
256 Ga0207428_10168619 3300027907 Bacteria 1659
257 Ga0268266_10102408 3300028379 Bacteria 2525
258 Ga0268266_10309629 3300028379 Bacteria 1475
259 Ga0268265_10172896 3300028380 Bacteria 1848
260 Ga0268264_10142327 3300028381 Bacteria 2140
261 Ga0265325_10014547 3300031241 Bacteria 4442
262 Ga0307513_10296676 3300031456 Bacteria 1385
263 Ga0307513_10379669 3300031456 Bacteria 1153
264 Ga0307516_10267329 3300031730 Bacteria 1398
265 Ga0307405_10209085 3300031731 Bacteria 1423
266 Ga0373928_0023091 3300035084 Bacteria 1324
267 Ga0373944_0066227 3300035089 Bacteria 1168
268 Ga0373953_0026934 3300035117 Bacteria 2206
269 Ga0373954_0027248 3300035118 Bacteria 2622
270 Ga0373956_0141091 3300035119 Bacteria 1131
271 Ga0373943_0224971 3300035170 Bacteria 1046
272 Ga0373955_0015196 3300035172 Unclassified 3763
273 Ga0373961_0023589 3300035241 Bacteria 1657
274 Ga0373962_0092441 3300035242 Bacteria 933
275 Ga0373931_0011708 3300035691 Bacteria 4240
276 Ga0373931_0030658 3300035691 Bacteria 2770
277 Ga0373935_0060141 3300035692 Bacteria 2430
278 Ga0373935_0300779 3300035692 Bacteria 1134
279 Ga0373927_0071758 3300035695 Bacteria 2241
280 Ga0373927_0148686 3300035695 Bacteria 1534
281 Ga0373933_0014396 3300035724 Bacteria 4399
282 Ga0373947_0170190 3300035725 Bacteria 1413
283 Ga0373947_0226781 3300035725 Bacteria 1229
284 Ga0373947_0259784 3300035725 Bacteria 1150
285 Ga0373937_0002652 3300036401 Bacteria 14908
286 Ga0373925_0006958 3300037068 Bacteria 8271
287 Ga0373925_0322542 3300037068 Bacteria 1250
288 Ga0373925_0430632 3300037068 Bacteria 1079
289 Ga0439459_0007229 3300042438 Bacteria 1870
290 Ga0495603_0023847 3300046455 Bacteria 3701
291 Ga0495603_0172013 3300046455 Bacteria 1254
292 Ga0495629_0152862 3300046459 Bacteria 1604
293 Ga0495641_0106852 3300046461 Bacteria 1249
294 Ga0495651_0037314 3300046462 Bacteria 3783
295 Ga0495653_0004594 3300046463 Bacteria 11163
296 Ga0495582_0007458 3300046473 Bacteria 6050
297 Ga0495639_0210827 3300046475 Bacteria 953
298 Ga0495585_0133054 3300046492 Bacteria 1307
299 Ga0495608_0004219 3300046511 Bacteria 10300
300 Ga0495616_0103161 3300046513 Bacteria 1335
301 Ga0495618_0047395 3300046514 Bacteria 2712
302 Ga0495628_0006403 3300046516 Bacteria 10287
303 Ga0495630_0233948 3300046517 Bacteria 1404
304 Ga0495632_0163857 3300046519 Bacteria 1023
305 Ga0495637_0068300 3300046520 Bacteria 1440
306 Ga0495663_0022203 3300046525 Bacteria 1832
307 Ga0495665_0077590 3300046531 Bacteria 1748
308 Ga0495640_0009237 3300046533 Bacteria 7690
309 Ga0495598_0039088 3300046537 Bacteria 1377
310 Ga0495621_0061720 3300046539 Bacteria 1362
311 Ga0495667_0023193 3300046559 Bacteria 4181
312 Ga0495656_0042131 3300046615 Bacteria 1910
313 Ga0495634_0029586 3300046642 Bacteria 3791
314 Ga0495634_0056471 3300046642 Bacteria 2622
315 Ga0495625_0093140 3300046660 Bacteria 2081
316 Ga0495635_0023259 3300046663 Bacteria 4319
317 Ga0495635_0070597 3300046663 Bacteria 2394
318 Ga0495659_0018743 3300046664 Bacteria 2309
319 Ga0495661_0234811 3300046665 Bacteria 944
320 Ga0495657_0018345 3300046675 Bacteria 5068
321 Ga0495599_0021382 3300046678 Unclassified 4036
322 Ga0495623_0011716 3300046679 Bacteria 5680
323 Ga0495646_0006898 3300046680 Bacteria 7206
324 Ga0495647_0067377 3300046681 Unclassified 1426
325 Ga0495658_0048828 3300046683 Bacteria 2388
326 Ga0495658_0209631 3300046683 Bacteria 1217
327 Ga0495669_0204914 3300046684 Bacteria 943
328 Ga0495613_0118412 3300046689 Bacteria 1904
329 Ga0495624_0087477 3300046690 Unclassified 1924
330 Ga0495670_0068174 3300046691 Bacteria 1797
331 Ga0495649_0131387 3300046694 Bacteria 1321
332 Ga0495649_0179105 3300046694 Bacteria 1106
333 Ga0495600_0020933 3300046809 Bacteria 4186
334 Ga0495660_0142584 3300046810 Bacteria 1190
335 Ga0495581_0074530 3300047315 Unclassified 1964
336 Ga0495581_0161006 3300047315 Bacteria 1312
337 Ga0495604_0015349 3300047317 Bacteria 6112
338 Ga0495674_0007637 3300047319 Bacteria 10327
339 Ga0495674_0297249 3300047319 Bacteria 1319
340 Ga0495676_0006957 3300047321 Bacteria 10382
341 Ga0495676_0367939 3300047321 Bacteria 958
342 Ga0495680_0006942 3300047322 Bacteria 10449
343 Ga0495680_0159834 3300047322 Bacteria 1637
344 Ga0495680_0176203 3300047322 Bacteria 1546
345 Ga0495683_0147007 3300047323 Bacteria 1100
346 Ga0495685_109779 3300047447 Bacteria 908
347 Ga0495681_0137386 3300047470 Bacteria 1035
348 Ga0495684_0026771 3300047471 Bacteria 4431
349 Ga0495686_0260606 3300047472 Bacteria 971
350 Ga0496100_0001780 3300048903 Bacteria 10750
351 Ga0496100_0025171 3300048903 Bacteria 3638
352 Ga0496100_0189810 3300048903 Bacteria 1491
353 Ga0496101_0000630 3300048904 Bacteria 21384
354 Ga0496101_0004963 3300048904 Bacteria 8451
355 Ga0496101_0037035 3300048904 Bacteria 3458
356 Ga0496101_0041828 3300048904 Bacteria 3270
357 Ga0496101_0044020 3300048904 Bacteria 3193
358 Ga0496101_0047135 3300048904 Bacteria 3093
359 Ga0496102_0047148 3300048905 Bacteria 3914
360 Ga0496102_0055823 3300048905 Bacteria 3602
361 Ga0496102_0111494 3300048905 Bacteria 2550
362 Ga0496102_0113712 3300048905 Bacteria 2525
363 Ga0496102_0274559 3300048905 Bacteria 1589
364 Ga0496103_0002767 3300048906 Bacteria 10912
365 Ga0496103_0003932 3300048906 Bacteria 9032
366 Ga0496103_0084150 3300048906 Bacteria 2003
367 Ga0496103_0154169 3300048906 Bacteria 1472
368 Ga0496104_0006048 3300048907 Bacteria 10617
369 Ga0496104_0040311 3300048907 Bacteria 4377
370 Ga0496104_0049950 3300048907 Bacteria 3945
371 Ga0496104_0082552 3300048907 Bacteria 3065
372 Ga0496104_0103756 3300048907 Bacteria 2724
373 Ga0496105_0018215 3300048908 Bacteria 5639
374 Ga0496105_0032730 3300048908 Bacteria 4268
375 Ga0496105_0109538 3300048908 Bacteria 2280
376 Ga0496105_0303762 3300048908 Bacteria 1282
377 Ga0496105_0453137 3300048908 Bacteria 1012
378 Ga0496106_0000996 3300048909 Bacteria 20689
379 Ga0496106_0036879 3300048909 Bacteria 3657
380 Ga0496106_0096849 3300048909 Bacteria 2284
381 Ga0496106_0251826 3300048909 Bacteria 1412
382 Ga0496107_0032655 3300048910 Bacteria 3721
383 Ga0496107_0062653 3300048910 Bacteria 2694
384 Ga0496107_0077811 3300048910 Bacteria 2416
385 Ga0496108_0008817 3300048911 Bacteria 8175
386 Ga0496108_0010748 3300048911 Bacteria 7431
387 Ga0496108_0071455 3300048911 Bacteria 2928
388 Ga0496108_0085638 3300048911 Bacteria 2675
389 Ga0496108_0207277 3300048911 Bacteria 1701
390 Ga0496108_0540766 3300048911 Bacteria 1017
391 Ga0496109_0060480 3300048912 Bacteria 3461
392 Ga0496109_0068203 3300048912 Bacteria 3260
393 Ga0496109_0183234 3300048912 Bacteria 1967
394 Ga0496109_0323155 3300048912 Bacteria 1456
395 Ga0496109_0333860 3300048912 Bacteria 1431
396 Ga0496109_0335583 3300048912 Bacteria 1427
397 Ga0496109_0576219 3300048912 Bacteria 1061
398 Ga0496110_0006749 3300048913 Bacteria 9130
399 Ga0496110_0008156 3300048913 Bacteria 8415
400 Ga0496110_0022548 3300048913 Bacteria 5346
401 Ga0496110_0069039 3300048913 Bacteria 3128
402 Ga0496110_0190999 3300048913 Bacteria 1860
403 Ga0496110_0191288 3300048913 Bacteria 1858
404 Ga0496110_0288552 3300048913 Bacteria 1494
405 Ga0496111_0066789 3300048914 Bacteria 2612
406 Ga0496111_0089810 3300048914 Bacteria 2250
407 Ga0496111_0090684 3300048914 Bacteria 2239
408 Ga0496112_0001890 3300048915 Bacteria 16521
409 Ga0496112_0126071 3300048915 Bacteria 2531
410 Ga0496113_0002804 3300048916 Bacteria 10257
411 Ga0496113_0010942 3300048916 Bacteria 6024
412 Ga0496113_0057328 3300048916 Bacteria 2927
413 Ga0496113_0106697 3300048916 Bacteria 2176
414 Ga0496113_0486471 3300048916 Bacteria 991
415 Ga0496114_0010085 3300048917 Bacteria 7513
416 Ga0496114_0016013 3300048917 Bacteria 6033
417 Ga0496114_0171938 3300048917 Bacteria 1888
418 Ga0496115_0072894 3300048918 Bacteria 2786
419 Ga0496115_0276405 3300048918 Bacteria 1379
420 Ga0501072_0569752 3300049588 Bacteria 894
421 nmdc:mga05p37_105880_c1 3300050507 Bacteria 3460
422 nmdc:mga05p37_177727_c1 3300050507 Bacteria 2592
423 nmdc:mga05p37_623931_c1 3300050507 Unclassified 1213
424 nmdc:mga09592_28685_c1 3300050508 Bacteria 4626
425 nmdc:mga0qj67_32624_c1 3300050509 Bacteria 4063
426 nmdc:mga0qj67_8500_c1 3300050509 Bacteria 7617
427 nmdc:mga06r32_145601_c1 3300050510 Bacteria 2347
428 nmdc:mga06r32_18287_c1 3300050510 Bacteria 6415
429 nmdc:mga06r32_90570_c1 3300050510 Bacteria 2988
430 nmdc:mga08y16_132268_c1 3300050511 Bacteria 2594
431 nmdc:mga08y16_54610_c1 3300050511 Bacteria 4174
432 nmdc:mga08y16_9622_c1 3300050511 Bacteria 10148
433 nmdc:mga0n895_1652_c1 3300050512 Bacteria 16864
434 nmdc:mga0n895_451401_c1 3300050512 Bacteria 1298
435 nmdc:mga0n895_50337_c1 3300050512 Bacteria 4084
436 nmdc:mga0rr50_51937_c1 3300050513 Bacteria 3044
437 nmdc:mga0a205_2278_c1 3300050515 Bacteria 16934
438 nmdc:mga0a205_44058_c1 3300050515 Bacteria 4301
439 Ga0495601_0061723 3300053077 Bacteria 2379
440 Ga0495655_0041310 3300053083 Bacteria 1178
441 Ga0495595_0002725 3300053084 Bacteria 6932
442 JGI24748J21848_1002025
443 JGI24752J21851_1010497
444 JGI24742J22300_10003574
445 JGI24742J22300_10017542
446 JGI24751J29686_10024286
447 Ga0070676_10009223
448 Ga0070690_100088856
449 Ga0068869_100036904
450 Ga0068869_100136633
451 Ga0070666_10020221
452 Ga0070666_10034888
453 Ga0070660_100202681
454 Ga0070660_100283963
455 Ga0070689_100005437
456 Ga0070689_100018418
457 Ga0070689_100171721
458 Ga0070691_10037611
459 Ga0070687_100211695
460 Ga0070668_100155993
461 Ga0070675_100021043
462 Ga0070671_100027634
463 Ga0070671_100161807
464 Ga0070674_100003043
465 Ga0070674_100044630
466 Ga0070674_100092203
467 Ga0070673_100109337
468 Ga0070673_100173626
469 Ga0070673_100186205
470 Ga0070688_100089458
471 Ga0070659_100009935
472 Ga0070659_100079351
473 Ga0070667_100433501
474 Ga0070709_10056965
475 Ga0070709_10259861
476 Ga0070709_10269316
477 Ga0070714_100036279
478 Ga0070714_100075967
479 Ga0070714_100262911
480 Ga0070714_100478958
481 Ga0070713_100096552
482 Ga0070713_100301776
483 Ga0070710_10012875
484 Ga0070710_10028150
485 Ga0070711_100013527
486 Ga0070711_100022190
487 Ga0070711_100040238
488 Ga0070711_100459181
489 Ga0070700_100009802
490 Ga0070694_100068823
491 Ga0070678_100022728
492 Ga0070678_100025456
493 Ga0070678_100205441
494 Ga0070662_100016243
495 Ga0068867_100003627
496 Ga0070685_10016165
497 Ga0070685_10128411
498 Ga0070706_100114993
499 Ga0070706_100147343
500 Ga0070706_100329204
501 Ga0070707_100069509
502 Ga0070698_100075104
503 Ga0070698_100451354
504 Ga0070699_100008511
505 Ga0070679_100358707
506 Ga0070684_100053473
507 Ga0070697_100012739
508 Ga0070697_100206446
509 Ga0068853_100084970
510 Ga0068853_100147104
511 Ga0070672_100012994
512 Ga0070672_100285099
513 Ga0070686_100229306
514 Ga0070686_100384904
515 Ga0070665_100120341
516 Ga0070665_100138075
517 Ga0070665_100345472
518 Ga0070664_100044956
519 Ga0070664_100062026
520 Ga0070664_100069474
521 Ga0068854_100020604
522 Ga0068856_100302700
523 Ga0070702_100007296
524 Ga0070702_100011802
525 Ga0068852_100009812
526 Ga0068859_100098270
527 Ga0068859_100228994
528 Ga0068864_100064819
529 Ga0068864_100106891
530 Ga0068866_10005589
531 Ga0068866_10097338
532 Ga0068863_100023783
533 Ga0068858_100009285
534 Ga0068860_100007881
535 Ga0068860_100028077
536 Ga0068862_100028919
537 Ga0068862_100167172
538 Ga0081455_10002117
539 Ga0081455_10049340
540 Ga0081455_10123552
541 Ga0081540_1004550
542 Ga0070717_10474368
543 Ga0070715_10133413
544 Ga0070716_100058489
545 Ga0070716_100096265
546 Ga0070712_100017688
547 Ga0070712_100185433
548 Ga0070712_100262046
549 Ga0097621_100018809
550 Ga0097621_100031136
551 Ga0068871_100309022
552 Ga0068871_100328906
553 Ga0075428_100055319
554 Ga0075428_100121563
555 Ga0075430_100038856
556 Ga0075430_100101569
557 Ga0075431_100064101
558 Ga0075431_100138893
559 Ga0075431_100148411
560 Ga0075433_10037527
561 Ga0075433_10098635
562 Ga0075434_100008816
563 Ga0075429_100012794
564 Ga0075429_100106344
565 Ga0068865_100026936
566 Ga0068865_100030720
567 Ga0097620_100098274
568 Ga0097620_100228985
569 Ga0075435_100335231
570 Ga0105251_10125175
571 Ga0105250_10087498
572 Ga0105240_10092405
573 Ga0111539_10026706
574 Ga0111539_10030804
575 Ga0105245_10005603
576 Ga0105247_10046000
577 Ga0105247_10083893
578 Ga0105247_10173128
579 Ga0114129_10042530
580 Ga0114129_10102000
581 Ga0114129_10544160
582 Ga0105243_10001839
583 Ga0105243_10028655
584 Ga0105243_10154067
585 Ga0105243_10229101
586 Ga0105241_10083423
587 Ga0105241_10430468
588 Ga0105242_10010169
589 Ga0105242_10024066
590 Ga0105248_10017126
591 Ga0105248_10019613
592 Ga0105248_10032019
593 Ga0105248_10049605
594 Ga0105248_10433884
595 Ga0105248_10454714
596 Ga0105249_10008501
597 Ga0105239_10062414
598 Ga0105246_10001905
599 Ga0105246_10113191
600 Ga0105246_10121016
601 Ga0157374_10016109
602 Ga0157374_10025162
603 Ga0157378_10025116
604 Ga0157378_10040475
605 Ga0157378_10479784
606 Ga0163162_10090760
607 Ga0163162_10129647
608 Ga0163162_10184466
609 Ga0157375_10001511
610 Ga0163163_10054902
611 Ga0163163_10080292
612 Ga0163163_10099679
613 Ga0157380_10052795
614 Ga0157377_10081802
615 Ga0157379_10257195
616 Ga0157376_10002710
617 Ga0157376_10069080
618 Ga0163161_10011624
619 Ga0163161_10117887
620 Ga0163161_10243453
621 Ga0207692_10014175
622 Ga0207692_10076491
623 Ga0207692_10093560
624 Ga0207642_10050026
625 Ga0207688_10018109
626 Ga0207680_10023245
627 Ga0207680_10067753
628 Ga0207647_10027138
629 Ga0207685_10050981
630 Ga0207684_10002447
631 Ga0207684_10144915
632 Ga0207693_10107846
633 Ga0207693_10111703
634 Ga0207693_10164888
635 Ga0207693_10183888
636 Ga0207693_10235948
637 Ga0207663_10017142
638 Ga0207663_10018236
639 Ga0207662_10065041
640 Ga0207657_10192279
641 Ga0207649_10250120
642 Ga0207646_10048890
643 Ga0207659_10304494
644 Ga0207687_10025468
645 Ga0207700_10071607
646 Ga0207700_10115142
647 Ga0207700_10126380
648 Ga0207644_10023184
649 Ga0207644_10101265
650 Ga0207644_10153214
651 Ga0207690_10036710
652 Ga0207706_10025667
653 Ga0207706_10043468
654 Ga0207686_10008662
655 Ga0207686_10015714
656 Ga0207686_10025607
657 Ga0207709_10009877
658 Ga0207709_10135070
659 Ga0207709_10291052
660 Ga0207670_10022927
661 Ga0207670_10080232
662 Ga0207670_10093456
663 Ga0207669_10010525
664 Ga0207669_10062632
665 Ga0207704_10013267
666 Ga0207665_10024630
667 Ga0207665_10138362
668 Ga0207691_10069588
669 Ga0207711_10088657
670 Ga0207711_10105571
671 Ga0207689_10022442
672 Ga0207689_10063001
673 Ga0207679_10059808
674 Ga0207679_10186387
675 Ga0207668_10368578
676 Ga0207658_10172078
677 Ga0207658_10295272
678 Ga0207703_10037899
679 Ga0207703_10053159
680 Ga0207639_10044498
681 Ga0207678_10023036
682 Ga0207678_10061922
683 Ga0207678_10132477
684 Ga0207678_10319550
685 Ga0207708_10006668
686 Ga0207702_10113930
687 Ga0207641_10019477
688 Ga0207641_10026985
689 Ga0207676_10006636
690 Ga0207676_10053849
691 Ga0207676_10117458
692 Ga0207683_10013872
693 Ga0207683_10019032
694 Ga0207683_10248006
695 Ga0207428_10006720
696 Ga0207428_10072520
697 Ga0207428_10168619
698 Ga0268266_10102408
699 Ga0268266_10309629
700 Ga0268265_10172896
701 Ga0268264_10142327
702 Ga0265325_10014547
703 Ga0307513_10296676
704 Ga0307513_10379669
705 Ga0307516_10267329
706 Ga0307405_10209085
707 Ga0373928_0023091
708 Ga0373944_0066227
709 Ga0373953_0026934
710 Ga0373954_0027248
711 Ga0373956_0141091
712 Ga0373943_0224971
713 Ga0373955_0015196
714 Ga0373961_0023589
715 Ga0373962_0092441
716 Ga0373931_0011708
717 Ga0373931_0030658
718 Ga0373935_0060141
719 Ga0373935_0300779
720 Ga0373927_0071758
721 Ga0373927_0148686
722 Ga0373933_0014396
723 Ga0373947_0170190
724 Ga0373947_0226781
725 Ga0373947_0259784
726 Ga0373937_0002652
727 Ga0373925_0006958
728 Ga0373925_0322542
729 Ga0373925_0430632
730 Ga0439459_0007229
731 Ga0495603_0023847
732 Ga0495603_0172013
733 Ga0495629_0152862
734 Ga0495641_0106852
735 Ga0495651_0037314
736 Ga0495653_0004594
737 Ga0495582_0007458
738 Ga0495639_0210827
739 Ga0495585_0133054
740 Ga0495608_0004219
741 Ga0495616_0103161
742 Ga0495618_0047395
743 Ga0495628_0006403
744 Ga0495630_0233948
745 Ga0495632_0163857
746 Ga0495637_0068300
747 Ga0495663_0022203
748 Ga0495665_0077590
749 Ga0495640_0009237
750 Ga0495598_0039088
751 Ga0495621_0061720
752 Ga0495667_0023193
753 Ga0495656_0042131
754 Ga0495634_0029586
755 Ga0495634_0056471
756 Ga0495625_0093140
757 Ga0495635_0023259
758 Ga0495635_0070597
759 Ga0495659_0018743
760 Ga0495661_0234811
761 Ga0495657_0018345
762 Ga0495599_0021382
763 Ga0495623_0011716
764 Ga0495646_0006898
765 Ga0495647_0067377
766 Ga0495658_0048828
767 Ga0495658_0209631
768 Ga0495669_0204914
769 Ga0495613_0118412
770 Ga0495624_0087477
771 Ga0495670_0068174
772 Ga0495649_0131387
773 Ga0495649_0179105
774 Ga0495600_0020933
775 Ga0495660_0142584
776 Ga0495581_0074530
777 Ga0495581_0161006
778 Ga0495604_0015349
779 Ga0495674_0007637
780 Ga0495674_0297249
781 Ga0495676_0006957
782 Ga0495676_0367939
783 Ga0495680_0006942
784 Ga0495680_0159834
785 Ga0495680_0176203
786 Ga0495683_0147007
787 Ga0495685_109779
788 Ga0495681_0137386
789 Ga0495684_0026771
790 Ga0495686_0260606
791 Ga0496100_0001780
792 Ga0496100_0025171
793 Ga0496100_0189810
794 Ga0496101_0000630
795 Ga0496101_0004963
796 Ga0496101_0037035
797 Ga0496101_0041828
798 Ga0496101_0044020
799 Ga0496101_0047135
800 Ga0496102_0047148
801 Ga0496102_0055823
802 Ga0496102_0111494
803 Ga0496102_0113712
804 Ga0496102_0274559
805 Ga0496103_0002767
806 Ga0496103_0003932
807 Ga0496103_0084150
808 Ga0496103_0154169
809 Ga0496104_0006048
810 Ga0496104_0040311
811 Ga0496104_0049950
812 Ga0496104_0082552
813 Ga0496104_0103756
814 Ga0496105_0018215
815 Ga0496105_0032730
816 Ga0496105_0109538
817 Ga0496105_0303762
818 Ga0496105_0453137
819 Ga0496106_0000996
820 Ga0496106_0036879
821 Ga0496106_0096849
822 Ga0496106_0251826
823 Ga0496107_0032655
824 Ga0496107_0062653
825 Ga0496107_0077811
826 Ga0496108_0008817
827 Ga0496108_0010748
828 Ga0496108_0071455
829 Ga0496108_0085638
830 Ga0496108_0207277
831 Ga0496108_0540766
832 Ga0496109_0060480
833 Ga0496109_0068203
834 Ga0496109_0183234
835 Ga0496109_0323155
836 Ga0496109_0333860
837 Ga0496109_0335583
838 Ga0496109_0576219
839 Ga0496110_0006749
840 Ga0496110_0008156
841 Ga0496110_0022548
842 Ga0496110_0069039
843 Ga0496110_0190999
844 Ga0496110_0191288
845 Ga0496110_0288552
846 Ga0496111_0066789
847 Ga0496111_0089810
848 Ga0496111_0090684
849 Ga0496112_0001890
850 Ga0496112_0126071
851 Ga0496113_0002804
852 Ga0496113_0010942
853 Ga0496113_0057328
854 Ga0496113_0106697
855 Ga0496113_0486471
856 Ga0496114_0010085
857 Ga0496114_0016013
858 Ga0496114_0171938
859 Ga0496115_0072894
860 Ga0496115_0276405
861 Ga0501072_0569752
862 nmdc:mga05p37_105880_c1
863 nmdc:mga05p37_177727_c1
864 nmdc:mga05p37_623931_c1
865 nmdc:mga09592_28685_c1
866 nmdc:mga0qj67_32624_c1
867 nmdc:mga0qj67_8500_c1
868 nmdc:mga06r32_145601_c1
869 nmdc:mga06r32_18287_c1
870 nmdc:mga06r32_90570_c1
871 nmdc:mga08y16_132268_c1
872 nmdc:mga08y16_54610_c1
873 nmdc:mga08y16_9622_c1
874 nmdc:mga0n895_1652_c1
875 nmdc:mga0n895_451401_c1
876 nmdc:mga0n895_50337_c1
877 nmdc:mga0rr50_51937_c1
878 nmdc:mga0a205_2278_c1
879 nmdc:mga0a205_44058_c1
880 Ga0495601_0061723
881 Ga0495655_0041310
882 Ga0495595_0002725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

56

344

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9265 29 327
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9181 31 327
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9176 29 327
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9155 27 326
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9121 31 327
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9134 27 298 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9076 27 298 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8942 150 327 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8768 150 327 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8759 31 143 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537MMK8-F1-model_v4 ABC transporter substrate-binding protein 0.9789 149 328
AF-A0A537U815-F1-model_v4 ABC transporter substrate-binding protein 0.9783 158 328
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9782 221 328
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9775 223 328
AF-A0A5N7MX86-F1-model_v4 ABC transporter substrate-binding protein 0.9769 221 328

Map