F444438

General Info

Members Datasets Scaffolds Average Seq Length
440 254 880 204

Family's Representative Sequence

Representative Sequence 3300025303|Ga0209051_1014198|Ga0209051_10141982
Length 232
Sequence MSCASSTPKRACADFPDDAHSIAAHNRVMRAEVTSIAELRAIVGEPDPAVANKVKDRLSAVQRDWLAHSPLAFVATTDSQGRVDVSPKGDPPGFVHVIDEQTIAIPDRTGNKRVDGYLNLLQRPQVGTVFLIPGRGDTLRINGRARILADADYFDTMIVQGKRPLLVMEIEIEEVFFHCPKAFLRSDTWKPETWNPTALPSLAQMLKALRADWTDAQLEERYSEENIRRSMY

Samples

Sample ID Description Type Environment
1 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
174 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
229 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
247 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
248 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
249 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
250 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
251 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
252 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
253 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
254 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.05
Nodule 0
Rhizoplane 11.36
Rhizosphere 66.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209051_1014198 3300025303 Bacteria 3729
2 JGI24743J22301_10000505 3300001991 Bacteria 4558
3 JGI24744J21845_10000823 3300002077 Bacteria 5844
4 JGI24744J21845_10007377 3300002077 Bacteria 2271
5 JGI24034J26672_10027377 3300002239 Bacteria 917
6 Ga0055540_1000221 3300003792 Bacteria 53636
7 Ga0055540_1004248 3300003792 Bacteria 6563
8 Ga0070676_10085721 3300005328 Bacteria 1920
9 Ga0070676_10220632 3300005328 Bacteria 1252
10 Ga0070670_100589562 3300005331 Bacteria 994
11 Ga0068869_100050577 3300005334 Bacteria 3013
12 Ga0068869_100122676 3300005334 Bacteria 1989
13 Ga0068869_100389929 3300005334 Bacteria 1143
14 Ga0070666_10010240 3300005335 Bacteria 5859
15 Ga0070666_10021248 3300005335 Bacteria 4205
16 Ga0070680_100276538 3300005336 Bacteria 1422
17 Ga0070682_100016248 3300005337 Bacteria 4325
18 Ga0070682_100050184 3300005337 Bacteria 2604
19 Ga0070682_100130933 3300005337 Bacteria 1698
20 Ga0068868_100079229 3300005338 Bacteria 2631
21 Ga0070689_100029726 3300005340 Bacteria 4140
22 Ga0070691_10085883 3300005341 Bacteria 1546
23 Ga0070687_100083264 3300005343 Bacteria 1751
24 Ga0070692_10150096 3300005345 Bacteria 1327
25 Ga0070668_100000385 3300005347 Bacteria 29197
26 Ga0070668_100002937 3300005347 Bacteria 12599
27 Ga0070668_100051410 3300005347 Bacteria 3175
28 Ga0070668_100500874 3300005347 Bacteria 1051
29 Ga0070669_100324167 3300005353 Bacteria 1245
30 Ga0070675_100621326 3300005354 Bacteria 981
31 Ga0070671_100029743 3300005355 Bacteria 4505
32 Ga0070674_100001147 3300005356 Bacteria 13956
33 Ga0070674_100297588 3300005356 Bacteria 1285
34 Ga0070673_100426830 3300005364 Bacteria 1189
35 Ga0070688_100019754 3300005365 Bacteria 3907
36 Ga0070688_100139460 3300005365 Bacteria 1645
37 Ga0070667_100061907 3300005367 Bacteria 3169
38 Ga0070667_100110974 3300005367 Bacteria 2378
39 Ga0070667_100131255 3300005367 Bacteria 2187
40 Ga0070667_100387950 3300005367 Bacteria 1270
41 Ga0070703_10016666 3300005406 Bacteria 2110
42 Ga0070709_10004515 3300005434 Bacteria 7508
43 Ga0070709_10296312 3300005434 Bacteria 1180
44 Ga0070714_100096991 3300005435 Bacteria 2591
45 Ga0070714_100223104 3300005435 Bacteria 1733
46 Ga0070714_101085147 3300005435 Bacteria 780
47 Ga0070710_10018698 3300005437 Bacteria 3569
48 Ga0070701_10001192 3300005438 Bacteria 9520
49 Ga0070711_100000197 3300005439 Bacteria 31831
50 Ga0070711_100002333 3300005439 Bacteria 10781
51 Ga0070711_100998865 3300005439 Bacteria 718
52 Ga0070705_100681729 3300005440 Bacteria 805
53 Ga0070700_100001650 3300005441 Bacteria 11173
54 Ga0070700_100142815 3300005441 Bacteria 1629
55 Ga0070694_100385054 3300005444 Bacteria 1095
56 Ga0070663_100032886 3300005455 Bacteria 3579
57 Ga0070663_100053849 3300005455 Bacteria 2874
58 Ga0070663_100055026 3300005455 Bacteria 2846
59 Ga0070678_100009133 3300005456 Bacteria 5984
60 Ga0070678_100064313 3300005456 Bacteria 2718
61 Ga0070662_100021245 3300005457 Bacteria 4430
62 Ga0068867_100021210 3300005459 Bacteria 4634
63 Ga0070685_10018277 3300005466 Bacteria 3768
64 Ga0070685_10173574 3300005466 Bacteria 1383
65 Ga0070697_100260711 3300005536 Bacteria 1484
66 Ga0068853_100010887 3300005539 Bacteria 7368
67 Ga0070672_100358646 3300005543 Bacteria 1244
68 Ga0070686_100146100 3300005544 Bacteria 1651
69 Ga0070686_100837212 3300005544 Bacteria 744
70 Ga0070696_100010743 3300005546 Bacteria 6133
71 Ga0070696_100022080 3300005546 Bacteria 4321
72 Ga0070693_100020309 3300005547 Bacteria 3500
73 Ga0070693_100058681 3300005547 Bacteria 2228
74 Ga0070665_100007477 3300005548 Bacteria 11108
75 Ga0070665_100011098 3300005548 Bacteria 9102
76 Ga0070665_100115112 3300005548 Bacteria 2692
77 Ga0070704_100470698 3300005549 Bacteria 1085
78 Ga0068855_100639649 3300005563 Bacteria 1143
79 Ga0068857_100679899 3300005577 Bacteria 977
80 Ga0068854_100003036 3300005578 Bacteria 10437
81 Ga0068854_100245555 3300005578 Bacteria 1427
82 Ga0068856_100292123 3300005614 Bacteria 1647
83 Ga0070702_100000458 3300005615 Bacteria 14558
84 Ga0070702_100035392 3300005615 Bacteria 2759
85 Ga0068852_100080297 3300005616 Bacteria 2891
86 Ga0068859_100010462 3300005617 Bacteria 9334
87 Ga0068859_100035000 3300005617 Bacteria 5038
88 Ga0068864_100238934 3300005618 Bacteria 1683
89 Ga0068866_10001248 3300005718 Bacteria 10998
90 Ga0068861_100001182 3300005719 Bacteria 16244
91 Ga0068861_100036442 3300005719 Bacteria 3650
92 Ga0068870_10207128 3300005840 Bacteria 1192
93 Ga0068863_100110021 3300005841 Bacteria 2623
94 Ga0068858_100004503 3300005842 Bacteria 13656
95 Ga0068858_100035691 3300005842 Bacteria 4610
96 Ga0068860_100007804 3300005843 Bacteria 10687
97 Ga0068860_100119847 3300005843 Bacteria 2519
98 Ga0068862_100002385 3300005844 Bacteria 16701
99 Ga0068862_100304511 3300005844 Bacteria 1467
100 Ga0081455_10074256 3300005937 Bacteria 2809
101 Ga0075365_10001404 3300006038 Bacteria 10867
102 Ga0075365_10001656 3300006038 Bacteria 10289
103 Ga0075365_10162358 3300006038 Bacteria 1557
104 Ga0075365_10177609 3300006038 Bacteria 1488
105 Ga0075365_10181976 3300006038 Bacteria 1470
106 Ga0075368_10025750 3300006042 Bacteria 2258
107 Ga0075363_100000528 3300006048 Bacteria 12321
108 Ga0075363_100002295 3300006048 Bacteria 7765
109 Ga0075363_100019712 3300006048 Bacteria 3375
110 Ga0075363_100022711 3300006048 Bacteria 3174
111 Ga0075363_100026711 3300006048 Bacteria 2955
112 Ga0075363_100057006 3300006048 Bacteria 2096
113 Ga0075363_100138472 3300006048 Bacteria 1369
114 Ga0075363_100170455 3300006048 Bacteria 1235
115 Ga0075363_100208246 3300006048 Bacteria 1119
116 Ga0075363_100230221 3300006048 Bacteria 1064
117 Ga0075363_100346898 3300006048 Bacteria 867
118 Ga0075364_10003584 3300006051 Bacteria 8844
119 Ga0075364_10006680 3300006051 Bacteria 6802
120 Ga0075364_10016704 3300006051 Bacteria 4570
121 Ga0075364_10033992 3300006051 Bacteria 3286
122 Ga0075364_10039576 3300006051 Bacteria 3057
123 Ga0075364_10051271 3300006051 Bacteria 2695
124 Ga0075364_10145514 3300006051 Bacteria 1595
125 Ga0075364_10212749 3300006051 Bacteria 1311
126 Ga0075364_10623462 3300006051 Bacteria 737
127 Ga0075432_10159998 3300006058 Bacteria 870
128 Ga0070715_10047062 3300006163 Bacteria 1837
129 Ga0070715_10053401 3300006163 Bacteria 1746
130 Ga0070716_100172200 3300006173 Bacteria 1414
131 Ga0070716_100275305 3300006173 Bacteria 1159
132 Ga0070712_100024544 3300006175 Bacteria 3997
133 Ga0070712_100034107 3300006175 Bacteria 3448
134 Ga0070712_100106547 3300006175 Bacteria 2084
135 Ga0075362_10023589 3300006177 Bacteria 2604
136 Ga0075369_10004979 3300006186 Bacteria 4944
137 Ga0075369_10007779 3300006186 Bacteria 4099
138 Ga0075369_10030887 3300006186 Bacteria 2258
139 Ga0075369_10034737 3300006186 Bacteria 2141
140 Ga0075369_10086658 3300006186 Bacteria 1394
141 Ga0075369_10113716 3300006186 Bacteria 1221
142 Ga0075369_10198649 3300006186 Bacteria 925
143 Ga0075370_10000928 3300006353 Bacteria 12046
144 Ga0075370_10000946 3300006353 Bacteria 11939
145 Ga0068871_100070058 3300006358 Bacteria 2881
146 Ga0068871_100580115 3300006358 Bacteria 1018
147 Ga0068871_100582620 3300006358 Bacteria 1016
148 Ga0075428_100011360 3300006844 Bacteria 9905
149 Ga0075428_100031686 3300006844 Bacteria 5841
150 Ga0075428_100235892 3300006844 Bacteria 1974
151 Ga0075430_100023311 3300006846 Bacteria 5268
152 Ga0075431_100016978 3300006847 Bacteria 7391
153 Ga0075433_10350761 3300006852 Bacteria 1304
154 Ga0075434_100579063 3300006871 Bacteria 1142
155 Ga0068865_100007228 3300006881 Bacteria 6822
156 Ga0097620_100010462 3300006931 Bacteria 9334
157 Ga0097620_100034998 3300006931 Bacteria 5038
158 Ga0105250_10097730 3300009092 Bacteria 1197
159 Ga0105245_10409746 3300009098 Bacteria 1356
160 Ga0105247_10000696 3300009101 Bacteria 26401
161 Ga0105247_10149543 3300009101 Bacteria 1537
162 Ga0105247_10296127 3300009101 Bacteria 1121
163 Ga0114129_10033716 3300009147 Bacteria 7234
164 Ga0105243_10001347 3300009148 Bacteria 21882
165 Ga0105243_10269622 3300009148 Bacteria 1528
166 Ga0105243_10912621 3300009148 Bacteria 874
167 Ga0105241_11178347 3300009174 Bacteria 725
168 Ga0105242_10000373 3300009176 Bacteria 35638
169 Ga0105248_10089509 3300009177 Bacteria 3465
170 Ga0105248_10269084 3300009177 Bacteria 1919
171 Ga0105237_10020467 3300009545 Bacteria 6817
172 Ga0105238_10078302 3300009551 Bacteria 3296
173 Ga0105238_10488889 3300009551 Bacteria 1231
174 Ga0105249_10006603 3300009553 Bacteria 10094
175 Ga0105249_10220707 3300009553 Bacteria 1865
176 Ga0105239_10008769 3300010375 Bacteria 11446
177 Ga0105239_10096094 3300010375 Bacteria 3273
178 Ga0105239_10695419 3300010375 Bacteria 1162
179 Ga0105246_10007843 3300011119 Bacteria 6549
180 Ga0157369_10773088 3300013105 Bacteria 987
181 Ga0157374_10020348 3300013296 Bacteria 5885
182 Ga0157374_10065616 3300013296 Bacteria 3409
183 Ga0157378_10066297 3300013297 Bacteria 3234
184 Ga0163162_10818949 3300013306 Bacteria 1048
185 Ga0163162_11352105 3300013306 Bacteria 810
186 Ga0157372_10964752 3300013307 Bacteria 988
187 Ga0157375_10000487 3300013308 Bacteria 35984
188 Ga0157375_10955786 3300013308 Bacteria 998
189 Ga0163163_10139290 3300014325 Bacteria 2468
190 Ga0157380_10051096 3300014326 Bacteria 3267
191 Ga0157380_10156909 3300014326 Bacteria 1973
192 Ga0157377_10119431 3300014745 Bacteria 1596
193 Ga0157379_10309763 3300014968 Bacteria 1440
194 Ga0157379_10415886 3300014968 Bacteria 1238
195 Ga0157376_10089132 3300014969 Bacteria 2667
196 Ga0163161_10010096 3300017792 Bacteria 6536
197 Ga0209051_1006046 3300025303 Bacteria 6909
198 Ga0209051_1006545 3300025303 Bacteria 6543
199 Ga0209051_1009117 3300025303 Bacteria 5152
200 Ga0209051_1021329 3300025303 Bacteria 2762
201 Ga0207692_10008331 3300025898 Bacteria 4288
202 Ga0207642_10005470 3300025899 Bacteria 4150
203 Ga0207710_10003466 3300025900 Bacteria 7030
204 Ga0207710_10028653 3300025900 Bacteria 2418
205 Ga0207688_10000196 3300025901 Bacteria 26802
206 Ga0207688_10000812 3300025901 Bacteria 15629
207 Ga0207688_10339309 3300025901 Bacteria 924
208 Ga0207680_10023241 3300025903 Bacteria 3382
209 Ga0207685_10016680 3300025905 Bacteria 2356
210 Ga0207699_10035689 3300025906 Bacteria 2830
211 Ga0207645_10034538 3300025907 Bacteria 3249
212 Ga0207643_10209222 3300025908 Bacteria 1190
213 Ga0207643_10258313 3300025908 Bacteria 1075
214 Ga0207654_10433855 3300025911 Bacteria 919
215 Ga0207671_10013232 3300025914 Bacteria 6582
216 Ga0207693_10003120 3300025915 Bacteria 14266
217 Ga0207663_10002207 3300025916 Bacteria 9315
218 Ga0207663_10081394 3300025916 Bacteria 2120
219 Ga0207660_10278200 3300025917 Bacteria 1327
220 Ga0207662_10103638 3300025918 Bacteria 1766
221 Ga0207657_10240701 3300025919 Bacteria 1445
222 Ga0207694_10047808 3300025924 Bacteria 3309
223 Ga0207650_10686539 3300025925 Bacteria 864
224 Ga0207659_10849331 3300025926 Bacteria 785
225 Ga0207687_10007315 3300025927 Bacteria 7280
226 Ga0207687_10015998 3300025927 Bacteria 4922
227 Ga0207664_10048896 3300025929 Bacteria 3328
228 Ga0207644_10008041 3300025931 Bacteria 6900
229 Ga0207690_10299531 3300025932 Bacteria 1258
230 Ga0207706_10008091 3300025933 Bacteria 9703
231 Ga0207686_10003015 3300025934 Bacteria 9073
232 Ga0207709_10018939 3300025935 Bacteria 3862
233 Ga0207709_10178725 3300025935 Bacteria 1496
234 Ga0207670_10382409 3300025936 Bacteria 1121
235 Ga0207669_10007912 3300025937 Bacteria 4956
236 Ga0207704_10139519 3300025938 Bacteria 1693
237 Ga0207704_10378809 3300025938 Bacteria 1110
238 Ga0207665_10000947 3300025939 Bacteria 19623
239 Ga0207665_10007843 3300025939 Bacteria 7049
240 Ga0207665_10230787 3300025939 Bacteria 1360
241 Ga0207691_10064701 3300025940 Bacteria 3312
242 Ga0207711_10032772 3300025941 Bacteria 4394
243 Ga0207711_10220286 3300025941 Bacteria 1735
244 Ga0207689_10179094 3300025942 Bacteria 1748
245 Ga0207689_10561696 3300025942 Bacteria 959
246 Ga0207679_10519819 3300025945 Bacteria 1064
247 Ga0207667_10208878 3300025949 Bacteria 2001
248 Ga0207667_10285679 3300025949 Bacteria 1686
249 Ga0207651_10610444 3300025960 Bacteria 954
250 Ga0207712_10017458 3300025961 Bacteria 4661
251 Ga0207712_10288836 3300025961 Bacteria 1341
252 Ga0207668_10003114 3300025972 Bacteria 9715
253 Ga0207668_10089569 3300025972 Bacteria 2256
254 Ga0207668_10152778 3300025972 Bacteria 1789
255 Ga0207640_10006283 3300025981 Bacteria 6516
256 Ga0207658_10002843 3300025986 Bacteria 12401
257 Ga0207658_10111653 3300025986 Bacteria 2162
258 Ga0207677_10196391 3300026023 Bacteria 1600
259 Ga0207703_10005766 3300026035 Bacteria 9926
260 Ga0207703_10044428 3300026035 Bacteria 3570
261 Ga0207703_10714709 3300026035 Bacteria 953
262 Ga0207678_10007937 3300026067 Bacteria 9359
263 Ga0207678_10014090 3300026067 Bacteria 7030
264 Ga0207678_10051233 3300026067 Bacteria 3564
265 Ga0207678_10472995 3300026067 Bacteria 1091
266 Ga0207708_10001599 3300026075 Bacteria 16873
267 Ga0207708_10149454 3300026075 Bacteria 1838
268 Ga0207702_10153542 3300026078 Bacteria 2096
269 Ga0207641_10657073 3300026088 Bacteria 1030
270 Ga0207648_10000671 3300026089 Bacteria 38354
271 Ga0207648_10011295 3300026089 Bacteria 8420
272 Ga0207676_10243280 3300026095 Bacteria 1615
273 Ga0207675_100000388 3300026118 Bacteria 42128
274 Ga0207683_10000929 3300026121 Bacteria 26957
275 Ga0207683_10030001 3300026121 Bacteria 4711
276 Ga0207698_10609513 3300026142 Bacteria 1077
277 Ga0207698_10933724 3300026142 Bacteria 876
278 Ga0268266_10048271 3300028379 Bacteria 3649
279 Ga0268265_10082329 3300028380 Bacteria 2545
280 Ga0268265_10323097 3300028380 Bacteria 1398
281 Ga0268264_10011464 3300028381 Bacteria 7319
282 Ga0307410_10272504 3300031852 Bacteria 1324
283 Ga0307406_10203026 3300031901 Bacteria 1461
284 Ga0307409_100050913 3300031995 Bacteria 3166
285 Ga0307416_100175431 3300032002 Bacteria 2001
286 Ga0307411_10129510 3300032005 Bacteria 1842
287 Ga0307411_10348150 3300032005 Bacteria 1207
288 Ga0307415_100238119 3300032126 Bacteria 1470
289 Ga0373930_0058976 3300034816 Bacteria 853
290 Ga0373931_0021088 3300035691 Bacteria 3267
291 Ga0436363_0266274 3300039450 Bacteria 1383
292 Ga0439461_0004008 3300041410 Bacteria 2445
293 Ga0439466_0004840 3300041411 Bacteria 5178
294 Ga0439466_0005712 3300041411 Bacteria 4743
295 Ga0439465_0008890 3300041413 Bacteria 3164
296 Ga0439465_0028603 3300041413 Bacteria 1768
297 Ga0451804_0528103 3300041463 Bacteria 866
298 Ga0451841_0624356 3300041498 Bacteria 1744
299 Ga0439431_0005501 3300041997 Bacteria 2797
300 Ga0439431_0021035 3300041997 Bacteria 1564
301 Ga0439434_0010065 3300042435 Bacteria 2785
302 Ga0439435_0100182 3300042436 Bacteria 889
303 Ga0466972_0013868 3300044658 Bacteria 4045
304 Ga0466965_0003293 3300044683 Bacteria 7065
305 Ga0466961_0012982 3300044693 Bacteria 5329
306 Ga0466963_0464896 3300044694 Bacteria 893
307 Ga0466964_0115929 3300044706 Bacteria 1201
308 Ga0466971_0038114 3300044719 Bacteria 2156
309 Ga0466968_0152817 3300044735 Bacteria 1062
310 Ga0466970_0024869 3300044765 Bacteria 3132
311 Ga0466957_0092029 3300044842 Bacteria 1901
312 Ga0466960_0048418 3300044901 Bacteria 2043
313 Ga0466959_0120423 3300045049 Bacteria 1866
314 Ga0466958_0001373 3300045836 Bacteria 11504
315 Ga0466967_0424127 3300045976 Bacteria 1297
316 Ga0466967_0430596 3300045976 Bacteria 1287
317 Ga0495638_0000539 3300046460 Bacteria 43648
318 Ga0495583_0043332 3300046506 Bacteria 2096
319 Ga0495620_0201249 3300046515 Bacteria 766
320 Ga0495648_0022548 3300046524 Bacteria 4332
321 Ga0495642_0101480 3300046528 Bacteria 1225
322 Ga0495649_0336709 3300046694 Bacteria 764
323 Ga0495672_0003901 3300047320 Bacteria 12514
324 Ga0495672_0137278 3300047320 Bacteria 1281
325 Ga0495672_0171024 3300047320 Bacteria 1108
326 Ga0495673_0009217 3300047469 Bacteria 5479
327 Ga0495686_0018212 3300047472 Bacteria 4718
328 Ga0495626_0178980 3300048091 Bacteria 880
329 Ga0496100_0002061 3300048903 Bacteria 10094
330 Ga0496100_0006232 3300048903 Bacteria 6491
331 Ga0496100_0018598 3300048903 Bacteria 4124
332 Ga0496100_0386965 3300048903 Bacteria 1063
333 Ga0496101_0000014 3300048904 Bacteria 253487
334 Ga0496101_0000555 3300048904 Bacteria 22845
335 Ga0496101_0002508 3300048904 Bacteria 11282
336 Ga0496101_0011320 3300048904 Bacteria 5916
337 Ga0496101_0200058 3300048904 Bacteria 1544
338 Ga0496102_0002067 3300048905 Bacteria 17286
339 Ga0496102_0041274 3300048905 Bacteria 4176
340 Ga0496102_0053859 3300048905 Bacteria 3667
341 Ga0496102_0160462 3300048905 Bacteria 2115
342 Ga0496102_0215925 3300048905 Bacteria 1808
343 Ga0496102_0268946 3300048905 Bacteria 1607
344 Ga0496102_0364613 3300048905 Bacteria 1360
345 Ga0496103_0000058 3300048906 Bacteria 141099
346 Ga0496103_0000584 3300048906 Bacteria 28834
347 Ga0496103_0063251 3300048906 Bacteria 2305
348 Ga0496103_0103610 3300048906 Bacteria 1803
349 Ga0496103_0262119 3300048906 Bacteria 1112
350 Ga0496104_0075763 3300048907 Bacteria 3204
351 Ga0496104_0101390 3300048907 Bacteria 2756
352 Ga0496104_0113594 3300048907 Bacteria 2597
353 Ga0496104_0276563 3300048907 Bacteria 1592
354 Ga0496105_0071072 3300048908 Bacteria 2877
355 Ga0496105_0300616 3300048908 Bacteria 1290
356 Ga0496106_0000264 3300048909 Bacteria 36882
357 Ga0496106_0001017 3300048909 Bacteria 20568
358 Ga0496106_0014135 3300048909 Bacteria 5897
359 Ga0496106_0095308 3300048909 Bacteria 2302
360 Ga0496106_0452390 3300048909 Bacteria 1031
361 Ga0496107_0000889 3300048910 Bacteria 17584
362 Ga0496107_0085858 3300048910 Bacteria 2296
363 Ga0496107_0335424 3300048910 Bacteria 1125
364 Ga0496107_0824384 3300048910 Bacteria 678
365 Ga0496108_0000246 3300048911 Bacteria 48269
366 Ga0496108_0076463 3300048911 Bacteria 2830
367 Ga0496108_0867641 3300048911 Bacteria 776
368 Ga0496109_0001841 3300048912 Bacteria 17583
369 Ga0496110_0035980 3300048913 Bacteria 4299
370 Ga0496111_0014805 3300048914 Bacteria 5340
371 Ga0496112_0071335 3300048915 Bacteria 3433
372 Ga0496112_0233096 3300048915 Bacteria 1795
373 Ga0496114_0006442 3300048917 Bacteria 9243
374 Ga0496114_0007547 3300048917 Bacteria 8603
375 Ga0496115_0028186 3300048918 Bacteria 4400
376 Ga0496115_0073847 3300048918 Bacteria 2769
377 Ga0496115_0302891 3300048918 Bacteria 1309
378 Ga0496116_0002964 3300048919 Bacteria 17272
379 Ga0496117_0003771 3300048920 Bacteria 17335
380 Ga0496118_0004222 3300048921 Bacteria 17249
381 Ga0496119_0034019 3300048922 Bacteria 3366
382 Ga0496119_0181702 3300048922 Bacteria 1102
383 Ga0496120_0027199 3300048923 Bacteria 3523
384 Ga0496120_0030946 3300048923 Bacteria 3246
385 Ga0496121_0000611 3300048924 Bacteria 66753
386 Ga0496122_0157550 3300048925 Bacteria 1390
387 Ga0496123_0016901 3300048926 Bacteria 5896
388 Ga0496126_0001187 3300048929 Bacteria 42635
389 Ga0496126_0017540 3300048929 Bacteria 7130
390 Ga0501034_0320483 3300049571 Bacteria 1483
391 Ga0501070_0188717 3300049586 Bacteria 1695
392 Ga0501074_0329020 3300049590 Bacteria 1085
393 Ga0501249_000180 3300049679 Bacteria 19312
394 Ga0501204_001149 3300049850 Bacteria 2525
395 nmdc:mga03683_18410_c1 3300050489 Bacteria 2655
396 nmdc:mga03n38_107516_c1 3300050490 Bacteria 1354
397 nmdc:mga03n38_222634_c1 3300050490 Bacteria 986
398 nmdc:mga03n38_229918_c1 3300050490 Bacteria 972
399 nmdc:mga03n38_5819_c1 3300050490 Bacteria 4235
400 nmdc:mga03n38_68341_c1 3300050490 Bacteria 1638
401 nmdc:mga00v17_11658_c1 3300050491 Bacteria 4834
402 nmdc:mga00v17_1270_c1 3300050491 Bacteria 13237
403 nmdc:mga00v17_13405_c1 3300050491 Bacteria 4550
404 nmdc:mga00v17_3933_c1 3300050491 Bacteria 7663
405 nmdc:mga00v17_51117_c1 3300050491 Bacteria 2513
406 nmdc:mga0yw44_10367_c1 3300050492 Bacteria 4757
407 nmdc:mga0yw44_2634_c1 3300050492 Bacteria 7728
408 nmdc:mga06z11_144061_c1 3300050494 Bacteria 1349
409 nmdc:mga06z11_3476_c2 3300050494 Bacteria 2911
410 nmdc:mga04h51_45721_c1 3300050495 Bacteria 1448
411 nmdc:mga07m45_13223_c2 3300050496 Bacteria 1691
412 nmdc:mga07m45_158999_c1 3300050496 Bacteria 1311
413 nmdc:mga07m45_20457_c1 3300050496 Bacteria 3594
414 nmdc:mga07m45_346318_c1 3300050496 Bacteria 863
415 nmdc:mga05p37_227602_c1 3300050507 Bacteria 2248
416 nmdc:mga0qj67_133318_c1 3300050509 Bacteria 2012
417 nmdc:mga0qj67_19413_c1 3300050509 Bacteria 5192
418 nmdc:mga0sz30_1579_c1 3300050516 Bacteria 8115
419 nmdc:mga0sz30_175948_c1 3300050516 Bacteria 949
420 nmdc:mga0sz30_23414_c1 3300050516 Bacteria 2512
421 nmdc:mga0sz30_45822_c1 3300050516 Bacteria 1845
422 nmdc:mga0sz30_53987_c1 3300050516 Bacteria 1708
423 nmdc:mga0sz30_7467_c1 3300050516 Bacteria 3674
424 nmdc:mga0sz30_82248_c1 3300050516 Bacteria 1394
425 nmdc:mga0sz30_82468_c1 3300050516 Bacteria 1392
426 Ga0500610_0032033 3300053079 Bacteria 2675
427 Ga0495655_0003729 3300053083 Bacteria 2542
428 Ga0500643_002135 3300053087 Bacteria 10479
429 Ga0500652_000343 3300053131 Bacteria 16733
430 Ga0500616_0006405 3300053153 Bacteria 7715
431 Ga0466962_0014986 3300061719 Bacteria 3736
432 2644487195 2643221687 Bacteria 6500351
433 2644638823 2643221715 Bacteria 6671032
434 2753037211 2751185725 Bacteria 5740550
435 2753325080 2751185792 Bacteria 5739090
436 2902794549 2902792274 Bacteria 7270173
437 2902802505 2902799365 Bacteria 5419524
438 2902813958 2902810491 Bacteria 6794147
439 2902839277 2902837492 Bacteria 6697721
440 2939586959 2939582691 Bacteria 7088898
441 Ga0209051_1014198
442 JGI24743J22301_10000505
443 JGI24744J21845_10000823
444 JGI24744J21845_10007377
445 JGI24034J26672_10027377
446 Ga0055540_1000221
447 Ga0055540_1004248
448 Ga0070676_10085721
449 Ga0070676_10220632
450 Ga0070670_100589562
451 Ga0068869_100050577
452 Ga0068869_100122676
453 Ga0068869_100389929
454 Ga0070666_10010240
455 Ga0070666_10021248
456 Ga0070680_100276538
457 Ga0070682_100016248
458 Ga0070682_100050184
459 Ga0070682_100130933
460 Ga0068868_100079229
461 Ga0070689_100029726
462 Ga0070691_10085883
463 Ga0070687_100083264
464 Ga0070692_10150096
465 Ga0070668_100000385
466 Ga0070668_100002937
467 Ga0070668_100051410
468 Ga0070668_100500874
469 Ga0070669_100324167
470 Ga0070675_100621326
471 Ga0070671_100029743
472 Ga0070674_100001147
473 Ga0070674_100297588
474 Ga0070673_100426830
475 Ga0070688_100019754
476 Ga0070688_100139460
477 Ga0070667_100061907
478 Ga0070667_100110974
479 Ga0070667_100131255
480 Ga0070667_100387950
481 Ga0070703_10016666
482 Ga0070709_10004515
483 Ga0070709_10296312
484 Ga0070714_100096991
485 Ga0070714_100223104
486 Ga0070714_101085147
487 Ga0070710_10018698
488 Ga0070701_10001192
489 Ga0070711_100000197
490 Ga0070711_100002333
491 Ga0070711_100998865
492 Ga0070705_100681729
493 Ga0070700_100001650
494 Ga0070700_100142815
495 Ga0070694_100385054
496 Ga0070663_100032886
497 Ga0070663_100053849
498 Ga0070663_100055026
499 Ga0070678_100009133
500 Ga0070678_100064313
501 Ga0070662_100021245
502 Ga0068867_100021210
503 Ga0070685_10018277
504 Ga0070685_10173574
505 Ga0070697_100260711
506 Ga0068853_100010887
507 Ga0070672_100358646
508 Ga0070686_100146100
509 Ga0070686_100837212
510 Ga0070696_100010743
511 Ga0070696_100022080
512 Ga0070693_100020309
513 Ga0070693_100058681
514 Ga0070665_100007477
515 Ga0070665_100011098
516 Ga0070665_100115112
517 Ga0070704_100470698
518 Ga0068855_100639649
519 Ga0068857_100679899
520 Ga0068854_100003036
521 Ga0068854_100245555
522 Ga0068856_100292123
523 Ga0070702_100000458
524 Ga0070702_100035392
525 Ga0068852_100080297
526 Ga0068859_100010462
527 Ga0068859_100035000
528 Ga0068864_100238934
529 Ga0068866_10001248
530 Ga0068861_100001182
531 Ga0068861_100036442
532 Ga0068870_10207128
533 Ga0068863_100110021
534 Ga0068858_100004503
535 Ga0068858_100035691
536 Ga0068860_100007804
537 Ga0068860_100119847
538 Ga0068862_100002385
539 Ga0068862_100304511
540 Ga0081455_10074256
541 Ga0075365_10001404
542 Ga0075365_10001656
543 Ga0075365_10162358
544 Ga0075365_10177609
545 Ga0075365_10181976
546 Ga0075368_10025750
547 Ga0075363_100000528
548 Ga0075363_100002295
549 Ga0075363_100019712
550 Ga0075363_100022711
551 Ga0075363_100026711
552 Ga0075363_100057006
553 Ga0075363_100138472
554 Ga0075363_100170455
555 Ga0075363_100208246
556 Ga0075363_100230221
557 Ga0075363_100346898
558 Ga0075364_10003584
559 Ga0075364_10006680
560 Ga0075364_10016704
561 Ga0075364_10033992
562 Ga0075364_10039576
563 Ga0075364_10051271
564 Ga0075364_10145514
565 Ga0075364_10212749
566 Ga0075364_10623462
567 Ga0075432_10159998
568 Ga0070715_10047062
569 Ga0070715_10053401
570 Ga0070716_100172200
571 Ga0070716_100275305
572 Ga0070712_100024544
573 Ga0070712_100034107
574 Ga0070712_100106547
575 Ga0075362_10023589
576 Ga0075369_10004979
577 Ga0075369_10007779
578 Ga0075369_10030887
579 Ga0075369_10034737
580 Ga0075369_10086658
581 Ga0075369_10113716
582 Ga0075369_10198649
583 Ga0075370_10000928
584 Ga0075370_10000946
585 Ga0068871_100070058
586 Ga0068871_100580115
587 Ga0068871_100582620
588 Ga0075428_100011360
589 Ga0075428_100031686
590 Ga0075428_100235892
591 Ga0075430_100023311
592 Ga0075431_100016978
593 Ga0075433_10350761
594 Ga0075434_100579063
595 Ga0068865_100007228
596 Ga0097620_100010462
597 Ga0097620_100034998
598 Ga0105250_10097730
599 Ga0105245_10409746
600 Ga0105247_10000696
601 Ga0105247_10149543
602 Ga0105247_10296127
603 Ga0114129_10033716
604 Ga0105243_10001347
605 Ga0105243_10269622
606 Ga0105243_10912621
607 Ga0105241_11178347
608 Ga0105242_10000373
609 Ga0105248_10089509
610 Ga0105248_10269084
611 Ga0105237_10020467
612 Ga0105238_10078302
613 Ga0105238_10488889
614 Ga0105249_10006603
615 Ga0105249_10220707
616 Ga0105239_10008769
617 Ga0105239_10096094
618 Ga0105239_10695419
619 Ga0105246_10007843
620 Ga0157369_10773088
621 Ga0157374_10020348
622 Ga0157374_10065616
623 Ga0157378_10066297
624 Ga0163162_10818949
625 Ga0163162_11352105
626 Ga0157372_10964752
627 Ga0157375_10000487
628 Ga0157375_10955786
629 Ga0163163_10139290
630 Ga0157380_10051096
631 Ga0157380_10156909
632 Ga0157377_10119431
633 Ga0157379_10309763
634 Ga0157379_10415886
635 Ga0157376_10089132
636 Ga0163161_10010096
637 Ga0209051_1006046
638 Ga0209051_1006545
639 Ga0209051_1009117
640 Ga0209051_1021329
641 Ga0207692_10008331
642 Ga0207642_10005470
643 Ga0207710_10003466
644 Ga0207710_10028653
645 Ga0207688_10000196
646 Ga0207688_10000812
647 Ga0207688_10339309
648 Ga0207680_10023241
649 Ga0207685_10016680
650 Ga0207699_10035689
651 Ga0207645_10034538
652 Ga0207643_10209222
653 Ga0207643_10258313
654 Ga0207654_10433855
655 Ga0207671_10013232
656 Ga0207693_10003120
657 Ga0207663_10002207
658 Ga0207663_10081394
659 Ga0207660_10278200
660 Ga0207662_10103638
661 Ga0207657_10240701
662 Ga0207694_10047808
663 Ga0207650_10686539
664 Ga0207659_10849331
665 Ga0207687_10007315
666 Ga0207687_10015998
667 Ga0207664_10048896
668 Ga0207644_10008041
669 Ga0207690_10299531
670 Ga0207706_10008091
671 Ga0207686_10003015
672 Ga0207709_10018939
673 Ga0207709_10178725
674 Ga0207670_10382409
675 Ga0207669_10007912
676 Ga0207704_10139519
677 Ga0207704_10378809
678 Ga0207665_10000947
679 Ga0207665_10007843
680 Ga0207665_10230787
681 Ga0207691_10064701
682 Ga0207711_10032772
683 Ga0207711_10220286
684 Ga0207689_10179094
685 Ga0207689_10561696
686 Ga0207679_10519819
687 Ga0207667_10208878
688 Ga0207667_10285679
689 Ga0207651_10610444
690 Ga0207712_10017458
691 Ga0207712_10288836
692 Ga0207668_10003114
693 Ga0207668_10089569
694 Ga0207668_10152778
695 Ga0207640_10006283
696 Ga0207658_10002843
697 Ga0207658_10111653
698 Ga0207677_10196391
699 Ga0207703_10005766
700 Ga0207703_10044428
701 Ga0207703_10714709
702 Ga0207678_10007937
703 Ga0207678_10014090
704 Ga0207678_10051233
705 Ga0207678_10472995
706 Ga0207708_10001599
707 Ga0207708_10149454
708 Ga0207702_10153542
709 Ga0207641_10657073
710 Ga0207648_10000671
711 Ga0207648_10011295
712 Ga0207676_10243280
713 Ga0207675_100000388
714 Ga0207683_10000929
715 Ga0207683_10030001
716 Ga0207698_10609513
717 Ga0207698_10933724
718 Ga0268266_10048271
719 Ga0268265_10082329
720 Ga0268265_10323097
721 Ga0268264_10011464
722 Ga0307410_10272504
723 Ga0307406_10203026
724 Ga0307409_100050913
725 Ga0307416_100175431
726 Ga0307411_10129510
727 Ga0307411_10348150
728 Ga0307415_100238119
729 Ga0373930_0058976
730 Ga0373931_0021088
731 Ga0436363_0266274
732 Ga0439461_0004008
733 Ga0439466_0004840
734 Ga0439466_0005712
735 Ga0439465_0008890
736 Ga0439465_0028603
737 Ga0451804_0528103
738 Ga0451841_0624356
739 Ga0439431_0005501
740 Ga0439431_0021035
741 Ga0439434_0010065
742 Ga0439435_0100182
743 Ga0466972_0013868
744 Ga0466965_0003293
745 Ga0466961_0012982
746 Ga0466963_0464896
747 Ga0466964_0115929
748 Ga0466971_0038114
749 Ga0466968_0152817
750 Ga0466970_0024869
751 Ga0466957_0092029
752 Ga0466960_0048418
753 Ga0466959_0120423
754 Ga0466958_0001373
755 Ga0466967_0424127
756 Ga0466967_0430596
757 Ga0495638_0000539
758 Ga0495583_0043332
759 Ga0495620_0201249
760 Ga0495648_0022548
761 Ga0495642_0101480
762 Ga0495649_0336709
763 Ga0495672_0003901
764 Ga0495672_0137278
765 Ga0495672_0171024
766 Ga0495673_0009217
767 Ga0495686_0018212
768 Ga0495626_0178980
769 Ga0496100_0002061
770 Ga0496100_0006232
771 Ga0496100_0018598
772 Ga0496100_0386965
773 Ga0496101_0000014
774 Ga0496101_0000555
775 Ga0496101_0002508
776 Ga0496101_0011320
777 Ga0496101_0200058
778 Ga0496102_0002067
779 Ga0496102_0041274
780 Ga0496102_0053859
781 Ga0496102_0160462
782 Ga0496102_0215925
783 Ga0496102_0268946
784 Ga0496102_0364613
785 Ga0496103_0000058
786 Ga0496103_0000584
787 Ga0496103_0063251
788 Ga0496103_0103610
789 Ga0496103_0262119
790 Ga0496104_0075763
791 Ga0496104_0101390
792 Ga0496104_0113594
793 Ga0496104_0276563
794 Ga0496105_0071072
795 Ga0496105_0300616
796 Ga0496106_0000264
797 Ga0496106_0001017
798 Ga0496106_0014135
799 Ga0496106_0095308
800 Ga0496106_0452390
801 Ga0496107_0000889
802 Ga0496107_0085858
803 Ga0496107_0335424
804 Ga0496107_0824384
805 Ga0496108_0000246
806 Ga0496108_0076463
807 Ga0496108_0867641
808 Ga0496109_0001841
809 Ga0496110_0035980
810 Ga0496111_0014805
811 Ga0496112_0071335
812 Ga0496112_0233096
813 Ga0496114_0006442
814 Ga0496114_0007547
815 Ga0496115_0028186
816 Ga0496115_0073847
817 Ga0496115_0302891
818 Ga0496116_0002964
819 Ga0496117_0003771
820 Ga0496118_0004222
821 Ga0496119_0034019
822 Ga0496119_0181702
823 Ga0496120_0027199
824 Ga0496120_0030946
825 Ga0496121_0000611
826 Ga0496122_0157550
827 Ga0496123_0016901
828 Ga0496126_0001187
829 Ga0496126_0017540
830 Ga0501034_0320483
831 Ga0501070_0188717
832 Ga0501074_0329020
833 Ga0501249_000180
834 Ga0501204_001149
835 nmdc:mga03683_18410_c1
836 nmdc:mga03n38_107516_c1
837 nmdc:mga03n38_222634_c1
838 nmdc:mga03n38_229918_c1
839 nmdc:mga03n38_5819_c1
840 nmdc:mga03n38_68341_c1
841 nmdc:mga00v17_11658_c1
842 nmdc:mga00v17_1270_c1
843 nmdc:mga00v17_13405_c1
844 nmdc:mga00v17_3933_c1
845 nmdc:mga00v17_51117_c1
846 nmdc:mga0yw44_10367_c1
847 nmdc:mga0yw44_2634_c1
848 nmdc:mga06z11_144061_c1
849 nmdc:mga06z11_3476_c2
850 nmdc:mga04h51_45721_c1
851 nmdc:mga07m45_13223_c2
852 nmdc:mga07m45_158999_c1
853 nmdc:mga07m45_20457_c1
854 nmdc:mga07m45_346318_c1
855 nmdc:mga05p37_227602_c1
856 nmdc:mga0qj67_133318_c1
857 nmdc:mga0qj67_19413_c1
858 nmdc:mga0sz30_1579_c1
859 nmdc:mga0sz30_175948_c1
860 nmdc:mga0sz30_23414_c1
861 nmdc:mga0sz30_45822_c1
862 nmdc:mga0sz30_53987_c1
863 nmdc:mga0sz30_7467_c1
864 nmdc:mga0sz30_82248_c1
865 nmdc:mga0sz30_82468_c1
866 Ga0500610_0032033
867 Ga0495655_0003729
868 Ga0500643_002135
869 Ga0500652_000343
870 Ga0500616_0006405
871 Ga0466962_0014986
872 2644487195
873 2644638823
874 2753037211
875 2753325080
876 2902794549
877 2902802505
878 2902813958
879 2902839277
880 2939586959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

58

152

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.7944 32 151
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7919 32 152
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7802 32 152
2htd-assembly1.cif.gz_A crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution 0.7795 29 150
2q9k-assembly1.cif.gz_A-2 crystal structure of a putative oxidoreductase (exig_1997) from exiguobacterium sibiricum 255-15 at 1.59 a resolution 0.7684 27 150
ID Description Score Start End Superfamily
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7705 29 150 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7628 32 151 2.30.110.10
2q9kA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7586 27 150 2.30.110.10
4hmtB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7554 40 130 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.755 32 149 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A258JPW9-F1-model_v4 Phosphohydrolase 0.9367 4 148 GO:0016787
AF-A0A3N1DEE5-F1-model_v4 deleted 0.9361 6 163
AF-A0A7L4TJ18-F1-model_v4 Phosphohydrolase 0.9347 4 160 GO:0016787
AF-A0A1H4N5T4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.934 2 168
AF-A0A7W1ZYX1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9334 6 161

Map