F444319

General Info

Members Datasets Scaffolds Average Seq Length
439 228 878 129

Family's Representative Sequence

Representative Sequence 3300055283|Ga0500661_000643|Ga0500661_000643_3162_3551
Length 112
Sequence MAVKVIDEAEVEELDLPGRHLRWVITAENAGARYCTMAVIRVAPGQKVFPAHSHPNGEEVIYILSGHGRVLVNGEVALQNLSEVEMKVACFFAPPAGLENYKFFEGVDFPAD

Samples

Sample ID Description Type Environment
1 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 1.82
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 0.23
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 35.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500661_000643 3300055283 Bacteria 6525
2 rootH1_10079190 3300003316 Bacteria 1016
3 rootH2_10315029 3300003320 Unclassified 1255
4 rootL2_10102048 3300003322 Bacteria 9183
5 rootH1_10221777 3300003323 Bacteria 2034
6 Ga0058863_11259383 3300004799 Bacteria 1303
7 Ga0058861_11830008 3300004800 Unclassified 731
8 Ga0058862_12549752 3300004803 Bacteria 1529
9 Ga0065714_10124049 3300005288 Unclassified 1312
10 Ga0065712_10323282 3300005290 Bacteria 825
11 Ga0070658_10005112 3300005327 Bacteria 10679
12 Ga0070658_10006090 3300005327 Bacteria 9784
13 Ga0070658_10085526 3300005327 Bacteria 2594
14 Ga0070658_10179994 3300005327 Unclassified 1779
15 Ga0070658_10204119 3300005327 Bacteria 1668
16 Ga0070658_10255177 3300005327 Bacteria 1488
17 Ga0070676_11301303 3300005328 Unclassified 555
18 Ga0070683_100001730 3300005329 Bacteria 16986
19 Ga0070683_100024039 3300005329 Bacteria 5454
20 Ga0070683_100034840 3300005329 Bacteria 4601
21 Ga0070683_100466522 3300005329 Bacteria 1205
22 Ga0070690_100500586 3300005330 Unclassified 909
23 Ga0070670_100325204 3300005331 Bacteria 1348
24 Ga0068869_100040430 3300005334 Unclassified 3335
25 Ga0070666_10861862 3300005335 Unclassified 669
26 Ga0070666_10959804 3300005335 Unclassified 633
27 Ga0070680_100002280 3300005336 Bacteria 14190
28 Ga0070680_100005542 3300005336 Bacteria 9553
29 Ga0070680_100013904 3300005336 Bacteria 6280
30 Ga0070680_101268838 3300005336 Unclassified 637
31 Ga0070682_100165847 3300005337 Bacteria 1530
32 Ga0070682_100658669 3300005337 Unclassified 834
33 Ga0068868_100924428 3300005338 Unclassified 794
34 Ga0070660_100002510 3300005339 Bacteria 12584
35 Ga0070660_100081862 3300005339 Bacteria 2534
36 Ga0070660_100103290 3300005339 Bacteria 2260
37 Ga0070660_100303189 3300005339 Unclassified 1310
38 Ga0070660_100540794 3300005339 Unclassified 971
39 Ga0070689_100084591 3300005340 Bacteria 2494
40 Ga0070691_10132237 3300005341 Bacteria 1265
41 Ga0070661_100018750 3300005344 Bacteria 4924
42 Ga0070661_100053780 3300005344 Bacteria 2948
43 Ga0070661_100217635 3300005344 Unclassified 1464
44 Ga0070661_100716810 3300005344 Unclassified 816
45 Ga0070692_10086133 3300005345 Bacteria 1700
46 Ga0070675_100027233 3300005354 Bacteria 4591
47 Ga0070675_100162903 3300005354 Bacteria 1919
48 Ga0070675_100457376 3300005354 Bacteria 1145
49 Ga0070673_100108012 3300005364 Unclassified 2303
50 Ga0070673_101900480 3300005364 Unclassified 564
51 Ga0070688_100067236 3300005365 Bacteria 2283
52 Ga0070659_100004116 3300005366 Bacteria 10364
53 Ga0070659_100011432 3300005366 Bacteria 6566
54 Ga0070667_100169846 3300005367 Bacteria 1925
55 Ga0070667_100432472 3300005367 Unclassified 1201
56 Ga0070703_10115495 3300005406 Bacteria 966
57 Ga0070709_10964824 3300005434 Unclassified 677
58 Ga0070714_100129012 3300005435 Bacteria 2258
59 Ga0070714_100353190 3300005435 Bacteria 1381
60 Ga0070713_100110347 3300005436 Bacteria 2398
61 Ga0070710_10735114 3300005437 Unclassified 699
62 Ga0070711_100910897 3300005439 Unclassified 751
63 Ga0070705_100412269 3300005440 Bacteria 1003
64 Ga0070694_100313768 3300005444 Unclassified 1205
65 Ga0070694_100506585 3300005444 Unclassified 961
66 Ga0070663_100012289 3300005455 Bacteria 5410
67 Ga0070663_100041403 3300005455 Bacteria 3230
68 Ga0070663_100178030 3300005455 Bacteria 1648
69 Ga0070663_100531529 3300005455 Unclassified 980
70 Ga0070663_101497968 3300005455 Bacteria 600
71 Ga0070662_101272316 3300005457 Unclassified 633
72 Ga0070681_10002593 3300005458 Bacteria 16578
73 Ga0070681_10008038 3300005458 Bacteria 10329
74 Ga0070681_10054091 3300005458 Bacteria 3999
75 Ga0070681_10134509 3300005458 Bacteria 2403
76 Ga0070685_10023366 3300005466 Bacteria 3385
77 Ga0070707_100028874 3300005468 Bacteria 5279
78 Ga0070698_100559664 3300005471 Unclassified 1083
79 Ga0070679_100007758 3300005530 Bacteria 10049
80 Ga0070679_100008564 3300005530 Bacteria 9637
81 Ga0070679_100034008 3300005530 Bacteria 5050
82 Ga0070679_100035876 3300005530 Bacteria 4920
83 Ga0070679_100738431 3300005530 Unclassified 927
84 Ga0070684_100013782 3300005535 Bacteria 6526
85 Ga0070684_100037801 3300005535 Bacteria 4143
86 Ga0070684_100161114 3300005535 Bacteria 2035
87 Ga0070684_100172090 3300005535 Bacteria 1967
88 Ga0068853_100004802 3300005539 Bacteria 10511
89 Ga0068853_100029149 3300005539 Bacteria 4650
90 Ga0070672_100503271 3300005543 Bacteria 1048
91 Ga0070686_101188314 3300005544 Unclassified 633
92 Ga0070695_100167142 3300005545 Unclassified 1549
93 Ga0070693_100473503 3300005547 Unclassified 883
94 Ga0070665_100009295 3300005548 Bacteria 9949
95 Ga0070665_100136655 3300005548 Unclassified 2454
96 Ga0070665_100250385 3300005548 Bacteria 1772
97 Ga0070665_100623707 3300005548 Unclassified 1091
98 Ga0070704_100010688 3300005549 Bacteria 5591
99 Ga0068855_100002087 3300005563 Bacteria 24749
100 Ga0068855_100011465 3300005563 Bacteria 10711
101 Ga0068855_100022538 3300005563 Bacteria 7547
102 Ga0068855_100077342 3300005563 Bacteria 3861
103 Ga0068855_100501182 3300005563 Unclassified 1319
104 Ga0068855_101157199 3300005563 Unclassified 806
105 Ga0068855_101979168 3300005563 Unclassified 589
106 Ga0068857_100039766 3300005577 Bacteria 4167
107 Ga0068854_100050525 3300005578 Bacteria 2975
108 Ga0068856_100008920 3300005614 Bacteria 9753
109 Ga0068856_100203284 3300005614 Bacteria 1995
110 Ga0068856_100395691 3300005614 Bacteria 1401
111 Ga0068856_100585476 3300005614 Unclassified 1137
112 Ga0068856_100714877 3300005614 Unclassified 1022
113 Ga0068852_100007414 3300005616 Bacteria 8008
114 Ga0068852_100177411 3300005616 Unclassified 2001
115 Ga0068852_101135201 3300005616 Unclassified 802
116 Ga0068852_101396210 3300005616 Unclassified 722
117 Ga0068859_100012488 3300005617 Bacteria 8544
118 Ga0068859_100943440 3300005617 Bacteria 946
119 Ga0068864_100754407 3300005618 Unclassified 954
120 Ga0068861_100612720 3300005719 Unclassified 1001
121 Ga0068861_101676691 3300005719 Unclassified 628
122 Ga0068851_10020723 3300005834 Bacteria 3186
123 Ga0068870_10137048 3300005840 Unclassified 1428
124 Ga0068863_100664649 3300005841 Bacteria 1034
125 Ga0068858_100164858 3300005842 Bacteria 2088
126 Ga0068858_100583565 3300005842 Bacteria 1083
127 Ga0068860_100076138 3300005843 Bacteria 3191
128 Ga0068860_100469010 3300005843 Unclassified 1254
129 Ga0068862_100394157 3300005844 Unclassified 1294
130 Ga0068862_100466179 3300005844 Unclassified 1193
131 Ga0068862_101599855 3300005844 Unclassified 659
132 Ga0081455_10017808 3300005937 Bacteria 6791
133 Ga0081455_10231595 3300005937 Bacteria 1363
134 Ga0081539_10008532 3300005985 Bacteria 8884
135 Ga0070717_10780152 3300006028 Unclassified 869
136 Ga0070717_11590501 3300006028 Unclassified 592
137 Ga0070712_101099316 3300006175 Unclassified 690
138 Ga0097621_100108190 3300006237 Unclassified 2347
139 Ga0097621_100219013 3300006237 Unclassified 1658
140 Ga0097621_100471248 3300006237 Unclassified 1134
141 Ga0068871_100271438 3300006358 Unclassified 1482
142 Ga0068871_100300791 3300006358 Unclassified 1408
143 Ga0068871_100456697 3300006358 Bacteria 1146
144 Ga0068871_100566770 3300006358 Archaea 1030
145 Ga0068871_100586068 3300006358 Bacteria 1013
146 Ga0068871_101411026 3300006358 Unclassified 657
147 Ga0075430_100057186 3300006846 Bacteria 3281
148 Ga0097620_100012485 3300006931 Bacteria 8544
149 Ga0097620_100943652 3300006931 Bacteria 946
150 Ga0105240_10000980 3300009093 Bacteria 50924
151 Ga0105240_10001247 3300009093 Bacteria 44160
152 Ga0105240_10034414 3300009093 Bacteria 6534
153 Ga0105240_10099994 3300009093 Bacteria 3529
154 Ga0105240_10137341 3300009093 Unclassified 2927
155 Ga0105240_10227215 3300009093 Bacteria 2171
156 Ga0105240_10324147 3300009093 Bacteria 1755
157 Ga0105240_11741884 3300009093 Bacteria 650
158 Ga0105240_11816307 3300009093 Unclassified 635
159 Ga0111539_10095708 3300009094 Bacteria 3488
160 Ga0111539_10157509 3300009094 Bacteria 2657
161 Ga0105245_10008440 3300009098 Bacteria 8997
162 Ga0105245_10322204 3300009098 Unclassified 1523
163 Ga0105247_10108169 3300009101 Unclassified 1786
164 Ga0105243_10553473 3300009148 Bacteria 1100
165 Ga0105241_10450813 3300009174 Bacteria 1138
166 Ga0105241_10915567 3300009174 Unclassified 815
167 Ga0105241_11303088 3300009174 Unclassified 692
168 Ga0105241_11407038 3300009174 Unclassified 668
169 Ga0105242_10048819 3300009176 Bacteria 3441
170 Ga0105248_10060329 3300009177 Unclassified 4258
171 Ga0105248_10340071 3300009177 Bacteria 1690
172 Ga0105248_10388541 3300009177 Bacteria 1571
173 Ga0105248_10678383 3300009177 Unclassified 1163
174 Ga0105248_11011632 3300009177 Unclassified 939
175 Ga0105237_10020009 3300009545 Bacteria 6910
176 Ga0105237_10033334 3300009545 Bacteria 5217
177 Ga0105237_10101149 3300009545 Unclassified 2874
178 Ga0105237_10251617 3300009545 Bacteria 1769
179 Ga0105237_11157653 3300009545 Unclassified 780
180 Ga0105238_10007709 3300009551 Bacteria 10762
181 Ga0105238_10010898 3300009551 Bacteria 9138
182 Ga0105238_10030205 3300009551 Bacteria 5514
183 Ga0105238_10096733 3300009551 Bacteria 2938
184 Ga0105238_10123648 3300009551 Bacteria 2567
185 Ga0105249_10015817 3300009553 Bacteria 6685
186 Ga0105249_10883708 3300009553 Bacteria 960
187 Ga0105249_11231763 3300009553 Unclassified 819
188 Ga0105249_12149854 3300009553 Unclassified 631
189 Ga0099796_10349245 3300010159 Unclassified 637
190 Ga0105239_10123006 3300010375 Bacteria 2883
191 Ga0105239_10196709 3300010375 Unclassified 2258
192 Ga0105239_10655296 3300010375 Bacteria 1199
193 Ga0105246_10082970 3300011119 Unclassified 2289
194 Ga0105246_10547219 3300011119 Bacteria 991
195 Ga0157373_10044672 3300013100 Bacteria 3163
196 Ga0157373_10336734 3300013100 Unclassified 1075
197 Ga0157371_10113698 3300013102 Bacteria 1922
198 Ga0157371_10147935 3300013102 Unclassified 1675
199 Ga0157370_10011814 3300013104 Bacteria 9112
200 Ga0157370_10114949 3300013104 Bacteria 2514
201 Ga0157370_10158592 3300013104 Bacteria 2105
202 Ga0157370_10236793 3300013104 Unclassified 1689
203 Ga0157370_10248712 3300013104 Bacteria 1645
204 Ga0157370_10720863 3300013104 Unclassified 909
205 Ga0157370_11644588 3300013104 Unclassified 577
206 Ga0157369_10002857 3300013105 Bacteria 20629
207 Ga0157369_10009230 3300013105 Bacteria 11282
208 Ga0157369_10015633 3300013105 Bacteria 8552
209 Ga0157369_10037037 3300013105 Bacteria 5343
210 Ga0157369_10046556 3300013105 Bacteria 4714
211 Ga0157369_10084483 3300013105 Bacteria 3393
212 Ga0157374_10031778 3300013296 Bacteria 4802
213 Ga0157374_10042843 3300013296 Unclassified 4178
214 Ga0157374_12189276 3300013296 Bacteria 580
215 Ga0157374_12259568 3300013296 Unclassified 571
216 Ga0163162_10261750 3300013306 Bacteria 1861
217 Ga0157372_10001208 3300013307 Bacteria 27938
218 Ga0157372_10006358 3300013307 Bacteria 12564
219 Ga0157372_10012976 3300013307 Bacteria 8888
220 Ga0157372_10027254 3300013307 Bacteria 6220
221 Ga0157372_10206135 3300013307 Unclassified 2278
222 Ga0157372_10600745 3300013307 Unclassified 1282
223 Ga0157372_12534969 3300013307 Unclassified 589
224 Ga0157375_10622030 3300013308 Bacteria 1238
225 Ga0163163_10202512 3300014325 Bacteria 2033
226 Ga0163163_10947279 3300014325 Unclassified 924
227 Ga0157380_12263988 3300014326 Unclassified 608
228 Ga0157377_10026652 3300014745 Bacteria 3095
229 Ga0157379_10133863 3300014968 Unclassified 2233
230 Ga0157379_10158085 3300014968 Unclassified 2045
231 Ga0157379_10256570 3300014968 Unclassified 1588
232 Ga0157379_11608829 3300014968 Unclassified 634
233 Ga0157376_10059431 3300014969 Bacteria 3205
234 Ga0157376_10253602 3300014969 Unclassified 1644
235 Ga0163161_10638229 3300017792 Unclassified 881
236 Ga0206350_10581626 3300020080 Bacteria 1348
237 Ga0206350_11218699 3300020080 Unclassified 710
238 Ga0206353_11615790 3300020082 Bacteria 1159
239 Ga0154015_1376974 3300020610 Unclassified 596
240 Ga0224712_10112367 3300022467 Unclassified 1170
241 Ga0207656_10248482 3300025321 Bacteria 871
242 Ga0207653_10040374 3300025885 Unclassified 1530
243 Ga0207692_10503809 3300025898 Unclassified 769
244 Ga0207642_10917459 3300025899 Unclassified 562
245 Ga0207680_10411369 3300025903 Unclassified 957
246 Ga0207647_10001908 3300025904 Bacteria 15976
247 Ga0207647_10016455 3300025904 Bacteria 5048
248 Ga0207699_11414729 3300025906 Unclassified 514
249 Ga0207645_11120393 3300025907 Unclassified 530
250 Ga0207705_10002004 3300025909 Bacteria 15839
251 Ga0207705_10006212 3300025909 Bacteria 8878
252 Ga0207705_10094825 3300025909 Bacteria 2189
253 Ga0207705_10533630 3300025909 Unclassified 912
254 Ga0207705_10904423 3300025909 Unclassified 684
255 Ga0207684_11383262 3300025910 Unclassified 577
256 Ga0207654_10870090 3300025911 Unclassified 653
257 Ga0207707_10046479 3300025912 Bacteria 3781
258 Ga0207707_10098990 3300025912 Bacteria 2549
259 Ga0207707_10274966 3300025912 Bacteria 1459
260 Ga0207695_10000374 3300025913 Bacteria 101673
261 Ga0207695_10001495 3300025913 Bacteria 38982
262 Ga0207695_10018476 3300025913 Bacteria 8061
263 Ga0207695_10151704 3300025913 Bacteria 2256
264 Ga0207695_10271418 3300025913 Bacteria 1592
265 Ga0207671_10053860 3300025914 Unclassified 2981
266 Ga0207671_10124025 3300025914 Bacteria 1977
267 Ga0207671_10264259 3300025914 Unclassified 1355
268 Ga0207671_10945801 3300025914 Unclassified 680
269 Ga0207660_10018806 3300025917 Bacteria 4611
270 Ga0207660_10212227 3300025917 Bacteria 1516
271 Ga0207660_10408486 3300025917 Bacteria 1094
272 Ga0207657_10008292 3300025919 Bacteria 10571
273 Ga0207657_10014217 3300025919 Bacteria 7783
274 Ga0207657_10217311 3300025919 Bacteria 1533
275 Ga0207649_10042284 3300025920 Bacteria 2779
276 Ga0207649_10091208 3300025920 Bacteria 1995
277 Ga0207649_10301270 3300025920 Bacteria 1172
278 Ga0207649_10358723 3300025920 Bacteria 1081
279 Ga0207649_10786923 3300025920 Bacteria 742
280 Ga0207652_10029125 3300025921 Bacteria 4613
281 Ga0207652_10037168 3300025921 Bacteria 4120
282 Ga0207652_10264870 3300025921 Unclassified 1550
283 Ga0207646_10056281 3300025922 Bacteria 3515
284 Ga0207694_10004828 3300025924 Bacteria 10462
285 Ga0207694_10029413 3300025924 Bacteria 4192
286 Ga0207694_10032231 3300025924 Bacteria 4009
287 Ga0207694_10130915 3300025924 Unclassified 2011
288 Ga0207694_10444570 3300025924 Bacteria 1082
289 Ga0207659_10013368 3300025926 Bacteria 5253
290 Ga0207700_10428673 3300025928 Unclassified 1163
291 Ga0207700_10614492 3300025928 Unclassified 968
292 Ga0207664_10252831 3300025929 Bacteria 1539
293 Ga0207690_10008076 3300025932 Bacteria 6248
294 Ga0207690_10088150 3300025932 Bacteria 2185
295 Ga0207706_10285509 3300025933 Unclassified 1439
296 Ga0207706_10333875 3300025933 Bacteria 1319
297 Ga0207686_10033937 3300025934 Unclassified 3050
298 Ga0207709_10014554 3300025935 Bacteria 4346
299 Ga0207709_10798489 3300025935 Unclassified 762
300 Ga0207670_10794082 3300025936 Unclassified 788
301 Ga0207711_10100743 3300025941 Unclassified 2555
302 Ga0207711_10620488 3300025941 Unclassified 1009
303 Ga0207689_10172796 3300025942 Bacteria 1781
304 Ga0207689_10526630 3300025942 Unclassified 992
305 Ga0207661_10034221 3300025944 Bacteria 3949
306 Ga0207661_10040482 3300025944 Bacteria 3663
307 Ga0207679_10428818 3300025945 Bacteria 1168
308 Ga0207679_10721072 3300025945 Unclassified 906
309 Ga0207667_10000199 3300025949 Bacteria 87200
310 Ga0207667_10002760 3300025949 Bacteria 21722
311 Ga0207667_10016370 3300025949 Bacteria 8382
312 Ga0207667_10054574 3300025949 Unclassified 4202
313 Ga0207667_10101156 3300025949 Bacteria 2973
314 Ga0207667_11387162 3300025949 Unclassified 677
315 Ga0207651_11722349 3300025960 Unclassified 564
316 Ga0207712_10025976 3300025961 Bacteria 3896
317 Ga0207640_10099627 3300025981 Bacteria 2034
318 Ga0207677_10499343 3300026023 Unclassified 1052
319 Ga0207703_10211761 3300026035 Bacteria 1728
320 Ga0207703_11024738 3300026035 Unclassified 792
321 Ga0207639_10012768 3300026041 Bacteria 5860
322 Ga0207639_10340915 3300026041 Bacteria 1336
323 Ga0207678_10000156 3300026067 Bacteria 56308
324 Ga0207678_10014994 3300026067 Bacteria 6818
325 Ga0207678_10763389 3300026067 Unclassified 853
326 Ga0207678_11376689 3300026067 Bacteria 624
327 Ga0207702_10033435 3300026078 Bacteria 4295
328 Ga0207702_10044111 3300026078 Bacteria 3747
329 Ga0207702_10365451 3300026078 Bacteria 1384
330 Ga0207702_10547935 3300026078 Unclassified 1131
331 Ga0207641_10589035 3300026088 Bacteria 1088
332 Ga0207648_10182160 3300026089 Bacteria 1859
333 Ga0207676_10195850 3300026095 Bacteria 1782
334 Ga0207674_10022305 3300026116 Bacteria 6799
335 Ga0207674_10257609 3300026116 Bacteria 1692
336 Ga0207674_11068039 3300026116 Unclassified 777
337 Ga0207675_100072734 3300026118 Bacteria 3216
338 Ga0207698_10006350 3300026142 Bacteria 7366
339 Ga0207698_10013454 3300026142 Bacteria 5399
340 Ga0207698_10030471 3300026142 Unclassified 3880
341 Ga0207698_10222734 3300026142 Bacteria 1706
342 Ga0210002_1026523 3300027617 Unclassified 951
343 Ga0209966_1070620 3300027695 Bacteria 765
344 Ga0207428_10713279 3300027907 Unclassified 717
345 Ga0268266_10001808 3300028379 Bacteria 24206
346 Ga0268266_10007349 3300028379 Bacteria 9952
347 Ga0268265_10553983 3300028380 Bacteria 1092
348 Ga0268265_10631633 3300028380 Unclassified 1027
349 Ga0268264_10107545 3300028381 Bacteria 2437
350 Ga0268264_10205216 3300028381 Unclassified 1806
351 Ga0265318_10002639 3300028577 Bacteria 9459
352 Ga0265330_10001307 3300031235 Bacteria 14553
353 Ga0265325_10000197 3300031241 Bacteria 43020
354 Ga0265329_10063238 3300031242 Bacteria 1171
355 Ga0265329_10102701 3300031242 Bacteria 910
356 Ga0265340_10004601 3300031247 Bacteria 7682
357 Ga0265339_10004009 3300031249 Bacteria 10182
358 Ga0265331_10447708 3300031250 Bacteria 580
359 Ga0265316_10006441 3300031344 Bacteria 11214
360 Ga0265316_10006595 3300031344 Bacteria 11061
361 Ga0265316_10006867 3300031344 Bacteria 10808
362 Ga0265316_10019808 3300031344 Bacteria 5745
363 Ga0265313_10002120 3300031595 Bacteria 17656
364 Ga0265313_10285369 3300031595 Bacteria 666
365 Ga0265342_10003910 3300031712 Bacteria 11967
366 Ga0265342_10137782 3300031712 Unclassified 1363
367 Ga0307416_101090917 3300032002 Unclassified 903
368 Ga0307416_103093224 3300032002 Unclassified 557
369 Ga0316583_10126481 3300032133 Unclassified 891
370 Ga0307510_10025467 3300033180 Bacteria 6821
371 Ga0307510_10273262 3300033180 Bacteria 1165
372 Ga0395900_1190518 3300037418 Unclassified 678
373 Ga0395905_1906294 3300037471 Unclassified 501
374 Ga0436364_0359498 3300037853 Bacteria 2427
375 Ga0436364_0947382 3300037853 Unclassified 1110
376 Ga0436365_0591476 3300039437 Unclassified 2877
377 Ga0436365_0752636 3300039437 Unclassified 906
378 Ga0436365_1529594 3300039437 Bacteria 1646
379 Ga0436360_0902978 3300039438 Unclassified 1426
380 Ga0436363_0247654 3300039450 Bacteria 1816
381 Ga0436362_0284568 3300039453 Bacteria 912
382 Ga0436362_1017616 3300039453 Bacteria 807
383 Ga0450919_011284 3300042121 Bacteria 1017
384 Ga0439435_0078623 3300042436 Unclassified 987
385 Ga0439460_0213014 3300042461 Unclassified 661
386 Ga0450918_047769 3300042531 Bacteria 776
387 Ga0466966_0119393 3300044684 Bacteria 1621
388 Ga0466971_0616382 3300044719 Unclassified 542
389 Ga0466958_0840237 3300045836 Unclassified 599
390 Ga0495650_0000006 3300046471 Bacteria 721347
391 Ga0495650_0009719 3300046471 Bacteria 5449
392 Ga0495594_0427445 3300046499 Bacteria 753
393 Ga0495630_0113399 3300046517 Bacteria 2054
394 Ga0495637_0040392 3300046520 Bacteria 2009
395 Ga0495652_0294609 3300046529 Bacteria 1182
396 Ga0495625_0000156 3300046660 Bacteria 104915
397 Ga0495625_0257554 3300046660 Unclassified 1130
398 Ga0495613_0492314 3300046689 Bacteria 826
399 Ga0495649_0053610 3300046694 Bacteria 2183
400 Ga0495649_0309644 3300046694 Bacteria 803
401 Ga0495674_0072316 3300047319 Bacteria 2974
402 Ga0495687_139928 3300047443 Bacteria 843
403 Ga0495686_0169658 3300047472 Unclassified 1270
404 Ga0496115_0794522 3300048918 Unclassified 737
405 Ga0496120_0387547 3300048923 Unclassified 620
406 Ga0496126_0000010 3300048929 Bacteria 744888
407 Ga0496126_0000560 3300048929 Bacteria 71370
408 Ga0501031_0068158 3300049568 Bacteria 2318
409 Ga0501032_0103347 3300049569 Bacteria 1888
410 Ga0501032_0130892 3300049569 Bacteria 1655
411 Ga0501033_0002991 3300049570 Bacteria 14116
412 Ga0501034_0016554 3300049571 Bacteria 7560
413 Ga0501036_0018154 3300049572 Bacteria 5891
414 Ga0501037_0019154 3300049573 Bacteria 5044
415 Ga0501038_0001587 3300049574 Bacteria 21087
416 Ga0501039_0345992 3300049575 Bacteria 1168
417 Ga0501043_0035702 3300049579 Bacteria 3910
418 Ga0501043_0378368 3300049579 Bacteria 1072
419 Ga0501046_0000121 3300049580 Bacteria 83077
420 Ga0501047_0009555 3300049581 Bacteria 9167
421 Ga0501047_0152196 3300049581 Unclassified 2189
422 Ga0501048_0117934 3300049582 Bacteria 1875
423 Ga0501068_0064690 3300049584 Bacteria 2226
424 Ga0501069_0135746 3300049585 Bacteria 1410
425 Ga0501070_0303578 3300049586 Unclassified 1300
426 Ga0501073_0018580 3300049589 Bacteria 5026
427 Ga0501074_0138074 3300049590 Bacteria 1744
428 Ga0501259_184232 3300049688 Unclassified 530
429 Ga0501080_0126872 3300049742 Bacteria 2363
430 Ga0501035_0012728 3300049822 Bacteria 7774
431 Ga0501035_0131015 3300049822 Bacteria 2186
432 Ga0501044_0053998 3300049823 Bacteria 4131
433 nmdc:mga0qj67_403439_c1 3300050509 Unclassified 1103
434 nmdc:mga08y16_12429_c1 3300050511 Bacteria 8959
435 nmdc:mga08y16_140435_c1 3300050511 Archaea 2511
436 Ga0500643_008811 3300053087 Bacteria 3921
437 Ga0500595_000014 3300053119 Bacteria 247996
438 Ga0501082_1263546 3300060353 Bacteria 645
439 2884218159 2884215851 Bacteria 4554841
440 Ga0500661_000643
441 rootH1_10079190
442 rootH2_10315029
443 rootL2_10102048
444 rootH1_10221777
445 Ga0058863_11259383
446 Ga0058861_11830008
447 Ga0058862_12549752
448 Ga0065714_10124049
449 Ga0065712_10323282
450 Ga0070658_10005112
451 Ga0070658_10006090
452 Ga0070658_10085526
453 Ga0070658_10179994
454 Ga0070658_10204119
455 Ga0070658_10255177
456 Ga0070676_11301303
457 Ga0070683_100001730
458 Ga0070683_100024039
459 Ga0070683_100034840
460 Ga0070683_100466522
461 Ga0070690_100500586
462 Ga0070670_100325204
463 Ga0068869_100040430
464 Ga0070666_10861862
465 Ga0070666_10959804
466 Ga0070680_100002280
467 Ga0070680_100005542
468 Ga0070680_100013904
469 Ga0070680_101268838
470 Ga0070682_100165847
471 Ga0070682_100658669
472 Ga0068868_100924428
473 Ga0070660_100002510
474 Ga0070660_100081862
475 Ga0070660_100103290
476 Ga0070660_100303189
477 Ga0070660_100540794
478 Ga0070689_100084591
479 Ga0070691_10132237
480 Ga0070661_100018750
481 Ga0070661_100053780
482 Ga0070661_100217635
483 Ga0070661_100716810
484 Ga0070692_10086133
485 Ga0070675_100027233
486 Ga0070675_100162903
487 Ga0070675_100457376
488 Ga0070673_100108012
489 Ga0070673_101900480
490 Ga0070688_100067236
491 Ga0070659_100004116
492 Ga0070659_100011432
493 Ga0070667_100169846
494 Ga0070667_100432472
495 Ga0070703_10115495
496 Ga0070709_10964824
497 Ga0070714_100129012
498 Ga0070714_100353190
499 Ga0070713_100110347
500 Ga0070710_10735114
501 Ga0070711_100910897
502 Ga0070705_100412269
503 Ga0070694_100313768
504 Ga0070694_100506585
505 Ga0070663_100012289
506 Ga0070663_100041403
507 Ga0070663_100178030
508 Ga0070663_100531529
509 Ga0070663_101497968
510 Ga0070662_101272316
511 Ga0070681_10002593
512 Ga0070681_10008038
513 Ga0070681_10054091
514 Ga0070681_10134509
515 Ga0070685_10023366
516 Ga0070707_100028874
517 Ga0070698_100559664
518 Ga0070679_100007758
519 Ga0070679_100008564
520 Ga0070679_100034008
521 Ga0070679_100035876
522 Ga0070679_100738431
523 Ga0070684_100013782
524 Ga0070684_100037801
525 Ga0070684_100161114
526 Ga0070684_100172090
527 Ga0068853_100004802
528 Ga0068853_100029149
529 Ga0070672_100503271
530 Ga0070686_101188314
531 Ga0070695_100167142
532 Ga0070693_100473503
533 Ga0070665_100009295
534 Ga0070665_100136655
535 Ga0070665_100250385
536 Ga0070665_100623707
537 Ga0070704_100010688
538 Ga0068855_100002087
539 Ga0068855_100011465
540 Ga0068855_100022538
541 Ga0068855_100077342
542 Ga0068855_100501182
543 Ga0068855_101157199
544 Ga0068855_101979168
545 Ga0068857_100039766
546 Ga0068854_100050525
547 Ga0068856_100008920
548 Ga0068856_100203284
549 Ga0068856_100395691
550 Ga0068856_100585476
551 Ga0068856_100714877
552 Ga0068852_100007414
553 Ga0068852_100177411
554 Ga0068852_101135201
555 Ga0068852_101396210
556 Ga0068859_100012488
557 Ga0068859_100943440
558 Ga0068864_100754407
559 Ga0068861_100612720
560 Ga0068861_101676691
561 Ga0068851_10020723
562 Ga0068870_10137048
563 Ga0068863_100664649
564 Ga0068858_100164858
565 Ga0068858_100583565
566 Ga0068860_100076138
567 Ga0068860_100469010
568 Ga0068862_100394157
569 Ga0068862_100466179
570 Ga0068862_101599855
571 Ga0081455_10017808
572 Ga0081455_10231595
573 Ga0081539_10008532
574 Ga0070717_10780152
575 Ga0070717_11590501
576 Ga0070712_101099316
577 Ga0097621_100108190
578 Ga0097621_100219013
579 Ga0097621_100471248
580 Ga0068871_100271438
581 Ga0068871_100300791
582 Ga0068871_100456697
583 Ga0068871_100566770
584 Ga0068871_100586068
585 Ga0068871_101411026
586 Ga0075430_100057186
587 Ga0097620_100012485
588 Ga0097620_100943652
589 Ga0105240_10000980
590 Ga0105240_10001247
591 Ga0105240_10034414
592 Ga0105240_10099994
593 Ga0105240_10137341
594 Ga0105240_10227215
595 Ga0105240_10324147
596 Ga0105240_11741884
597 Ga0105240_11816307
598 Ga0111539_10095708
599 Ga0111539_10157509
600 Ga0105245_10008440
601 Ga0105245_10322204
602 Ga0105247_10108169
603 Ga0105243_10553473
604 Ga0105241_10450813
605 Ga0105241_10915567
606 Ga0105241_11303088
607 Ga0105241_11407038
608 Ga0105242_10048819
609 Ga0105248_10060329
610 Ga0105248_10340071
611 Ga0105248_10388541
612 Ga0105248_10678383
613 Ga0105248_11011632
614 Ga0105237_10020009
615 Ga0105237_10033334
616 Ga0105237_10101149
617 Ga0105237_10251617
618 Ga0105237_11157653
619 Ga0105238_10007709
620 Ga0105238_10010898
621 Ga0105238_10030205
622 Ga0105238_10096733
623 Ga0105238_10123648
624 Ga0105249_10015817
625 Ga0105249_10883708
626 Ga0105249_11231763
627 Ga0105249_12149854
628 Ga0099796_10349245
629 Ga0105239_10123006
630 Ga0105239_10196709
631 Ga0105239_10655296
632 Ga0105246_10082970
633 Ga0105246_10547219
634 Ga0157373_10044672
635 Ga0157373_10336734
636 Ga0157371_10113698
637 Ga0157371_10147935
638 Ga0157370_10011814
639 Ga0157370_10114949
640 Ga0157370_10158592
641 Ga0157370_10236793
642 Ga0157370_10248712
643 Ga0157370_10720863
644 Ga0157370_11644588
645 Ga0157369_10002857
646 Ga0157369_10009230
647 Ga0157369_10015633
648 Ga0157369_10037037
649 Ga0157369_10046556
650 Ga0157369_10084483
651 Ga0157374_10031778
652 Ga0157374_10042843
653 Ga0157374_12189276
654 Ga0157374_12259568
655 Ga0163162_10261750
656 Ga0157372_10001208
657 Ga0157372_10006358
658 Ga0157372_10012976
659 Ga0157372_10027254
660 Ga0157372_10206135
661 Ga0157372_10600745
662 Ga0157372_12534969
663 Ga0157375_10622030
664 Ga0163163_10202512
665 Ga0163163_10947279
666 Ga0157380_12263988
667 Ga0157377_10026652
668 Ga0157379_10133863
669 Ga0157379_10158085
670 Ga0157379_10256570
671 Ga0157379_11608829
672 Ga0157376_10059431
673 Ga0157376_10253602
674 Ga0163161_10638229
675 Ga0206350_10581626
676 Ga0206350_11218699
677 Ga0206353_11615790
678 Ga0154015_1376974
679 Ga0224712_10112367
680 Ga0207656_10248482
681 Ga0207653_10040374
682 Ga0207692_10503809
683 Ga0207642_10917459
684 Ga0207680_10411369
685 Ga0207647_10001908
686 Ga0207647_10016455
687 Ga0207699_11414729
688 Ga0207645_11120393
689 Ga0207705_10002004
690 Ga0207705_10006212
691 Ga0207705_10094825
692 Ga0207705_10533630
693 Ga0207705_10904423
694 Ga0207684_11383262
695 Ga0207654_10870090
696 Ga0207707_10046479
697 Ga0207707_10098990
698 Ga0207707_10274966
699 Ga0207695_10000374
700 Ga0207695_10001495
701 Ga0207695_10018476
702 Ga0207695_10151704
703 Ga0207695_10271418
704 Ga0207671_10053860
705 Ga0207671_10124025
706 Ga0207671_10264259
707 Ga0207671_10945801
708 Ga0207660_10018806
709 Ga0207660_10212227
710 Ga0207660_10408486
711 Ga0207657_10008292
712 Ga0207657_10014217
713 Ga0207657_10217311
714 Ga0207649_10042284
715 Ga0207649_10091208
716 Ga0207649_10301270
717 Ga0207649_10358723
718 Ga0207649_10786923
719 Ga0207652_10029125
720 Ga0207652_10037168
721 Ga0207652_10264870
722 Ga0207646_10056281
723 Ga0207694_10004828
724 Ga0207694_10029413
725 Ga0207694_10032231
726 Ga0207694_10130915
727 Ga0207694_10444570
728 Ga0207659_10013368
729 Ga0207700_10428673
730 Ga0207700_10614492
731 Ga0207664_10252831
732 Ga0207690_10008076
733 Ga0207690_10088150
734 Ga0207706_10285509
735 Ga0207706_10333875
736 Ga0207686_10033937
737 Ga0207709_10014554
738 Ga0207709_10798489
739 Ga0207670_10794082
740 Ga0207711_10100743
741 Ga0207711_10620488
742 Ga0207689_10172796
743 Ga0207689_10526630
744 Ga0207661_10034221
745 Ga0207661_10040482
746 Ga0207679_10428818
747 Ga0207679_10721072
748 Ga0207667_10000199
749 Ga0207667_10002760
750 Ga0207667_10016370
751 Ga0207667_10054574
752 Ga0207667_10101156
753 Ga0207667_11387162
754 Ga0207651_11722349
755 Ga0207712_10025976
756 Ga0207640_10099627
757 Ga0207677_10499343
758 Ga0207703_10211761
759 Ga0207703_11024738
760 Ga0207639_10012768
761 Ga0207639_10340915
762 Ga0207678_10000156
763 Ga0207678_10014994
764 Ga0207678_10763389
765 Ga0207678_11376689
766 Ga0207702_10033435
767 Ga0207702_10044111
768 Ga0207702_10365451
769 Ga0207702_10547935
770 Ga0207641_10589035
771 Ga0207648_10182160
772 Ga0207676_10195850
773 Ga0207674_10022305
774 Ga0207674_10257609
775 Ga0207674_11068039
776 Ga0207675_100072734
777 Ga0207698_10006350
778 Ga0207698_10013454
779 Ga0207698_10030471
780 Ga0207698_10222734
781 Ga0210002_1026523
782 Ga0209966_1070620
783 Ga0207428_10713279
784 Ga0268266_10001808
785 Ga0268266_10007349
786 Ga0268265_10553983
787 Ga0268265_10631633
788 Ga0268264_10107545
789 Ga0268264_10205216
790 Ga0265318_10002639
791 Ga0265330_10001307
792 Ga0265325_10000197
793 Ga0265329_10063238
794 Ga0265329_10102701
795 Ga0265340_10004601
796 Ga0265339_10004009
797 Ga0265331_10447708
798 Ga0265316_10006441
799 Ga0265316_10006595
800 Ga0265316_10006867
801 Ga0265316_10019808
802 Ga0265313_10002120
803 Ga0265313_10285369
804 Ga0265342_10003910
805 Ga0265342_10137782
806 Ga0307416_101090917
807 Ga0307416_103093224
808 Ga0316583_10126481
809 Ga0307510_10025467
810 Ga0307510_10273262
811 Ga0395900_1190518
812 Ga0395905_1906294
813 Ga0436364_0359498
814 Ga0436364_0947382
815 Ga0436365_0591476
816 Ga0436365_0752636
817 Ga0436365_1529594
818 Ga0436360_0902978
819 Ga0436363_0247654
820 Ga0436362_0284568
821 Ga0436362_1017616
822 Ga0450919_011284
823 Ga0439435_0078623
824 Ga0439460_0213014
825 Ga0450918_047769
826 Ga0466966_0119393
827 Ga0466971_0616382
828 Ga0466958_0840237
829 Ga0495650_0000006
830 Ga0495650_0009719
831 Ga0495594_0427445
832 Ga0495630_0113399
833 Ga0495637_0040392
834 Ga0495652_0294609
835 Ga0495625_0000156
836 Ga0495625_0257554
837 Ga0495613_0492314
838 Ga0495649_0053610
839 Ga0495649_0309644
840 Ga0495674_0072316
841 Ga0495687_139928
842 Ga0495686_0169658
843 Ga0496115_0794522
844 Ga0496120_0387547
845 Ga0496126_0000010
846 Ga0496126_0000560
847 Ga0501031_0068158
848 Ga0501032_0103347
849 Ga0501032_0130892
850 Ga0501033_0002991
851 Ga0501034_0016554
852 Ga0501036_0018154
853 Ga0501037_0019154
854 Ga0501038_0001587
855 Ga0501039_0345992
856 Ga0501043_0035702
857 Ga0501043_0378368
858 Ga0501046_0000121
859 Ga0501047_0009555
860 Ga0501047_0152196
861 Ga0501048_0117934
862 Ga0501068_0064690
863 Ga0501069_0135746
864 Ga0501070_0303578
865 Ga0501073_0018580
866 Ga0501074_0138074
867 Ga0501259_184232
868 Ga0501080_0126872
869 Ga0501035_0012728
870 Ga0501035_0131015
871 Ga0501044_0053998
872 nmdc:mga0qj67_403439_c1
873 nmdc:mga08y16_12429_c1
874 nmdc:mga08y16_140435_c1
875 Ga0500643_008811
876 Ga0500595_000014
877 Ga0501082_1263546
878 2884218159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

38

99

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4f-assembly1.cif.gz_A crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695 0.9351 32 110
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.9103 5 114
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9094 13 113
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9079 2 111
4ccj-assembly1.cif.gz_D 60s ribosomal protein l8 histidine hydroxylase (no66) in apo form 0.8987 35 110
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9573 19 110 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9536 18 110 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9478 18 110 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.942 21 121 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9268 18 111 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1J5ARP4-F1-model_v4 Cupin type-2 domain-containing protein 0.9897 14 122
AF-A0A1Q3QNM9-F1-model_v4 Cupin type-2 domain-containing protein 0.9865 1 127 GO:0046872
AF-A0A1F5A5V2-F1-model_v4 Cupin type-2 domain-containing protein 0.9817 6 130 GO:0046872
AF-A0A2V5NF80-F1-model_v4 Cupin type-2 domain-containing protein 0.9805 22 121
AF-A0A7C6QB31-F1-model_v4 Cupin domain-containing protein 0.9762 1 125

Map