F444424

General Info

Members Datasets Scaffolds Average Seq Length
440 244 880 328

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10373992|Ga0157375_103739922
Length 353
Sequence MSTTPAAASGTRRTPTERPDELDRTDPARHVAESAEAFRNWGRWGEDDRLGTLNFIGDAERARAATLVRRGASFSLSQPFDMNGPQQGWRRRTNPVHTMLDTGTDAAAGTQGFPHGIGGADDVVAMPLQCSTQWDGLGHIFDRGMAWNGRPAGSVVTSDGDLVTGIEHAASAIVGRGVLLDLGRFLRPEPTDDDADNGAVGELPDGYAITTAELEACISAQGATSAVGRGDLVLVRTGRYARALREGWNGYAGGPSAGLSFTTAGWLHRTEIAAIATDTWGFEVRPNEFDVPAFQPLHQVVIPNLGLTIGEMWDLDELGDVCAQTRRYHFFLSAPPLPITGAVGSPINPVAIL

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
220 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 2643221575 Microbacterium sp. Root61 Isolate Unclassified
227 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
228 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
229 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
230 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
231 2808606372 Agromyces sp. 23-23 Isolate Unclassified
232 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
233 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
234 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
235 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
236 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
237 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
238 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
239 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
240 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
241 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
242 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
243 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
244 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 0
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.59
Nodule 0
Rhizoplane 9.32
Rhizosphere 66.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10373992 3300013308 Bacteria 1591
2 JGI24746J21847_1002490 3300001977 Bacteria 2934
3 JGI24744J21845_10002573 3300002077 Bacteria 3704
4 JGI24744J21845_10003112 3300002077 Bacteria 3401
5 JGI24034J26672_10013465 3300002239 Bacteria 1241
6 Ga0065714_10081064 3300005288 Bacteria 2399
7 Ga0068869_100015510 3300005334 Bacteria 5114
8 Ga0068869_100069444 3300005334 Bacteria 2605
9 Ga0070682_100081387 3300005337 Bacteria 2096
10 Ga0068868_100052337 3300005338 Bacteria 3214
11 Ga0068868_100306585 3300005338 Bacteria 1350
12 Ga0070691_10099316 3300005341 Bacteria 1444
13 Ga0070668_100000415 3300005347 Bacteria 28362
14 Ga0070668_100003680 3300005347 Bacteria 11320
15 Ga0070668_100096244 3300005347 Bacteria 2340
16 Ga0070668_100125449 3300005347 Bacteria 2056
17 Ga0070668_100139978 3300005347 Bacteria 1949
18 Ga0070668_100335727 3300005347 Bacteria 1276
19 Ga0070669_100001239 3300005353 Bacteria 18500
20 Ga0070669_100067660 3300005353 Bacteria 2635
21 Ga0070675_100098553 3300005354 Bacteria 2459
22 Ga0070674_100130564 3300005356 Bacteria 1872
23 Ga0070673_100377686 3300005364 Bacteria 1263
24 Ga0070688_100062020 3300005365 Bacteria 2366
25 Ga0070667_100000679 3300005367 Bacteria 32958
26 Ga0070667_100006205 3300005367 Bacteria 9944
27 Ga0070667_100054985 3300005367 Bacteria 3361
28 Ga0070667_100084903 3300005367 Bacteria 2714
29 Ga0070709_10012970 3300005434 Bacteria 4675
30 Ga0070714_100037059 3300005435 Bacteria 4096
31 Ga0070714_100132080 3300005435 Bacteria 2232
32 Ga0070714_100200052 3300005435 Bacteria 1827
33 Ga0070710_10006167 3300005437 Bacteria 5737
34 Ga0070701_10000802 3300005438 Bacteria 11224
35 Ga0070711_100002361 3300005439 Bacteria 10733
36 Ga0070663_100041173 3300005455 Bacteria 3238
37 Ga0070663_100223296 3300005455 Bacteria 1480
38 Ga0070678_100002715 3300005456 Bacteria 9767
39 Ga0070678_100062580 3300005456 Bacteria 2748
40 Ga0070662_100011550 3300005457 Bacteria 5827
41 Ga0068867_100003221 3300005459 Bacteria 11509
42 Ga0068867_100036364 3300005459 Bacteria 3575
43 Ga0070672_100090876 3300005543 Bacteria 2463
44 Ga0070695_100022325 3300005545 Bacteria 3882
45 Ga0070696_100066499 3300005546 Bacteria 2528
46 Ga0070693_100034349 3300005547 Bacteria 2806
47 Ga0070665_100001757 3300005548 Bacteria 24788
48 Ga0070665_100008312 3300005548 Bacteria 10498
49 Ga0070665_100063964 3300005548 Bacteria 3689
50 Ga0070665_100087058 3300005548 Bacteria 3129
51 Ga0070704_100000443 3300005549 Bacteria 19456
52 Ga0068855_100104991 3300005563 Bacteria 3249
53 Ga0068854_100000515 3300005578 Bacteria 23453
54 Ga0070702_100023924 3300005615 Bacteria 3252
55 Ga0068852_100157896 3300005616 Bacteria 2115
56 Ga0068859_100000276 3300005617 Bacteria 51118
57 Ga0068859_100025626 3300005617 Bacteria 5915
58 Ga0068859_100085108 3300005617 Bacteria 3207
59 Ga0068866_10000609 3300005718 Bacteria 16358
60 Ga0068861_100000307 3300005719 Bacteria 27379
61 Ga0068861_100145257 3300005719 Bacteria 1941
62 Ga0068861_100196838 3300005719 Bacteria 1689
63 Ga0068863_100000768 3300005841 Bacteria 32211
64 Ga0068863_100000835 3300005841 Bacteria 30885
65 Ga0068863_100020245 3300005841 Bacteria 6364
66 Ga0068863_100029468 3300005841 Bacteria 5239
67 Ga0068863_100110335 3300005841 Bacteria 2620
68 Ga0068858_100000440 3300005842 Bacteria 43437
69 Ga0068858_100008729 3300005842 Bacteria 9731
70 Ga0068860_100000232 3300005843 Bacteria 85501
71 Ga0068860_100009056 3300005843 Bacteria 9907
72 Ga0068860_100025102 3300005843 Bacteria 5751
73 Ga0068862_100000055 3300005844 Bacteria 142386
74 Ga0068862_100027936 3300005844 Bacteria 4751
75 Ga0068862_100045415 3300005844 Bacteria 3749
76 Ga0081538_10113529 3300005981 Bacteria 1323
77 Ga0075365_10005734 3300006038 Bacteria 6738
78 Ga0075365_10025315 3300006038 Bacteria 3755
79 Ga0075365_10036037 3300006038 Bacteria 3204
80 Ga0075365_10094529 3300006038 Bacteria 2040
81 Ga0075368_10018698 3300006042 Bacteria 2607
82 Ga0075363_100006782 3300006048 Bacteria 5229
83 Ga0075363_100013376 3300006048 Bacteria 3975
84 Ga0075363_100017787 3300006048 Bacteria 3531
85 Ga0075363_100020887 3300006048 Bacteria 3290
86 Ga0075363_100024049 3300006048 Bacteria 3094
87 Ga0075363_100092846 3300006048 Bacteria 1663
88 Ga0075363_100106996 3300006048 Bacteria 1552
89 Ga0075364_10000391 3300006051 Bacteria 21816
90 Ga0075364_10001597 3300006051 Bacteria 12392
91 Ga0075364_10014676 3300006051 Bacteria 4846
92 Ga0075364_10015074 3300006051 Bacteria 4786
93 Ga0075364_10015374 3300006051 Bacteria 4745
94 Ga0075364_10021521 3300006051 Bacteria 4065
95 Ga0070712_100001270 3300006175 Bacteria 15233
96 Ga0070712_100009279 3300006175 Bacteria 6198
97 Ga0075362_10009407 3300006177 Bacteria 3780
98 Ga0075362_10070177 3300006177 Bacteria 1599
99 Ga0075367_10015394 3300006178 Bacteria 4156
100 Ga0075367_10189036 3300006178 Bacteria 1285
101 Ga0075367_10244339 3300006178 Bacteria 1125
102 Ga0075369_10050875 3300006186 Bacteria 1793
103 Ga0075366_10085130 3300006195 Bacteria 1891
104 Ga0097621_100258425 3300006237 Bacteria 1527
105 Ga0075370_10000744 3300006353 Bacteria 13002
106 Ga0075370_10001636 3300006353 Bacteria 9880
107 Ga0075370_10010380 3300006353 Bacteria 4869
108 Ga0075370_10010428 3300006353 Bacteria 4859
109 Ga0068871_100216498 3300006358 Bacteria 1658
110 Ga0075430_100032892 3300006846 Bacteria 4401
111 Ga0075431_100145936 3300006847 Bacteria 2438
112 Ga0068865_100046063 3300006881 Bacteria 2991
113 Ga0097620_100000276 3300006931 Bacteria 51118
114 Ga0097620_100025628 3300006931 Bacteria 5915
115 Ga0097620_100085106 3300006931 Bacteria 3207
116 Ga0105244_10000295 3300009036 Bacteria 48840
117 Ga0105245_10010633 3300009098 Bacteria 8007
118 Ga0105245_10031418 3300009098 Bacteria 4699
119 Ga0105247_10000029 3300009101 Bacteria 198763
120 Ga0114129_10644922 3300009147 Bacteria 1367
121 Ga0105243_10005029 3300009148 Bacteria 10371
122 Ga0105243_10009400 3300009148 Bacteria 7450
123 Ga0105243_10059113 3300009148 Bacteria 3058
124 Ga0105242_10003225 3300009176 Bacteria 12717
125 Ga0105248_10000136 3300009177 Bacteria 85507
126 Ga0105248_10014990 3300009177 Bacteria 8533
127 Ga0105248_10023798 3300009177 Bacteria 6808
128 Ga0105248_10094825 3300009177 Bacteria 3360
129 Ga0105249_10000077 3300009553 Bacteria 141905
130 Ga0105249_10024146 3300009553 Bacteria 5462
131 Ga0105249_10104263 3300009553 Bacteria 2672
132 Ga0105249_10339393 3300009553 Bacteria 1519
133 Ga0105239_10005314 3300010375 Bacteria 15120
134 Ga0105239_10167154 3300010375 Bacteria 2460
135 Ga0105246_10137790 3300011119 Bacteria 1831
136 Ga0157369_10127271 3300013105 Bacteria 2700
137 Ga0157378_10005026 3300013297 Bacteria 11608
138 Ga0163162_10010099 3300013306 Bacteria 9178
139 Ga0163162_10040972 3300013306 Bacteria 4633
140 Ga0163162_10087660 3300013306 Bacteria 3191
141 Ga0163162_10252945 3300013306 Bacteria 1893
142 Ga0163162_10298634 3300013306 Bacteria 1742
143 Ga0157372_10000875 3300013307 Bacteria 32716
144 Ga0157375_10010499 3300013308 Bacteria 8153
145 Ga0157375_10030659 3300013308 Bacteria 5073
146 Ga0163163_10006703 3300014325 Bacteria 10092
147 Ga0163163_10163826 3300014325 Bacteria 2269
148 Ga0157380_10023769 3300014326 Bacteria 4628
149 Ga0182008_10116848 3300014497 Bacteria 1324
150 Ga0157379_10208952 3300014968 Bacteria 1766
151 Ga0157376_10048523 3300014969 Bacteria 3511
152 Ga0163161_10001293 3300017792 Bacteria 18669
153 Ga0163161_10108683 3300017792 Bacteria 2071
154 Ga0163161_10357989 3300017792 Bacteria 1162
155 Ga0213876_10069535 3300021384 Bacteria 1860
156 Ga0209672_100011 3300025228 Bacteria 856297
157 Ga0209147_100675 3300025229 Bacteria 17592
158 Ga0209148_1000132 3300025254 Bacteria 171529
159 Ga0209455_1000122 3300025272 Bacteria 170954
160 Ga0207655_1000526 3300025728 Bacteria 48861
161 Ga0207692_10065706 3300025898 Bacteria 1893
162 Ga0207642_10003076 3300025899 Bacteria 5227
163 Ga0207642_10028214 3300025899 Bacteria 2308
164 Ga0207642_10163134 3300025899 Bacteria 1199
165 Ga0207710_10000046 3300025900 Bacteria 198754
166 Ga0207710_10003445 3300025900 Bacteria 7053
167 Ga0207710_10079113 3300025900 Bacteria 1522
168 Ga0207688_10000623 3300025901 Bacteria 17410
169 Ga0207688_10000910 3300025901 Bacteria 14940
170 Ga0207647_10048853 3300025904 Bacteria 2626
171 Ga0207699_10036450 3300025906 Bacteria 2804
172 Ga0207699_10102458 3300025906 Bacteria 1819
173 Ga0207693_10000614 3300025915 Bacteria 31922
174 Ga0207663_10002572 3300025916 Bacteria 8730
175 Ga0207681_10000341 3300025923 Bacteria 33602
176 Ga0207694_10354272 3300025924 Bacteria 1215
177 Ga0207650_10128705 3300025925 Bacteria 1979
178 Ga0207659_10035327 3300025926 Bacteria 3454
179 Ga0207687_10001777 3300025927 Bacteria 14824
180 Ga0207687_10011562 3300025927 Bacteria 5770
181 Ga0207644_10414353 3300025931 Bacteria 1103
182 Ga0207706_10001079 3300025933 Bacteria 27701
183 Ga0207686_10004045 3300025934 Bacteria 7870
184 Ga0207709_10002916 3300025935 Bacteria 10440
185 Ga0207709_10045476 3300025935 Bacteria 2659
186 Ga0207669_10000085 3300025937 Bacteria 47505
187 Ga0207669_10047229 3300025937 Bacteria 2549
188 Ga0207669_10056817 3300025937 Bacteria 2379
189 Ga0207704_10006243 3300025938 Bacteria 5541
190 Ga0207665_10012387 3300025939 Bacteria 5602
191 Ga0207665_10029462 3300025939 Bacteria 3628
192 Ga0207711_10000111 3300025941 Bacteria 85466
193 Ga0207711_10091812 3300025941 Bacteria 2671
194 Ga0207711_10097372 3300025941 Bacteria 2597
195 Ga0207689_10036744 3300025942 Bacteria 4065
196 Ga0207689_10264308 3300025942 Bacteria 1424
197 Ga0207712_10000017 3300025961 Bacteria 337943
198 Ga0207712_10212965 3300025961 Bacteria 1540
199 Ga0207712_10321587 3300025961 Bacteria 1277
200 Ga0207668_10065680 3300025972 Bacteria 2569
201 Ga0207668_10242181 3300025972 Bacteria 1460
202 Ga0207640_10010787 3300025981 Bacteria 5156
203 Ga0207658_10000612 3300025986 Bacteria 31708
204 Ga0207658_10027811 3300025986 Bacteria 3977
205 Ga0207658_10103610 3300025986 Bacteria 2234
206 Ga0207677_10065449 3300026023 Bacteria 2536
207 Ga0207677_10212655 3300026023 Bacteria 1545
208 Ga0207703_10002482 3300026035 Bacteria 15994
209 Ga0207703_10072731 3300026035 Bacteria 2843
210 Ga0207703_10165955 3300026035 Bacteria 1938
211 Ga0207639_10149045 3300026041 Bacteria 1957
212 Ga0207678_10044033 3300026067 Bacteria 3862
213 Ga0207708_10000329 3300026075 Bacteria 37329
214 Ga0207641_10000378 3300026088 Bacteria 53027
215 Ga0207641_10010420 3300026088 Bacteria 7639
216 Ga0207641_10019974 3300026088 Bacteria 5499
217 Ga0207641_10034558 3300026088 Bacteria 4206
218 Ga0207648_10000112 3300026089 Bacteria 78746
219 Ga0207648_10166049 3300026089 Bacteria 1951
220 Ga0207675_100000117 3300026118 Bacteria 64829
221 Ga0207675_100046569 3300026118 Bacteria 4052
222 Ga0207675_100085380 3300026118 Bacteria 2962
223 Ga0207683_10000451 3300026121 Bacteria 38077
224 Ga0207683_10232737 3300026121 Bacteria 1680
225 Ga0268266_10001547 3300028379 Bacteria 26936
226 Ga0268266_10019511 3300028379 Bacteria 5777
227 Ga0268266_10222589 3300028379 Bacteria 1735
228 Ga0268266_10272934 3300028379 Bacteria 1570
229 Ga0268265_10000067 3300028380 Bacteria 142389
230 Ga0268265_10019465 3300028380 Bacteria 4719
231 Ga0268265_10031249 3300028380 Bacteria 3844
232 Ga0268264_10000146 3300028381 Bacteria 165733
233 Ga0268264_10008289 3300028381 Bacteria 8635
234 Ga0268264_10263709 3300028381 Bacteria 1606
235 Ga0307405_10089587 3300031731 Bacteria 2033
236 Ga0307413_10076278 3300031824 Bacteria 2130
237 Ga0307413_10315439 3300031824 Bacteria 1192
238 Ga0307410_10168927 3300031852 Bacteria 1646
239 Ga0307410_10210417 3300031852 Bacteria 1490
240 Ga0307406_10027007 3300031901 Bacteria 3454
241 Ga0307406_10087310 3300031901 Bacteria 2090
242 Ga0307412_10327681 3300031911 Bacteria 1221
243 Ga0307409_100060920 3300031995 Bacteria 2946
244 Ga0307411_10259174 3300032005 Bacteria 1372
245 Ga0307415_100192116 3300032126 Bacteria 1612
246 Ga0373931_0025686 3300035691 Bacteria 2992
247 Ga0316584_0040394 3300036712 Bacteria 3475
248 Ga0395898_0304093 3300037466 Bacteria 1521
249 Ga0436364_0370259 3300037853 Bacteria 2780
250 Ga0436364_1272522 3300037853 Bacteria 142026
251 Ga0436365_0957112 3300039437 Bacteria 4970
252 Ga0436365_1737435 3300039437 Bacteria 6167
253 Ga0436365_1935781 3300039437 Bacteria 4460
254 Ga0436363_0716906 3300039450 Bacteria 1900
255 Ga0439461_0004719 3300041410 Bacteria 2290
256 Ga0439466_0014050 3300041411 Bacteria 2922
257 Ga0439465_0002060 3300041413 Bacteria 6590
258 Ga0439465_0062623 3300041413 Bacteria 1234
259 Ga0451841_0596037 3300041498 Bacteria 1152
260 Ga0439431_0002571 3300041997 Bacteria 4007
261 Ga0439431_0003398 3300041997 Bacteria 3504
262 Ga0439431_0013996 3300041997 Bacteria 1856
263 Ga0439445_0012670 3300042004 Bacteria 2030
264 Ga0439449_0002073 3300042007 Bacteria 7886
265 Ga0439434_0006002 3300042435 Bacteria 3545
266 Ga0439434_0008882 3300042435 Bacteria 2952
267 Ga0466969_0043786 3300044656 Bacteria 2229
268 Ga0466969_0049308 3300044656 Bacteria 2078
269 Ga0466972_0017376 3300044658 Bacteria 3601
270 Ga0466972_0030024 3300044658 Bacteria 2676
271 Ga0466972_0049154 3300044658 Bacteria 2037
272 Ga0466965_0050907 3300044683 Bacteria 2054
273 Ga0466966_0000885 3300044684 Bacteria 19103
274 Ga0466966_0004648 3300044684 Bacteria 9043
275 Ga0466966_0022227 3300044684 Bacteria 4164
276 Ga0466961_0000876 3300044693 Bacteria 18697
277 Ga0466961_0097068 3300044693 Bacteria 1858
278 Ga0466963_0005101 3300044694 Bacteria 7672
279 Ga0466964_0000712 3300044706 Bacteria 10755
280 Ga0466971_0000938 3300044719 Bacteria 11979
281 Ga0466968_0001343 3300044735 Bacteria 8770
282 Ga0466968_0043633 3300044735 Bacteria 1899
283 Ga0466970_0000909 3300044765 Bacteria 14310
284 Ga0466970_0144171 3300044765 Bacteria 1313
285 Ga0466957_0002992 3300044842 Bacteria 9178
286 Ga0466957_0006134 3300044842 Bacteria 6783
287 Ga0466957_0024254 3300044842 Bacteria 3589
288 Ga0466960_0000447 3300044901 Bacteria 14126
289 Ga0466960_0001027 3300044901 Bacteria 9982
290 Ga0466959_0000921 3300045049 Bacteria 17440
291 Ga0466959_0003579 3300045049 Bacteria 10230
292 Ga0466959_0032455 3300045049 Bacteria 3865
293 Ga0466959_0160773 3300045049 Bacteria 1579
294 Ga0466958_0000144 3300045836 Bacteria 24551
295 Ga0466958_0001254 3300045836 Bacteria 11889
296 Ga0466958_0049201 3300045836 Bacteria 2550
297 Ga0466967_0004058 3300045976 Bacteria 9769
298 Ga0466967_0007332 3300045976 Bacteria 7943
299 Ga0466967_0017251 3300045976 Bacteria 5725
300 Ga0466967_0026988 3300045976 Bacteria 4768
301 Ga0495629_0030780 3300046459 Bacteria 3802
302 Ga0495638_0002021 3300046460 Bacteria 17284
303 Ga0495580_0099511 3300046472 Bacteria 2023
304 Ga0495582_0034087 3300046473 Bacteria 2799
305 Ga0495594_0086105 3300046499 Bacteria 1758
306 Ga0495618_0029537 3300046514 Bacteria 3421
307 Ga0495628_0001491 3300046516 Bacteria 21439
308 Ga0495634_0045386 3300046642 Bacteria 2971
309 Ga0495624_0079336 3300046690 Bacteria 2036
310 Ga0495672_0101390 3300047320 Bacteria 1560
311 Ga0495686_0037954 3300047472 Bacteria 3084
312 Ga0496100_0000395 3300048903 Bacteria 21117
313 Ga0496100_0009529 3300048903 Bacteria 5458
314 Ga0496100_0030130 3300048903 Bacteria 3363
315 Ga0496100_0293424 3300048903 Bacteria 1215
316 Ga0496101_0001579 3300048904 Bacteria 13661
317 Ga0496101_0004109 3300048904 Bacteria 9110
318 Ga0496101_0038834 3300048904 Bacteria 3383
319 Ga0496102_0000268 3300048905 Bacteria 66717
320 Ga0496102_0010611 3300048905 Bacteria 7936
321 Ga0496102_0032601 3300048905 Bacteria 4680
322 Ga0496102_0064615 3300048905 Bacteria 3352
323 Ga0496102_0130211 3300048905 Bacteria 2354
324 Ga0496102_0275987 3300048905 Bacteria 1584
325 Ga0496103_0000237 3300048906 Bacteria 53762
326 Ga0496103_0003795 3300048906 Bacteria 9195
327 Ga0496103_0175141 3300048906 Bacteria 1378
328 Ga0496105_0031605 3300048908 Bacteria 4340
329 Ga0496105_0125688 3300048908 Bacteria 2114
330 Ga0496105_0295269 3300048908 Bacteria 1304
331 Ga0496106_0002405 3300048909 Bacteria 13942
332 Ga0496106_0006699 3300048909 Bacteria 8531
333 Ga0496106_0084182 3300048909 Bacteria 2447
334 Ga0496106_0214460 3300048909 Bacteria 1534
335 Ga0496107_0004395 3300048910 Bacteria 9548
336 Ga0496108_0002116 3300048911 Bacteria 15905
337 Ga0496108_0044032 3300048911 Bacteria 3727
338 Ga0496108_0147461 3300048911 Bacteria 2029
339 Ga0496109_0007462 3300048912 Bacteria 9260
340 Ga0496110_0028720 3300048913 Bacteria 4780
341 Ga0496110_0253029 3300048913 Bacteria 1603
342 Ga0496110_0459846 3300048913 Bacteria 1160
343 Ga0496112_0004365 3300048915 Bacteria 11964
344 Ga0496112_0038710 3300048915 Bacteria 4658
345 Ga0496112_0133336 3300048915 Bacteria 2455
346 Ga0496113_0002563 3300048916 Bacteria 10615
347 Ga0496113_0097022 3300048916 Bacteria 2280
348 Ga0496113_0179922 3300048916 Bacteria 1676
349 Ga0496114_0000629 3300048917 Bacteria 26088
350 Ga0496114_0002083 3300048917 Bacteria 15214
351 Ga0496115_0000824 3300048918 Bacteria 22725
352 Ga0496115_0001294 3300048918 Bacteria 17870
353 Ga0496116_0007423 3300048919 Bacteria 9729
354 Ga0496117_0001548 3300048920 Bacteria 32660
355 Ga0496118_0001284 3300048921 Bacteria 38348
356 Ga0496119_0010884 3300048922 Bacteria 7602
357 Ga0496121_0003814 3300048924 Bacteria 21004
358 Ga0496122_0014952 3300048925 Bacteria 7463
359 Ga0496123_0004488 3300048926 Bacteria 14627
360 Ga0496125_0008684 3300048928 Bacteria 10582
361 Ga0496126_0004792 3300048929 Bacteria 15900
362 Ga0496126_0008009 3300048929 Bacteria 11469
363 Ga0501032_0002313 3300049569 Bacteria 14948
364 Ga0501033_0018634 3300049570 Bacteria 5246
365 Ga0501034_0006673 3300049571 Bacteria 12378
366 Ga0501034_0066271 3300049571 Bacteria 3624
367 Ga0501034_0194650 3300049571 Bacteria 1988
368 Ga0501037_0001502 3300049573 Bacteria 17059
369 Ga0501038_0001711 3300049574 Bacteria 20376
370 Ga0501039_0000526 3300049575 Bacteria 27681
371 Ga0501043_0000633 3300049579 Bacteria 31114
372 Ga0501070_0000448 3300049586 Bacteria 37506
373 Ga0501070_0111388 3300049586 Bacteria 2262
374 Ga0501035_0000753 3300049822 Bacteria 34892
375 Ga0501035_0020975 3300049822 Bacteria 6005
376 Ga0501044_0031803 3300049823 Bacteria 5550
377 nmdc:mga03683_40485_c1 3300050489 Bacteria 1911
378 nmdc:mga03n38_10861_c1 3300050490 Bacteria 3369
379 nmdc:mga03n38_4468_c1 3300050490 Bacteria 4641
380 nmdc:mga03n38_5303_c1 3300050490 Bacteria 4376
381 nmdc:mga03n38_68129_c1 3300050490 Bacteria 1640
382 nmdc:mga03n38_9923_c1 3300050490 Bacteria 3484
383 nmdc:mga00v17_1485_c1 3300050491 Bacteria 12272
384 nmdc:mga00v17_148873_c1 3300050491 Bacteria 1503
385 nmdc:mga00v17_31066_c1 3300050491 Bacteria 3147
386 nmdc:mga00v17_3556_c1 3300050491 Bacteria 8051
387 nmdc:mga00v17_36857_c1 3300050491 Bacteria 2917
388 nmdc:mga00v17_47360_c1 3300050491 Bacteria 2604
389 nmdc:mga00v17_4942_c1 3300050491 Bacteria 6991
390 nmdc:mga00v17_9836_c1 3300050491 Bacteria 5196
391 nmdc:mga0yw44_112976_c1 3300050492 Bacteria 1742
392 nmdc:mga0yw44_24643_c1 3300050492 Bacteria 3408
393 nmdc:mga0yw44_297012_c1 3300050492 Bacteria 1082
394 nmdc:mga0yw44_33988_c1 3300050492 Bacteria 2984
395 nmdc:mga0yw44_39948_c1 3300050492 Bacteria 2784
396 nmdc:mga0yw44_5173_c1 3300050492 Bacteria 6112
397 nmdc:mga06z11_123951_c1 3300050494 Bacteria 1444
398 nmdc:mga06z11_180244_c1 3300050494 Bacteria 1218
399 nmdc:mga06z11_18125_c1 3300050494 Bacteria 3210
400 nmdc:mga07m45_813_c2 3300050496 Bacteria 12202
401 nmdc:mga07m45_8384_c1 3300050496 Bacteria 5312
402 nmdc:mga05p37_374819_c1 3300050507 Bacteria 1669
403 nmdc:mga0qj67_27780_c1 3300050509 Bacteria 4387
404 nmdc:mga06r32_29577_c1 3300050510 Bacteria 2554
405 nmdc:mga0sz30_24898_c1 3300050516 Bacteria 2445
406 nmdc:mga0sz30_385_c1 3300050516 Bacteria 16818
407 Ga0495601_0000697 3300053077 Bacteria 18051
408 Ga0500635_0007142 3300053080 Bacteria 3018
409 Ga0500643_024608 3300053087 Bacteria 1909
410 Ga0500643_033109 3300053087 Bacteria 1564
411 Ga0500556_0012086 3300053104 Bacteria 2570
412 Ga0500569_036683 3300053109 Bacteria 1413
413 Ga0500652_046702 3300053131 Bacteria 1758
414 Ga0500559_0001028 3300053136 Bacteria 17105
415 Ga0500604_0023688 3300053151 Bacteria 1753
416 Ga0500616_0003873 3300053153 Bacteria 11012
417 Ga0500616_0072491 3300053153 Bacteria 1751
418 Ga0500645_000007 3300053730 Bacteria 233700
419 Ga0500645_042795 3300053730 Bacteria 1335
420 Ga0500645_057143 3300053730 Bacteria 1131
421 Ga0466962_0000712 3300061719 Bacteria 14819
422 2643886825 2643221575 Bacteria 4022601
423 2644635930 2643221715 Bacteria 6671032
424 2738705768 2738541274 Bacteria 6909446
425 2739330258 2738543028 Bacteria 6917070
426 2774397747 2773857763 Bacteria 4180068
427 2808903568 2808606372 Bacteria 4649509
428 2808915949 2808606375 Bacteria 9466072
429 2812324955 2811994872 Bacteria 4121241
430 2821271488 2821268502 Bacteria 3750023
431 2870629065 2870628048 Bacteria 3696012
432 2895660331 2895660088 Bacteria 3782833
433 2902800112 2902799365 Bacteria 5419524
434 2902811988 2902810491 Bacteria 6794147
435 2919446689 2919443155 Bacteria 4072969
436 2929216824 2929212328 Bacteria 7708288
437 2946082103 2946080515 Bacteria 4310960
438 2974295694 2974294766 Bacteria 3767688
439 2977264809 2977264416 Bacteria 3750737
440 8016255910 8016254467 Bacteria 3797036
441 Ga0157375_10373992
442 JGI24746J21847_1002490
443 JGI24744J21845_10002573
444 JGI24744J21845_10003112
445 JGI24034J26672_10013465
446 Ga0065714_10081064
447 Ga0068869_100015510
448 Ga0068869_100069444
449 Ga0070682_100081387
450 Ga0068868_100052337
451 Ga0068868_100306585
452 Ga0070691_10099316
453 Ga0070668_100000415
454 Ga0070668_100003680
455 Ga0070668_100096244
456 Ga0070668_100125449
457 Ga0070668_100139978
458 Ga0070668_100335727
459 Ga0070669_100001239
460 Ga0070669_100067660
461 Ga0070675_100098553
462 Ga0070674_100130564
463 Ga0070673_100377686
464 Ga0070688_100062020
465 Ga0070667_100000679
466 Ga0070667_100006205
467 Ga0070667_100054985
468 Ga0070667_100084903
469 Ga0070709_10012970
470 Ga0070714_100037059
471 Ga0070714_100132080
472 Ga0070714_100200052
473 Ga0070710_10006167
474 Ga0070701_10000802
475 Ga0070711_100002361
476 Ga0070663_100041173
477 Ga0070663_100223296
478 Ga0070678_100002715
479 Ga0070678_100062580
480 Ga0070662_100011550
481 Ga0068867_100003221
482 Ga0068867_100036364
483 Ga0070672_100090876
484 Ga0070695_100022325
485 Ga0070696_100066499
486 Ga0070693_100034349
487 Ga0070665_100001757
488 Ga0070665_100008312
489 Ga0070665_100063964
490 Ga0070665_100087058
491 Ga0070704_100000443
492 Ga0068855_100104991
493 Ga0068854_100000515
494 Ga0070702_100023924
495 Ga0068852_100157896
496 Ga0068859_100000276
497 Ga0068859_100025626
498 Ga0068859_100085108
499 Ga0068866_10000609
500 Ga0068861_100000307
501 Ga0068861_100145257
502 Ga0068861_100196838
503 Ga0068863_100000768
504 Ga0068863_100000835
505 Ga0068863_100020245
506 Ga0068863_100029468
507 Ga0068863_100110335
508 Ga0068858_100000440
509 Ga0068858_100008729
510 Ga0068860_100000232
511 Ga0068860_100009056
512 Ga0068860_100025102
513 Ga0068862_100000055
514 Ga0068862_100027936
515 Ga0068862_100045415
516 Ga0081538_10113529
517 Ga0075365_10005734
518 Ga0075365_10025315
519 Ga0075365_10036037
520 Ga0075365_10094529
521 Ga0075368_10018698
522 Ga0075363_100006782
523 Ga0075363_100013376
524 Ga0075363_100017787
525 Ga0075363_100020887
526 Ga0075363_100024049
527 Ga0075363_100092846
528 Ga0075363_100106996
529 Ga0075364_10000391
530 Ga0075364_10001597
531 Ga0075364_10014676
532 Ga0075364_10015074
533 Ga0075364_10015374
534 Ga0075364_10021521
535 Ga0070712_100001270
536 Ga0070712_100009279
537 Ga0075362_10009407
538 Ga0075362_10070177
539 Ga0075367_10015394
540 Ga0075367_10189036
541 Ga0075367_10244339
542 Ga0075369_10050875
543 Ga0075366_10085130
544 Ga0097621_100258425
545 Ga0075370_10000744
546 Ga0075370_10001636
547 Ga0075370_10010380
548 Ga0075370_10010428
549 Ga0068871_100216498
550 Ga0075430_100032892
551 Ga0075431_100145936
552 Ga0068865_100046063
553 Ga0097620_100000276
554 Ga0097620_100025628
555 Ga0097620_100085106
556 Ga0105244_10000295
557 Ga0105245_10010633
558 Ga0105245_10031418
559 Ga0105247_10000029
560 Ga0114129_10644922
561 Ga0105243_10005029
562 Ga0105243_10009400
563 Ga0105243_10059113
564 Ga0105242_10003225
565 Ga0105248_10000136
566 Ga0105248_10014990
567 Ga0105248_10023798
568 Ga0105248_10094825
569 Ga0105249_10000077
570 Ga0105249_10024146
571 Ga0105249_10104263
572 Ga0105249_10339393
573 Ga0105239_10005314
574 Ga0105239_10167154
575 Ga0105246_10137790
576 Ga0157369_10127271
577 Ga0157378_10005026
578 Ga0163162_10010099
579 Ga0163162_10040972
580 Ga0163162_10087660
581 Ga0163162_10252945
582 Ga0163162_10298634
583 Ga0157372_10000875
584 Ga0157375_10010499
585 Ga0157375_10030659
586 Ga0163163_10006703
587 Ga0163163_10163826
588 Ga0157380_10023769
589 Ga0182008_10116848
590 Ga0157379_10208952
591 Ga0157376_10048523
592 Ga0163161_10001293
593 Ga0163161_10108683
594 Ga0163161_10357989
595 Ga0213876_10069535
596 Ga0209672_100011
597 Ga0209147_100675
598 Ga0209148_1000132
599 Ga0209455_1000122
600 Ga0207655_1000526
601 Ga0207692_10065706
602 Ga0207642_10003076
603 Ga0207642_10028214
604 Ga0207642_10163134
605 Ga0207710_10000046
606 Ga0207710_10003445
607 Ga0207710_10079113
608 Ga0207688_10000623
609 Ga0207688_10000910
610 Ga0207647_10048853
611 Ga0207699_10036450
612 Ga0207699_10102458
613 Ga0207693_10000614
614 Ga0207663_10002572
615 Ga0207681_10000341
616 Ga0207694_10354272
617 Ga0207650_10128705
618 Ga0207659_10035327
619 Ga0207687_10001777
620 Ga0207687_10011562
621 Ga0207644_10414353
622 Ga0207706_10001079
623 Ga0207686_10004045
624 Ga0207709_10002916
625 Ga0207709_10045476
626 Ga0207669_10000085
627 Ga0207669_10047229
628 Ga0207669_10056817
629 Ga0207704_10006243
630 Ga0207665_10012387
631 Ga0207665_10029462
632 Ga0207711_10000111
633 Ga0207711_10091812
634 Ga0207711_10097372
635 Ga0207689_10036744
636 Ga0207689_10264308
637 Ga0207712_10000017
638 Ga0207712_10212965
639 Ga0207712_10321587
640 Ga0207668_10065680
641 Ga0207668_10242181
642 Ga0207640_10010787
643 Ga0207658_10000612
644 Ga0207658_10027811
645 Ga0207658_10103610
646 Ga0207677_10065449
647 Ga0207677_10212655
648 Ga0207703_10002482
649 Ga0207703_10072731
650 Ga0207703_10165955
651 Ga0207639_10149045
652 Ga0207678_10044033
653 Ga0207708_10000329
654 Ga0207641_10000378
655 Ga0207641_10010420
656 Ga0207641_10019974
657 Ga0207641_10034558
658 Ga0207648_10000112
659 Ga0207648_10166049
660 Ga0207675_100000117
661 Ga0207675_100046569
662 Ga0207675_100085380
663 Ga0207683_10000451
664 Ga0207683_10232737
665 Ga0268266_10001547
666 Ga0268266_10019511
667 Ga0268266_10222589
668 Ga0268266_10272934
669 Ga0268265_10000067
670 Ga0268265_10019465
671 Ga0268265_10031249
672 Ga0268264_10000146
673 Ga0268264_10008289
674 Ga0268264_10263709
675 Ga0307405_10089587
676 Ga0307413_10076278
677 Ga0307413_10315439
678 Ga0307410_10168927
679 Ga0307410_10210417
680 Ga0307406_10027007
681 Ga0307406_10087310
682 Ga0307412_10327681
683 Ga0307409_100060920
684 Ga0307411_10259174
685 Ga0307415_100192116
686 Ga0373931_0025686
687 Ga0316584_0040394
688 Ga0395898_0304093
689 Ga0436364_0370259
690 Ga0436364_1272522
691 Ga0436365_0957112
692 Ga0436365_1737435
693 Ga0436365_1935781
694 Ga0436363_0716906
695 Ga0439461_0004719
696 Ga0439466_0014050
697 Ga0439465_0002060
698 Ga0439465_0062623
699 Ga0451841_0596037
700 Ga0439431_0002571
701 Ga0439431_0003398
702 Ga0439431_0013996
703 Ga0439445_0012670
704 Ga0439449_0002073
705 Ga0439434_0006002
706 Ga0439434_0008882
707 Ga0466969_0043786
708 Ga0466969_0049308
709 Ga0466972_0017376
710 Ga0466972_0030024
711 Ga0466972_0049154
712 Ga0466965_0050907
713 Ga0466966_0000885
714 Ga0466966_0004648
715 Ga0466966_0022227
716 Ga0466961_0000876
717 Ga0466961_0097068
718 Ga0466963_0005101
719 Ga0466964_0000712
720 Ga0466971_0000938
721 Ga0466968_0001343
722 Ga0466968_0043633
723 Ga0466970_0000909
724 Ga0466970_0144171
725 Ga0466957_0002992
726 Ga0466957_0006134
727 Ga0466957_0024254
728 Ga0466960_0000447
729 Ga0466960_0001027
730 Ga0466959_0000921
731 Ga0466959_0003579
732 Ga0466959_0032455
733 Ga0466959_0160773
734 Ga0466958_0000144
735 Ga0466958_0001254
736 Ga0466958_0049201
737 Ga0466967_0004058
738 Ga0466967_0007332
739 Ga0466967_0017251
740 Ga0466967_0026988
741 Ga0495629_0030780
742 Ga0495638_0002021
743 Ga0495580_0099511
744 Ga0495582_0034087
745 Ga0495594_0086105
746 Ga0495618_0029537
747 Ga0495628_0001491
748 Ga0495634_0045386
749 Ga0495624_0079336
750 Ga0495672_0101390
751 Ga0495686_0037954
752 Ga0496100_0000395
753 Ga0496100_0009529
754 Ga0496100_0030130
755 Ga0496100_0293424
756 Ga0496101_0001579
757 Ga0496101_0004109
758 Ga0496101_0038834
759 Ga0496102_0000268
760 Ga0496102_0010611
761 Ga0496102_0032601
762 Ga0496102_0064615
763 Ga0496102_0130211
764 Ga0496102_0275987
765 Ga0496103_0000237
766 Ga0496103_0003795
767 Ga0496103_0175141
768 Ga0496105_0031605
769 Ga0496105_0125688
770 Ga0496105_0295269
771 Ga0496106_0002405
772 Ga0496106_0006699
773 Ga0496106_0084182
774 Ga0496106_0214460
775 Ga0496107_0004395
776 Ga0496108_0002116
777 Ga0496108_0044032
778 Ga0496108_0147461
779 Ga0496109_0007462
780 Ga0496110_0028720
781 Ga0496110_0253029
782 Ga0496110_0459846
783 Ga0496112_0004365
784 Ga0496112_0038710
785 Ga0496112_0133336
786 Ga0496113_0002563
787 Ga0496113_0097022
788 Ga0496113_0179922
789 Ga0496114_0000629
790 Ga0496114_0002083
791 Ga0496115_0000824
792 Ga0496115_0001294
793 Ga0496116_0007423
794 Ga0496117_0001548
795 Ga0496118_0001284
796 Ga0496119_0010884
797 Ga0496121_0003814
798 Ga0496122_0014952
799 Ga0496123_0004488
800 Ga0496125_0008684
801 Ga0496126_0004792
802 Ga0496126_0008009
803 Ga0501032_0002313
804 Ga0501033_0018634
805 Ga0501034_0006673
806 Ga0501034_0066271
807 Ga0501034_0194650
808 Ga0501037_0001502
809 Ga0501038_0001711
810 Ga0501039_0000526
811 Ga0501043_0000633
812 Ga0501070_0000448
813 Ga0501070_0111388
814 Ga0501035_0000753
815 Ga0501035_0020975
816 Ga0501044_0031803
817 nmdc:mga03683_40485_c1
818 nmdc:mga03n38_10861_c1
819 nmdc:mga03n38_4468_c1
820 nmdc:mga03n38_5303_c1
821 nmdc:mga03n38_68129_c1
822 nmdc:mga03n38_9923_c1
823 nmdc:mga00v17_1485_c1
824 nmdc:mga00v17_148873_c1
825 nmdc:mga00v17_31066_c1
826 nmdc:mga00v17_3556_c1
827 nmdc:mga00v17_36857_c1
828 nmdc:mga00v17_47360_c1
829 nmdc:mga00v17_4942_c1
830 nmdc:mga00v17_9836_c1
831 nmdc:mga0yw44_112976_c1
832 nmdc:mga0yw44_24643_c1
833 nmdc:mga0yw44_297012_c1
834 nmdc:mga0yw44_33988_c1
835 nmdc:mga0yw44_39948_c1
836 nmdc:mga0yw44_5173_c1
837 nmdc:mga06z11_123951_c1
838 nmdc:mga06z11_180244_c1
839 nmdc:mga06z11_18125_c1
840 nmdc:mga07m45_813_c2
841 nmdc:mga07m45_8384_c1
842 nmdc:mga05p37_374819_c1
843 nmdc:mga0qj67_27780_c1
844 nmdc:mga06r32_29577_c1
845 nmdc:mga0sz30_24898_c1
846 nmdc:mga0sz30_385_c1
847 Ga0495601_0000697
848 Ga0500635_0007142
849 Ga0500643_024608
850 Ga0500643_033109
851 Ga0500556_0012086
852 Ga0500569_036683
853 Ga0500652_046702
854 Ga0500559_0001028
855 Ga0500604_0023688
856 Ga0500616_0003873
857 Ga0500616_0072491
858 Ga0500645_000007
859 Ga0500645_042795
860 Ga0500645_057143
861 Ga0466962_0000712
862 2643886825
863 2644635930
864 2738705768
865 2739330258
866 2774397747
867 2808903568
868 2808915949
869 2812324955
870 2821271488
871 2870629065
872 2895660331
873 2902800112
874 2902811988
875 2919446689
876 2929216824
877 2946082103
878 2974295694
879 2977264809
880 8016255910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

74

284

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.7944 14 329
8hmo-assembly3.cif.gz_E crystal structure of metal-dependent hydrolase complexed with manganese from bacillus smithii 0.7928 157 328
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.7893 14 329
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.7883 11 329
1r61-assembly1.cif.gz_A the structure of predicted metal-dependent hydrolase from bacillus stearothermophilus 0.7833 166 327
ID Description Score Start End Superfamily
5nmpC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7881 156 327 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.788 157 328 3.50.30.50
af_C4JAI3_56_274_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7557 150 328 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7481 157 327 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7223 166 327 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A7G1I3H4-F1-model_v4 Cyclase family protein 0.978 177 329 GO:0004061
GO:0019441
AF-X8C715-F1-model_v4 deleted 0.9766 205 329
AF-X8C715-F1-model_v4 deleted 0.969 205 329
AF-A0A7G1I3H4-F1-model_v4 Cyclase family protein 0.9655 177 329 GO:0004061
GO:0019441
AF-X8A381-F1-model_v4 deleted 0.9585 119 329

Map