F444442

General Info

Members Datasets Scaffolds Average Seq Length
440 234 880 186

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10030023|Ga0207681_100300232
Length 217
Sequence MRRSCAGRQAQRRRGRDALAPEPSTGEHYAMSEMTLDLAGNGLLAVTKDALAALRYALMRDTGHAAAAYFQEAGYAGGAALFDAFRGWLDERDALSPESLPLDEFQRLAAEFFRETGWGSLSIGTLHDTVATLDSPDWGEATPDAGMEHPCCHLSAGMFADFFGRVANAPLAVMEVECRSTGAERCRFLLGSAEVMQAVYDGMSQGQGYDEAVSGAA

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 16.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10030023 3300025923 Bacteria 3540
2 Ga0070658_10002792 3300005327 Bacteria 14509
3 Ga0070658_10064942 3300005327 Bacteria 2978
4 Ga0070658_10069880 3300005327 Unclassified 2874
5 Ga0070658_10410392 3300005327 Bacteria 1164
6 Ga0070658_11128100 3300005327 Bacteria 682
7 Ga0070676_10036064 3300005328 Unclassified 2847
8 Ga0070676_10340440 3300005328 Bacteria 1028
9 Ga0070676_10420923 3300005328 Unclassified 933
10 Ga0070676_10667461 3300005328 Unclassified 756
11 Ga0070683_100017629 3300005329 Bacteria 6310
12 Ga0070683_100027619 3300005329 Bacteria 5120
13 Ga0070683_100440596 3300005329 Bacteria 1243
14 Ga0070670_100005240 3300005331 Bacteria 10915
15 Ga0070680_100016153 3300005336 Bacteria 5869
16 Ga0070680_100039944 3300005336 Bacteria 3796
17 Ga0068868_100103179 3300005338 Unclassified 2310
18 Ga0068868_100160775 3300005338 Bacteria 1855
19 Ga0070660_100002933 3300005339 Bacteria 11738
20 Ga0070660_100087392 3300005339 Bacteria 2454
21 Ga0070691_10000572 3300005341 Bacteria 14054
22 Ga0070661_100014869 3300005344 Bacteria 5490
23 Ga0070661_100126040 3300005344 Bacteria 1921
24 Ga0070661_100204993 3300005344 Archaea 1508
25 Ga0070668_100026230 3300005347 Bacteria 4420
26 Ga0070669_100007145 3300005353 Bacteria 8025
27 Ga0070675_100001511 3300005354 Bacteria 17176
28 Ga0070671_100069223 3300005355 Bacteria 2943
29 Ga0070671_100129325 3300005355 Bacteria 2127
30 Ga0070674_100049933 3300005356 Unclassified 2879
31 Ga0070674_100057334 3300005356 Bacteria 2704
32 Ga0070674_100421627 3300005356 Bacteria 1095
33 Ga0070674_100576202 3300005356 Bacteria 948
34 Ga0070673_100305741 3300005364 Bacteria 1401
35 Ga0070673_100696368 3300005364 Bacteria 933
36 Ga0070673_101185715 3300005364 Bacteria 715
37 Ga0070688_100440273 3300005365 Bacteria 972
38 Ga0070659_100082140 3300005366 Bacteria 2574
39 Ga0070659_100098699 3300005366 Bacteria 2349
40 Ga0070659_100171168 3300005366 Archaea 1779
41 Ga0070714_100023611 3300005435 Bacteria 5055
42 Ga0070714_100025909 3300005435 Bacteria 4843
43 Ga0070714_100181790 3300005435 Bacteria 1914
44 Ga0070714_100246859 3300005435 Unclassified 1649
45 Ga0070713_100004084 3300005436 Bacteria 9723
46 Ga0070713_100166626 3300005436 Unclassified 1970
47 Ga0070713_100840455 3300005436 Bacteria 881
48 Ga0070710_10194801 3300005437 Bacteria 1276
49 Ga0070678_100283375 3300005456 Bacteria 1402
50 Ga0070678_100401493 3300005456 Unclassified 1191
51 Ga0070662_100083023 3300005457 Bacteria 2391
52 Ga0070662_100177858 3300005457 Bacteria 1675
53 Ga0070662_100199273 3300005457 Bacteria 1587
54 Ga0070681_10019316 3300005458 Bacteria 6820
55 Ga0068867_100006965 3300005459 Bacteria 7993
56 Ga0068867_100048370 3300005459 Bacteria 3128
57 Ga0068867_100060017 3300005459 Bacteria 2820
58 Ga0070698_100114663 3300005471 Bacteria 2659
59 Ga0070699_100630436 3300005518 Bacteria 978
60 Ga0070679_100003639 3300005530 Bacteria 14101
61 Ga0070679_100028836 3300005530 Bacteria 5475
62 Ga0070679_100142480 3300005530 Bacteria 2376
63 Ga0070679_100351680 3300005530 Unclassified 1421
64 Ga0070679_100364473 3300005530 Bacteria 1392
65 Ga0070679_100422041 3300005530 Unclassified 1279
66 Ga0070679_100436822 3300005530 Bacteria 1254
67 Ga0070684_100114705 3300005535 Bacteria 2419
68 Ga0070684_100165754 3300005535 Bacteria 2005
69 Ga0070684_100267250 3300005535 Bacteria 1565
70 Ga0070684_100352450 3300005535 Bacteria 1354
71 Ga0070684_100355395 3300005535 Bacteria 1348
72 Ga0068853_100069801 3300005539 Bacteria 3057
73 Ga0068853_100266524 3300005539 Bacteria 1576
74 Ga0068853_100972724 3300005539 Bacteria 817
75 Ga0070672_100056614 3300005543 Unclassified 3076
76 Ga0070672_100085489 3300005543 Unclassified 2535
77 Ga0070672_100339207 3300005543 Unclassified 1280
78 Ga0070686_100347737 3300005544 Bacteria 1113
79 Ga0070665_100019563 3300005548 Bacteria 6797
80 Ga0068855_101412455 3300005563 Bacteria 717
81 Ga0070664_100023648 3300005564 Bacteria 5076
82 Ga0070664_100024639 3300005564 Unclassified 4980
83 Ga0070664_100989897 3300005564 Bacteria 790
84 Ga0068857_100008104 3300005577 Bacteria 9070
85 Ga0068857_100125654 3300005577 Bacteria 2311
86 Ga0068856_100728868 3300005614 Bacteria 1012
87 Ga0070702_100105405 3300005615 Bacteria 1737
88 Ga0068852_100040845 3300005616 Bacteria 3917
89 Ga0068852_100124009 3300005616 Bacteria 2369
90 Ga0068852_101275358 3300005616 Bacteria 756
91 Ga0068852_101372737 3300005616 Unclassified 728
92 Ga0068859_100402231 3300005617 Unclassified 1465
93 Ga0068864_100533055 3300005618 Unclassified 1133
94 Ga0068864_101240507 3300005618 Bacteria 745
95 Ga0068866_10013364 3300005718 Bacteria 3601
96 Ga0068858_100066521 3300005842 Bacteria 3337
97 Ga0068860_100136732 3300005843 Bacteria 2353
98 Ga0068862_100000864 3300005844 Bacteria 29658
99 Ga0070717_10074541 3300006028 Bacteria 2837
100 Ga0070717_10220403 3300006028 Bacteria 1667
101 Ga0070715_10049479 3300006163 Bacteria 1801
102 Ga0070712_100035288 3300006175 Bacteria 3395
103 Ga0097621_100813834 3300006237 Bacteria 866
104 Ga0075428_100014623 3300006844 Bacteria 8715
105 Ga0075430_100009108 3300006846 Bacteria 8386
106 Ga0075430_100032116 3300006846 Bacteria 4456
107 Ga0075431_100019180 3300006847 Bacteria 6970
108 Ga0075431_100213425 3300006847 Unclassified 1971
109 Ga0075431_100344300 3300006847 Bacteria 1500
110 Ga0075434_100223861 3300006871 Bacteria 1901
111 Ga0075429_100014668 3300006880 Bacteria 6794
112 Ga0068865_100020282 3300006881 Bacteria 4310
113 Ga0068865_100113206 3300006881 Unclassified 2005
114 Ga0075436_100253641 3300006914 Bacteria 1253
115 Ga0097620_100402259 3300006931 Unclassified 1465
116 Ga0075435_100190540 3300007076 Bacteria 1736
117 Ga0111539_10798339 3300009094 Unclassified 1099
118 Ga0114129_10009098 3300009147 Bacteria 14155
119 Ga0114129_10345736 3300009147 Bacteria 1971
120 Ga0105243_10269236 3300009148 Unclassified 1529
121 Ga0105243_10999592 3300009148 Bacteria 839
122 Ga0105242_10063690 3300009176 Bacteria 3037
123 Ga0105242_10797608 3300009176 Unclassified 934
124 Ga0105248_10119719 3300009177 Bacteria 2969
125 Ga0105248_10349429 3300009177 Bacteria 1665
126 Ga0105238_10266033 3300009551 Bacteria 1695
127 Ga0105238_10692696 3300009551 Unclassified 1031
128 Ga0105249_10001122 3300009553 Bacteria 23841
129 Ga0105246_10403399 3300011119 Unclassified 1136
130 Ga0157373_10035219 3300013100 Bacteria 3595
131 Ga0157373_10115342 3300013100 Bacteria 1888
132 Ga0157373_10617406 3300013100 Bacteria 790
133 Ga0157371_10166293 3300013102 Bacteria 1575
134 Ga0157370_10625256 3300013104 Unclassified 985
135 Ga0157369_10026908 3300013105 Bacteria 6378
136 Ga0157369_10107034 3300013105 Unclassified 2975
137 Ga0157369_10641374 3300013105 Unclassified 1096
138 Ga0157369_11232378 3300013105 Bacteria 763
139 Ga0157378_10411180 3300013297 Unclassified 1335
140 Ga0163162_10061655 3300013306 Bacteria 3788
141 Ga0163162_11301204 3300013306 Bacteria 826
142 Ga0157372_10003730 3300013307 Bacteria 16362
143 Ga0157372_10004718 3300013307 Bacteria 14483
144 Ga0157372_10041857 3300013307 Bacteria 5065
145 Ga0157372_10044369 3300013307 Bacteria 4926
146 Ga0157372_10632973 3300013307 Bacteria 1246
147 Ga0157372_10697514 3300013307 Bacteria 1181
148 Ga0157372_10866780 3300013307 Bacteria 1048
149 Ga0157375_10021987 3300013308 Bacteria 5863
150 Ga0157375_10168924 3300013308 Bacteria 2334
151 Ga0157380_10003024 3300014326 Bacteria 11459
152 Ga0182008_10011300 3300014497 Bacteria 4756
153 Ga0157376_10896569 3300014969 Unclassified 905
154 Ga0157376_11194801 3300014969 Bacteria 788
155 Ga0182007_10155597 3300015262 Bacteria 779
156 Ga0206354_11609563 3300020081 Bacteria 1108
157 Ga0213875_10142112 3300021388 Bacteria 1124
158 Ga0207682_10021720 3300025893 Bacteria 2526
159 Ga0207642_10096528 3300025899 Bacteria 1474
160 Ga0207647_10058030 3300025904 Bacteria 2371
161 Ga0207699_10004999 3300025906 Bacteria 6340
162 Ga0207699_10063828 3300025906 Unclassified 2226
163 Ga0207699_10165210 3300025906 Bacteria 1477
164 Ga0207645_10040627 3300025907 Bacteria 2979
165 Ga0207705_10004955 3300025909 Bacteria 9997
166 Ga0207705_10005590 3300025909 Bacteria 9398
167 Ga0207705_10023340 3300025909 Bacteria 4413
168 Ga0207705_10023862 3300025909 Bacteria 4364
169 Ga0207705_10146772 3300025909 Bacteria 1765
170 Ga0207705_10152784 3300025909 Unclassified 1730
171 Ga0207705_10450487 3300025909 Unclassified 998
172 Ga0207705_10679393 3300025909 Bacteria 801
173 Ga0207707_10011009 3300025912 Bacteria 7871
174 Ga0207707_10034107 3300025912 Bacteria 4454
175 Ga0207707_10124925 3300025912 Bacteria 2250
176 Ga0207707_10382290 3300025912 Bacteria 1210
177 Ga0207707_10435151 3300025912 Bacteria 1123
178 Ga0207695_10038501 3300025913 Bacteria 5147
179 Ga0207693_10018146 3300025915 Bacteria 5607
180 Ga0207693_10029954 3300025915 Bacteria 4295
181 Ga0207660_10014023 3300025917 Bacteria 5260
182 Ga0207660_10017761 3300025917 Bacteria 4732
183 Ga0207660_10092757 3300025917 Bacteria 2242
184 Ga0207660_10183355 3300025917 Bacteria 1627
185 Ga0207660_10753411 3300025917 Bacteria 795
186 Ga0207657_10000690 3300025919 Bacteria 35945
187 Ga0207657_10012848 3300025919 Bacteria 8239
188 Ga0207657_10109280 3300025919 Bacteria 2286
189 Ga0207649_10061369 3300025920 Bacteria 2366
190 Ga0207649_10197713 3300025920 Bacteria 1418
191 Ga0207652_10009462 3300025921 Bacteria 7834
192 Ga0207652_10035504 3300025921 Bacteria 4208
193 Ga0207652_10177548 3300025921 Bacteria 1913
194 Ga0207652_10376769 3300025921 Bacteria 1281
195 Ga0207652_10427163 3300025921 Bacteria 1195
196 Ga0207652_10471558 3300025921 Bacteria 1131
197 Ga0207681_10000870 3300025923 Bacteria 19848
198 Ga0207694_10003117 3300025924 Bacteria 13255
199 Ga0207694_10202406 3300025924 Bacteria 1616
200 Ga0207659_10056666 3300025926 Unclassified 2808
201 Ga0207659_10192276 3300025926 Unclassified 1625
202 Ga0207700_10010549 3300025928 Bacteria 5838
203 Ga0207700_10041101 3300025928 Unclassified 3380
204 Ga0207664_10005409 3300025929 Bacteria 8721
205 Ga0207664_10033654 3300025929 Bacteria 3940
206 Ga0207664_10051023 3300025929 Bacteria 3265
207 Ga0207644_10063231 3300025931 Bacteria 2687
208 Ga0207644_10732218 3300025931 Unclassified 825
209 Ga0207690_10041658 3300025932 Bacteria 3011
210 Ga0207690_10108992 3300025932 Bacteria 1991
211 Ga0207690_10141719 3300025932 Archaea 1772
212 Ga0207690_10229580 3300025932 Bacteria 1424
213 Ga0207706_10033441 3300025933 Bacteria 4577
214 Ga0207706_10085763 3300025933 Bacteria 2769
215 Ga0207706_10224462 3300025933 Unclassified 1644
216 Ga0207686_10092675 3300025934 Bacteria 1998
217 Ga0207686_10137973 3300025934 Bacteria 1682
218 Ga0207669_10083036 3300025937 Bacteria 2059
219 Ga0207669_10371257 3300025937 Bacteria 1112
220 Ga0207704_10001732 3300025938 Bacteria 9772
221 Ga0207704_10286623 3300025938 Bacteria 1254
222 Ga0207691_10005458 3300025940 Bacteria 12277
223 Ga0207691_10016782 3300025940 Bacteria 6948
224 Ga0207711_10085171 3300025941 Bacteria 2769
225 Ga0207661_10012679 3300025944 Bacteria 6136
226 Ga0207661_10140019 3300025944 Bacteria 2081
227 Ga0207679_10011107 3300025945 Bacteria 5814
228 Ga0207679_10052746 3300025945 Bacteria 2984
229 Ga0207679_10198625 3300025945 Bacteria 1674
230 Ga0207679_10604553 3300025945 Bacteria 988
231 Ga0207667_10428949 3300025949 Bacteria 1345
232 Ga0207667_10907016 3300025949 Bacteria 873
233 Ga0207712_10001107 3300025961 Bacteria 18842
234 Ga0207658_10063649 3300025986 Unclassified 2765
235 Ga0207703_10188771 3300026035 Unclassified 1824
236 Ga0207639_10054682 3300026041 Bacteria 3052
237 Ga0207639_10058703 3300026041 Bacteria 2960
238 Ga0207639_10637955 3300026041 Unclassified 985
239 Ga0207639_11183766 3300026041 Bacteria 717
240 Ga0207678_10309065 3300026067 Bacteria 1359
241 Ga0207702_11057274 3300026078 Bacteria 805
242 Ga0207641_10330082 3300026088 Bacteria 1449
243 Ga0207648_10020671 3300026089 Bacteria 5926
244 Ga0207648_10114102 3300026089 Bacteria 2374
245 Ga0207676_10056914 3300026095 Bacteria 3077
246 Ga0207676_10261081 3300026095 Bacteria 1564
247 Ga0207676_10520184 3300026095 Bacteria 1133
248 Ga0207674_10006313 3300026116 Bacteria 13968
249 Ga0207674_10187953 3300026116 Bacteria 2016
250 Ga0207683_10410562 3300026121 Unclassified 1246
251 Ga0207698_10053335 3300026142 Bacteria 3103
252 Ga0207698_10126393 3300026142 Bacteria 2175
253 Ga0207698_10262610 3300026142 Bacteria 1587
254 Ga0268266_10031484 3300028379 Bacteria 4505
255 Ga0268265_10004069 3300028380 Bacteria 10277
256 Ga0268265_11444373 3300028380 Unclassified 691
257 Ga0268264_10084341 3300028381 Bacteria 2724
258 Ga0265332_10147274 3300031238 Unclassified 985
259 Ga0307408_100012902 3300031548 Bacteria 5540
260 Ga0307408_100964948 3300031548 Bacteria 784
261 Ga0265314_10008723 3300031711 Bacteria 8666
262 Ga0307405_10000162 3300031731 Bacteria 24577
263 Ga0307413_10000538 3300031824 Bacteria 12594
264 Ga0307410_10013161 3300031852 Bacteria 4815
265 Ga0307410_10186127 3300031852 Unclassified 1576
266 Ga0307406_10003650 3300031901 Bacteria 8382
267 Ga0307406_10852316 3300031901 Unclassified 773
268 Ga0307407_10001101 3300031903 Bacteria 9436
269 Ga0307407_10230399 3300031903 Bacteria 1258
270 Ga0307412_10003190 3300031911 Bacteria 9108
271 Ga0307412_10251351 3300031911 Bacteria 1373
272 Ga0307412_10850714 3300031911 Unclassified 796
273 Ga0307409_100594887 3300031995 Bacteria 1092
274 Ga0307409_101382539 3300031995 Unclassified 730
275 Ga0307416_100032752 3300032002 Bacteria 3932
276 Ga0307416_100264307 3300032002 Bacteria 1684
277 Ga0307416_100553737 3300032002 Bacteria 1224
278 Ga0307416_100696280 3300032002 Unclassified 1105
279 Ga0307414_10005259 3300032004 Bacteria 7115
280 Ga0307411_10001407 3300032005 Bacteria 9780
281 Ga0307411_10455770 3300032005 Bacteria 1071
282 Ga0307411_10671796 3300032005 Unclassified 899
283 Ga0307415_100004918 3300032126 Bacteria 7020
284 Ga0307415_100035301 3300032126 Bacteria 3265
285 Ga0373934_0000246 3300035086 Bacteria 19441
286 Ga0373923_0022710 3300035111 Bacteria 2462
287 Ga0373936_0129614 3300035113 Unclassified 1083
288 Ga0373945_0004315 3300035116 Bacteria 4518
289 Ga0373956_0001027 3300035119 Bacteria 11515
290 Ga0373943_0008063 3300035170 Bacteria 4725
291 Ga0373955_0013331 3300035172 Bacteria 3973
292 Ga0373924_0007337 3300035410 Bacteria 3978
293 Ga0373935_0007945 3300035692 Bacteria 6362
294 Ga0373927_0018614 3300035695 Bacteria 4561
295 Ga0373933_0005341 3300035724 Bacteria 7001
296 Ga0373937_0001671 3300036401 Bacteria 18648
297 Ga0373937_0914355 3300036401 Bacteria 826
298 Ga0373925_0000385 3300037068 Bacteria 45502
299 Ga0373925_0343543 3300037068 Unclassified 1211
300 Ga0395905_1038651 3300037471 Unclassified 723
301 Ga0436364_0920498 3300037853 Bacteria 3827
302 Ga0436364_1510006 3300037853 Unclassified 1224
303 Ga0451853_2313564 3300041512 Unclassified 985
304 Ga0466957_0088368 3300044842 Bacteria 1939
305 Ga0466959_0120661 3300045049 Unclassified 1864
306 Ga0451576_0203429 3300045051 Bacteria 2068
307 Ga0466958_0060058 3300045836 Bacteria 2314
308 Ga0466967_0013918 3300045976 Bacteria 6241
309 Ga0466967_0066069 3300045976 Bacteria 3222
310 Ga0466967_0996715 3300045976 Unclassified 834
311 Ga0495592_0000632 3300046454 Bacteria 24520
312 Ga0495592_0216590 3300046454 Bacteria 1283
313 Ga0495603_0003985 3300046455 Bacteria 8790
314 Ga0495603_0087846 3300046455 Bacteria 1819
315 Ga0495590_0355242 3300046457 Bacteria 557
316 Ga0495629_0012457 3300046459 Bacteria 6160
317 Ga0495629_0020898 3300046459 Bacteria 4672
318 Ga0495629_0495447 3300046459 Bacteria 824
319 Ga0495651_0000077 3300046462 Bacteria 71891
320 Ga0495653_0000153 3300046463 Bacteria 57262
321 Ga0495653_0277173 3300046463 Bacteria 1102
322 Ga0495580_0001293 3300046472 Bacteria 22086
323 Ga0495582_0174663 3300046473 Bacteria 1224
324 Ga0495582_0176067 3300046473 Unclassified 1218
325 Ga0495639_0000575 3300046475 Bacteria 17150
326 Ga0495662_0124060 3300046476 Bacteria 1268
327 Ga0495664_0085858 3300046477 Unclassified 1890
328 Ga0495585_0259621 3300046492 Bacteria 864
329 Ga0495594_0160107 3300046499 Bacteria 1280
330 Ga0495594_0257395 3300046499 Bacteria 994
331 Ga0495608_0000166 3300046511 Bacteria 46948
332 Ga0495608_0194086 3300046511 Bacteria 1281
333 Ga0495618_0363782 3300046514 Bacteria 890
334 Ga0495628_0002032 3300046516 Bacteria 18338
335 Ga0495628_0343663 3300046516 Bacteria 1098
336 Ga0495630_0000980 3300046517 Bacteria 19843
337 Ga0495630_0021535 3300046517 Bacteria 4760
338 Ga0495652_0002213 3300046529 Bacteria 20389
339 Ga0495652_0240568 3300046529 Bacteria 1347
340 Ga0495665_0000002 3300046531 Bacteria 128983
341 Ga0495665_0163725 3300046531 Bacteria 1159
342 Ga0495665_0183776 3300046531 Bacteria 1086
343 Ga0495640_0084751 3300046533 Bacteria 2101
344 Ga0495640_0207858 3300046533 Bacteria 1238
345 Ga0495586_0015017 3300046535 Bacteria 4117
346 Ga0495586_0040394 3300046535 Bacteria 2509
347 Ga0495586_0048991 3300046535 Bacteria 2284
348 Ga0495586_0151912 3300046535 Bacteria 1303
349 Ga0495587_0000400 3300046536 Bacteria 30690
350 Ga0495587_0013079 3300046536 Bacteria 5219
351 Ga0495587_0167550 3300046536 Bacteria 1248
352 Ga0495645_0000484 3300046543 Bacteria 27579
353 Ga0495645_0182362 3300046543 Bacteria 1437
354 Ga0495645_0182682 3300046543 Bacteria 1435
355 Ga0495667_0000489 3300046559 Bacteria 25253
356 Ga0495667_0095779 3300046559 Bacteria 1921
357 Ga0495667_0210096 3300046559 Bacteria 1244
358 Ga0495635_0000048 3300046663 Bacteria 79393
359 Ga0495635_0141357 3300046663 Bacteria 1639
360 Ga0495588_0000817 3300046674 Bacteria 13886
361 Ga0495657_0000318 3300046675 Bacteria 44307
362 Ga0495657_0119120 3300046675 Bacteria 1664
363 Ga0495657_0377748 3300046675 Unclassified 836
364 Ga0495599_0002246 3300046678 Bacteria 11242
365 Ga0495599_0238787 3300046678 Unclassified 1108
366 Ga0495599_0303414 3300046678 Bacteria 963
367 Ga0495623_0000110 3300046679 Bacteria 50112
368 Ga0495623_0100278 3300046679 Bacteria 1765
369 Ga0495646_0002674 3300046680 Bacteria 11030
370 Ga0495658_0000017 3300046683 Bacteria 93346
371 Ga0495613_0009269 3300046689 Bacteria 7303
372 Ga0495613_0046381 3300046689 Bacteria 3213
373 Ga0495624_0358711 3300046690 Bacteria 877
374 Ga0495600_0000273 3300046809 Bacteria 28023
375 Ga0495600_0096954 3300046809 Bacteria 1922
376 Ga0495600_0209649 3300046809 Bacteria 1249
377 Ga0495600_0564821 3300046809 Viruses 694
378 Ga0495581_0000727 3300047315 Bacteria 17418
379 Ga0495581_0035752 3300047315 Bacteria 2874
380 Ga0495581_0043946 3300047315 Bacteria 2584
381 Ga0495581_0321028 3300047315 Unclassified 905
382 Ga0495604_0000017 3300047317 Bacteria 192029
383 Ga0495604_0066128 3300047317 Bacteria 2751
384 Ga0495674_0024600 3300047319 Bacteria 5530
385 Ga0495674_0090221 3300047319 Bacteria 2619
386 Ga0495674_0093459 3300047319 Bacteria 2566
387 Ga0495680_0015843 3300047322 Bacteria 6488
388 Ga0495680_0074131 3300047322 Bacteria 2585
389 Ga0495680_0179977 3300047322 Bacteria 1526
390 Ga0495675_0000800 3300047444 Bacteria 19382
391 Ga0495684_0000785 3300047471 Bacteria 25792
392 Ga0495684_0226304 3300047471 Bacteria 1369
393 Ga0495593_0104721 3300047673 Bacteria 1448
394 Ga0495593_0118489 3300047673 Unclassified 1348
395 Ga0495602_0007248 3300048088 Bacteria 11612
396 Ga0495602_0028785 3300048088 Bacteria 5307
397 Ga0495602_0075395 3300048088 Bacteria 2863
398 Ga0495614_0000005 3300048089 Bacteria 74692
399 Ga0496100_0365956 3300048903 Bacteria 1092
400 Ga0496104_0118557 3300048907 Bacteria 2541
401 Ga0496104_0197845 3300048907 Bacteria 1922
402 Ga0496108_0938143 3300048911 Bacteria 741
403 Ga0496110_1272222 3300048913 Bacteria 645
404 Ga0496112_0038996 3300048915 Bacteria 4640
405 Ga0496112_0201749 3300048915 Bacteria 1948
406 Ga0496113_0049369 3300048916 Bacteria 3133
407 Ga0496115_0036770 3300048918 Bacteria 3878
408 Ga0501032_0510260 3300049569 Bacteria 768
409 Ga0501033_0004019 3300049570 Bacteria 11885
410 Ga0501034_0022849 3300049571 Bacteria 6372
411 Ga0501036_0012090 3300049572 Bacteria 7155
412 Ga0501036_0284851 3300049572 Bacteria 1383
413 Ga0501037_0352625 3300049573 Bacteria 1015
414 Ga0501038_0046096 3300049574 Bacteria 3781
415 Ga0501043_0055146 3300049579 Bacteria 3122
416 Ga0501047_0013386 3300049581 Bacteria 7775
417 Ga0501070_0039373 3300049586 Bacteria 3943
418 Ga0501207_048338 3300049654 Bacteria 755
419 Ga0501035_0105817 3300049822 Bacteria 2467
420 Ga0501044_0003693 3300049823 Bacteria 17206
421 nmdc:mga05p37_407334_c1 3300050507 Unclassified 1586
422 nmdc:mga05p37_42957_c1 3300050507 Bacteria 5557
423 nmdc:mga09592_9336_c1 3300050508 Bacteria 7975
424 nmdc:mga0qj67_15827_c1 3300050509 Bacteria 5712
425 nmdc:mga0qj67_26080_c1 3300050509 Bacteria 4523
426 nmdc:mga06r32_201686_c1 3300050510 Bacteria 1977
427 nmdc:mga06r32_282157_c1 3300050510 Unclassified 1648
428 nmdc:mga06r32_463599_c1 3300050510 Unclassified 1246
429 nmdc:mga08y16_41772_c1 3300050511 Bacteria 4803
430 nmdc:mga0n895_346406_c1 3300050512 Unclassified 1505
431 nmdc:mga0n895_723038_c1 3300050512 Unclassified 990
432 nmdc:mga0a205_184739_c1 3300050515 Bacteria 1978
433 nmdc:mga0a205_448110_c1 3300050515 Unclassified 1151
434 Ga0495601_0004220 3300053077 Bacteria 8292
435 Ga0495612_0002385 3300053078 Bacteria 7747
436 Ga0495595_0022200 3300053084 Bacteria 2783
437 Ga0495619_0006054 3300053085 Bacteria 7664
438 Ga0590071_022508 3300059421 Bacteria 1487
439 Ga0590075_024906 3300059424 Bacteria 1503
440 Ga0590077_083922 3300059426 Unclassified 735
441 Ga0207681_10030023
442 Ga0070658_10002792
443 Ga0070658_10064942
444 Ga0070658_10069880
445 Ga0070658_10410392
446 Ga0070658_11128100
447 Ga0070676_10036064
448 Ga0070676_10340440
449 Ga0070676_10420923
450 Ga0070676_10667461
451 Ga0070683_100017629
452 Ga0070683_100027619
453 Ga0070683_100440596
454 Ga0070670_100005240
455 Ga0070680_100016153
456 Ga0070680_100039944
457 Ga0068868_100103179
458 Ga0068868_100160775
459 Ga0070660_100002933
460 Ga0070660_100087392
461 Ga0070691_10000572
462 Ga0070661_100014869
463 Ga0070661_100126040
464 Ga0070661_100204993
465 Ga0070668_100026230
466 Ga0070669_100007145
467 Ga0070675_100001511
468 Ga0070671_100069223
469 Ga0070671_100129325
470 Ga0070674_100049933
471 Ga0070674_100057334
472 Ga0070674_100421627
473 Ga0070674_100576202
474 Ga0070673_100305741
475 Ga0070673_100696368
476 Ga0070673_101185715
477 Ga0070688_100440273
478 Ga0070659_100082140
479 Ga0070659_100098699
480 Ga0070659_100171168
481 Ga0070714_100023611
482 Ga0070714_100025909
483 Ga0070714_100181790
484 Ga0070714_100246859
485 Ga0070713_100004084
486 Ga0070713_100166626
487 Ga0070713_100840455
488 Ga0070710_10194801
489 Ga0070678_100283375
490 Ga0070678_100401493
491 Ga0070662_100083023
492 Ga0070662_100177858
493 Ga0070662_100199273
494 Ga0070681_10019316
495 Ga0068867_100006965
496 Ga0068867_100048370
497 Ga0068867_100060017
498 Ga0070698_100114663
499 Ga0070699_100630436
500 Ga0070679_100003639
501 Ga0070679_100028836
502 Ga0070679_100142480
503 Ga0070679_100351680
504 Ga0070679_100364473
505 Ga0070679_100422041
506 Ga0070679_100436822
507 Ga0070684_100114705
508 Ga0070684_100165754
509 Ga0070684_100267250
510 Ga0070684_100352450
511 Ga0070684_100355395
512 Ga0068853_100069801
513 Ga0068853_100266524
514 Ga0068853_100972724
515 Ga0070672_100056614
516 Ga0070672_100085489
517 Ga0070672_100339207
518 Ga0070686_100347737
519 Ga0070665_100019563
520 Ga0068855_101412455
521 Ga0070664_100023648
522 Ga0070664_100024639
523 Ga0070664_100989897
524 Ga0068857_100008104
525 Ga0068857_100125654
526 Ga0068856_100728868
527 Ga0070702_100105405
528 Ga0068852_100040845
529 Ga0068852_100124009
530 Ga0068852_101275358
531 Ga0068852_101372737
532 Ga0068859_100402231
533 Ga0068864_100533055
534 Ga0068864_101240507
535 Ga0068866_10013364
536 Ga0068858_100066521
537 Ga0068860_100136732
538 Ga0068862_100000864
539 Ga0070717_10074541
540 Ga0070717_10220403
541 Ga0070715_10049479
542 Ga0070712_100035288
543 Ga0097621_100813834
544 Ga0075428_100014623
545 Ga0075430_100009108
546 Ga0075430_100032116
547 Ga0075431_100019180
548 Ga0075431_100213425
549 Ga0075431_100344300
550 Ga0075434_100223861
551 Ga0075429_100014668
552 Ga0068865_100020282
553 Ga0068865_100113206
554 Ga0075436_100253641
555 Ga0097620_100402259
556 Ga0075435_100190540
557 Ga0111539_10798339
558 Ga0114129_10009098
559 Ga0114129_10345736
560 Ga0105243_10269236
561 Ga0105243_10999592
562 Ga0105242_10063690
563 Ga0105242_10797608
564 Ga0105248_10119719
565 Ga0105248_10349429
566 Ga0105238_10266033
567 Ga0105238_10692696
568 Ga0105249_10001122
569 Ga0105246_10403399
570 Ga0157373_10035219
571 Ga0157373_10115342
572 Ga0157373_10617406
573 Ga0157371_10166293
574 Ga0157370_10625256
575 Ga0157369_10026908
576 Ga0157369_10107034
577 Ga0157369_10641374
578 Ga0157369_11232378
579 Ga0157378_10411180
580 Ga0163162_10061655
581 Ga0163162_11301204
582 Ga0157372_10003730
583 Ga0157372_10004718
584 Ga0157372_10041857
585 Ga0157372_10044369
586 Ga0157372_10632973
587 Ga0157372_10697514
588 Ga0157372_10866780
589 Ga0157375_10021987
590 Ga0157375_10168924
591 Ga0157380_10003024
592 Ga0182008_10011300
593 Ga0157376_10896569
594 Ga0157376_11194801
595 Ga0182007_10155597
596 Ga0206354_11609563
597 Ga0213875_10142112
598 Ga0207682_10021720
599 Ga0207642_10096528
600 Ga0207647_10058030
601 Ga0207699_10004999
602 Ga0207699_10063828
603 Ga0207699_10165210
604 Ga0207645_10040627
605 Ga0207705_10004955
606 Ga0207705_10005590
607 Ga0207705_10023340
608 Ga0207705_10023862
609 Ga0207705_10146772
610 Ga0207705_10152784
611 Ga0207705_10450487
612 Ga0207705_10679393
613 Ga0207707_10011009
614 Ga0207707_10034107
615 Ga0207707_10124925
616 Ga0207707_10382290
617 Ga0207707_10435151
618 Ga0207695_10038501
619 Ga0207693_10018146
620 Ga0207693_10029954
621 Ga0207660_10014023
622 Ga0207660_10017761
623 Ga0207660_10092757
624 Ga0207660_10183355
625 Ga0207660_10753411
626 Ga0207657_10000690
627 Ga0207657_10012848
628 Ga0207657_10109280
629 Ga0207649_10061369
630 Ga0207649_10197713
631 Ga0207652_10009462
632 Ga0207652_10035504
633 Ga0207652_10177548
634 Ga0207652_10376769
635 Ga0207652_10427163
636 Ga0207652_10471558
637 Ga0207681_10000870
638 Ga0207694_10003117
639 Ga0207694_10202406
640 Ga0207659_10056666
641 Ga0207659_10192276
642 Ga0207700_10010549
643 Ga0207700_10041101
644 Ga0207664_10005409
645 Ga0207664_10033654
646 Ga0207664_10051023
647 Ga0207644_10063231
648 Ga0207644_10732218
649 Ga0207690_10041658
650 Ga0207690_10108992
651 Ga0207690_10141719
652 Ga0207690_10229580
653 Ga0207706_10033441
654 Ga0207706_10085763
655 Ga0207706_10224462
656 Ga0207686_10092675
657 Ga0207686_10137973
658 Ga0207669_10083036
659 Ga0207669_10371257
660 Ga0207704_10001732
661 Ga0207704_10286623
662 Ga0207691_10005458
663 Ga0207691_10016782
664 Ga0207711_10085171
665 Ga0207661_10012679
666 Ga0207661_10140019
667 Ga0207679_10011107
668 Ga0207679_10052746
669 Ga0207679_10198625
670 Ga0207679_10604553
671 Ga0207667_10428949
672 Ga0207667_10907016
673 Ga0207712_10001107
674 Ga0207658_10063649
675 Ga0207703_10188771
676 Ga0207639_10054682
677 Ga0207639_10058703
678 Ga0207639_10637955
679 Ga0207639_11183766
680 Ga0207678_10309065
681 Ga0207702_11057274
682 Ga0207641_10330082
683 Ga0207648_10020671
684 Ga0207648_10114102
685 Ga0207676_10056914
686 Ga0207676_10261081
687 Ga0207676_10520184
688 Ga0207674_10006313
689 Ga0207674_10187953
690 Ga0207683_10410562
691 Ga0207698_10053335
692 Ga0207698_10126393
693 Ga0207698_10262610
694 Ga0268266_10031484
695 Ga0268265_10004069
696 Ga0268265_11444373
697 Ga0268264_10084341
698 Ga0265332_10147274
699 Ga0307408_100012902
700 Ga0307408_100964948
701 Ga0265314_10008723
702 Ga0307405_10000162
703 Ga0307413_10000538
704 Ga0307410_10013161
705 Ga0307410_10186127
706 Ga0307406_10003650
707 Ga0307406_10852316
708 Ga0307407_10001101
709 Ga0307407_10230399
710 Ga0307412_10003190
711 Ga0307412_10251351
712 Ga0307412_10850714
713 Ga0307409_100594887
714 Ga0307409_101382539
715 Ga0307416_100032752
716 Ga0307416_100264307
717 Ga0307416_100553737
718 Ga0307416_100696280
719 Ga0307414_10005259
720 Ga0307411_10001407
721 Ga0307411_10455770
722 Ga0307411_10671796
723 Ga0307415_100004918
724 Ga0307415_100035301
725 Ga0373934_0000246
726 Ga0373923_0022710
727 Ga0373936_0129614
728 Ga0373945_0004315
729 Ga0373956_0001027
730 Ga0373943_0008063
731 Ga0373955_0013331
732 Ga0373924_0007337
733 Ga0373935_0007945
734 Ga0373927_0018614
735 Ga0373933_0005341
736 Ga0373937_0001671
737 Ga0373937_0914355
738 Ga0373925_0000385
739 Ga0373925_0343543
740 Ga0395905_1038651
741 Ga0436364_0920498
742 Ga0436364_1510006
743 Ga0451853_2313564
744 Ga0466957_0088368
745 Ga0466959_0120661
746 Ga0451576_0203429
747 Ga0466958_0060058
748 Ga0466967_0013918
749 Ga0466967_0066069
750 Ga0466967_0996715
751 Ga0495592_0000632
752 Ga0495592_0216590
753 Ga0495603_0003985
754 Ga0495603_0087846
755 Ga0495590_0355242
756 Ga0495629_0012457
757 Ga0495629_0020898
758 Ga0495629_0495447
759 Ga0495651_0000077
760 Ga0495653_0000153
761 Ga0495653_0277173
762 Ga0495580_0001293
763 Ga0495582_0174663
764 Ga0495582_0176067
765 Ga0495639_0000575
766 Ga0495662_0124060
767 Ga0495664_0085858
768 Ga0495585_0259621
769 Ga0495594_0160107
770 Ga0495594_0257395
771 Ga0495608_0000166
772 Ga0495608_0194086
773 Ga0495618_0363782
774 Ga0495628_0002032
775 Ga0495628_0343663
776 Ga0495630_0000980
777 Ga0495630_0021535
778 Ga0495652_0002213
779 Ga0495652_0240568
780 Ga0495665_0000002
781 Ga0495665_0163725
782 Ga0495665_0183776
783 Ga0495640_0084751
784 Ga0495640_0207858
785 Ga0495586_0015017
786 Ga0495586_0040394
787 Ga0495586_0048991
788 Ga0495586_0151912
789 Ga0495587_0000400
790 Ga0495587_0013079
791 Ga0495587_0167550
792 Ga0495645_0000484
793 Ga0495645_0182362
794 Ga0495645_0182682
795 Ga0495667_0000489
796 Ga0495667_0095779
797 Ga0495667_0210096
798 Ga0495635_0000048
799 Ga0495635_0141357
800 Ga0495588_0000817
801 Ga0495657_0000318
802 Ga0495657_0119120
803 Ga0495657_0377748
804 Ga0495599_0002246
805 Ga0495599_0238787
806 Ga0495599_0303414
807 Ga0495623_0000110
808 Ga0495623_0100278
809 Ga0495646_0002674
810 Ga0495658_0000017
811 Ga0495613_0009269
812 Ga0495613_0046381
813 Ga0495624_0358711
814 Ga0495600_0000273
815 Ga0495600_0096954
816 Ga0495600_0209649
817 Ga0495600_0564821
818 Ga0495581_0000727
819 Ga0495581_0035752
820 Ga0495581_0043946
821 Ga0495581_0321028
822 Ga0495604_0000017
823 Ga0495604_0066128
824 Ga0495674_0024600
825 Ga0495674_0090221
826 Ga0495674_0093459
827 Ga0495680_0015843
828 Ga0495680_0074131
829 Ga0495680_0179977
830 Ga0495675_0000800
831 Ga0495684_0000785
832 Ga0495684_0226304
833 Ga0495593_0104721
834 Ga0495593_0118489
835 Ga0495602_0007248
836 Ga0495602_0028785
837 Ga0495602_0075395
838 Ga0495614_0000005
839 Ga0496100_0365956
840 Ga0496104_0118557
841 Ga0496104_0197845
842 Ga0496108_0938143
843 Ga0496110_1272222
844 Ga0496112_0038996
845 Ga0496112_0201749
846 Ga0496113_0049369
847 Ga0496115_0036770
848 Ga0501032_0510260
849 Ga0501033_0004019
850 Ga0501034_0022849
851 Ga0501036_0012090
852 Ga0501036_0284851
853 Ga0501037_0352625
854 Ga0501038_0046096
855 Ga0501043_0055146
856 Ga0501047_0013386
857 Ga0501070_0039373
858 Ga0501207_048338
859 Ga0501035_0105817
860 Ga0501044_0003693
861 nmdc:mga05p37_407334_c1
862 nmdc:mga05p37_42957_c1
863 nmdc:mga09592_9336_c1
864 nmdc:mga0qj67_15827_c1
865 nmdc:mga0qj67_26080_c1
866 nmdc:mga06r32_201686_c1
867 nmdc:mga06r32_282157_c1
868 nmdc:mga06r32_463599_c1
869 nmdc:mga08y16_41772_c1
870 nmdc:mga0n895_346406_c1
871 nmdc:mga0n895_723038_c1
872 nmdc:mga0a205_184739_c1
873 nmdc:mga0a205_448110_c1
874 Ga0495601_0004220
875 Ga0495612_0002385
876 Ga0495595_0022200
877 Ga0495619_0006054
878 Ga0590071_022508
879 Ga0590075_024906
880 Ga0590077_083922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02830

V4R

V4R domain

141

192

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oso-assembly1.cif.gz_A crystal structure of a vinyl-4-reductase family protein (mj_1460) from methanocaldococcus jannaschii dsm at 1.90 a resolution 0.8386 37 157
7b70-assembly1.cif.gz_A trappcore plus c8 (355-596) and c11 (1-718) from minitrappiii 0.768 15 158
7vqf-assembly1.cif.gz_A phenol binding protein, mopr 0.7535 10 159
7e2d-assembly1.cif.gz_C monomer of trappii (closed) 0.7527 13 158
6aq3-assembly1.cif.gz_A crystal structure of a trafficking protein particle complex subunit 3 from naegleria fowleri covalently bound to palmitic acid 0.7492 15 158
ID Description Score Start End Superfamily
2osdA00 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.8449 74 159 3.30.1380.20
af_Q3UQ05_61_243_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.8143 88 102 3.15.10.10
af_Q58265_65_225_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.8027 18 160 3.30.1380.20
af_Q58155_28_181_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7814 11 160 3.30.1380.20
af_Q58149_3_150_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7531 10 157 3.30.1380.20
ID Description Score Start End GO Terms
AF-A0A7Y5TR62-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9853 1 182
AF-A0A2V7T0X8-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9788 1 182
AF-A0A7Y5TR62-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9747 1 182
AF-A0A2V7T0X8-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9683 1 182
AF-A0A7V9PI20-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9617 1 181

Map