F444244

General Info

Members Datasets Scaffolds Average Seq Length
439 216 395 462

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0178273|Ga0395900_0178273_601_2115
Length 504
Sequence MILRISREEKTSAKPCKHGVAARSEAFYLKAISIHEDKMSQSNAIQDDDLPAWLPRLAVHGGPRFLQIADALQAAVADGSLKPGDRLPPQRQLAAWLDVDLTTITRAYDEARRRNLLEGRGARGTYVAAPKVELTAILDLSMNTPPPPDGVDFDDMLKQGVAQVLMRVDNELLMTYHLGGGSDADRKAGARWLEPMFGHPDARQIVVCPGAQAAIAALILALTAPGDAVLAEPTGYPGLRAAATQFGRHVIAVEADKDGMLPGMFEEACRRHKPGLVYLNPTLQNPTAITMPERRRRELAGIARRCNVRIVEDDPYWLLADSPXXPVATFAPEHVVYISTLSKCLTPGLRVAFVLIRDPDERERFLVALRSFALMAAPLTAALATQWILDGSAERLLKGVRDEARLRQRMARDILAGRYSGAGDGLHVWLELPAYWNPAQLARAAASSGIAVTPAEAFATGSGSVNAIRISLGSIKDRGRLRAGLQRLSHLLARRPESFSAAVV

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2721755523 Delftia sp. HK171 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738541357 Duganella sp. GV053 Isolate Unclassified
11 2738543003 Duganella sp. GV066 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
17 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
18 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
19 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
20 2818991436 Collimonas arenae 515 Isolate Unclassified
21 2821131069 Duganella sp. 1224 Isolate Unclassified
22 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
23 2842711865 Duganella sp. R-73148 Isolate Unclassified
24 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
25 2855730933 Achromobacter sp. HZ28 Isolate Nodule
26 2855767633 Achromobacter sp. HZ34 Isolate Nodule
27 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
28 2857553236 Duganella sp. R-74557 Isolate Unclassified
29 2857564685 Duganella sp. R-74599 Isolate Unclassified
30 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
31 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
32 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
33 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
34 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
35 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
36 2904424332 Duganella sp. 1411 Isolate Rhizosphere
37 2919476304 Duganella sp. 3397 Isolate Unclassified
38 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
59 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.98
Metatranscriptomes 0
Isolates 10.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.95
Nodule 1.82
Rhizoplane 0.91
Rhizosphere 68.34
Stem 0
Stem Tuber 0
Unclassified 12.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000414 3300002737 Bacteria 34857
2 JGI25154J39366_1001504 3300002738 Bacteria 8152
3 JGI25158J39367_1000051 3300002739 Bacteria 27190
4 JGI25159J45721_1000360 3300002987 Bacteria 21138
5 JGI25159J45721_1001338 3300002987 Bacteria 10370
6 JGI25165J46597_1000135 3300003214 Bacteria 122924
7 rootL2_10002627 3300003322 Bacteria 2755
8 rootL2_10002628 3300003322 Bacteria 9375
9 JGI25161J50226_1001185 3300003374 Bacteria 8565
10 Ga0055538_1000055 3300003751 Bacteria 122924
11 Ga0055539_1000080 3300003752 Bacteria 122924
12 Ga0055533_1000086 3300003756 Bacteria 122924
13 Ga0055525_1000047 3300003759 Bacteria 261507
14 Ga0055525_1000114 3300003759 Bacteria 122924
15 Ga0055529_1000051 3300003763 Bacteria 205006
16 Ga0055526_1000193 3300003771 Bacteria 53165
17 Ga0055526_1000411 3300003771 Bacteria 34678
18 Ga0055537_1000060 3300003773 Bacteria 79376
19 Ga0055537_1004028 3300003773 Bacteria 4322
20 Ga0055524_1002778 3300003775 Bacteria 8802
21 Ga0055524_1022717 3300003775 Bacteria 2040
22 Ga0055534_1000009 3300003784 Bacteria 210256
23 Ga0055528_1000012 3300003790 Bacteria 182704
24 Ga0055530_10004710 3300003791 Bacteria 6901
25 Ga0055530_10009994 3300003791 Bacteria 3568
26 Ga0055531_10009197 3300003794 Bacteria 5086
27 Ga0055541_1000057 3300003841 Bacteria 122924
28 Ga0055543_1000532 3300004625 Bacteria 21468
29 Ga0065165_1000055 3300005262 Bacteria 187003
30 Ga0065165_1000495 3300005262 Bacteria 60868
31 Ga0070658_10033004 3300005327 Bacteria 4163
32 Ga0070658_10051897 3300005327 Bacteria 3324
33 Ga0070660_100029160 3300005339 Bacteria 4133
34 Ga0070660_100036216 3300005339 Bacteria 3736
35 Ga0070661_100142928 3300005344 Bacteria 1804
36 Ga0070659_100011628 3300005366 Bacteria 6513
37 Ga0068855_100013933 3300005563 Bacteria 9697
38 Ga0068855_100029634 3300005563 Bacteria 6541
39 Ga0070717_10021632 3300006028 Bacteria 5072
40 Ga0075364_10002431 3300006051 Bacteria 10429
41 Ga0079104_1000026 3300006946 Bacteria 216566
42 Ga0079104_1016994 3300006946 Bacteria 2105
43 Ga0105251_10015687 3300009011 Bacteria 4128
44 Ga0105244_10013171 3300009036 Bacteria 4845
45 Ga0105250_10003471 3300009092 Bacteria 7456
46 Ga0105240_10005711 3300009093 Bacteria 18459
47 Ga0105243_10004982 3300009148 Bacteria 10409
48 Ga0105243_10046418 3300009148 Bacteria 3417
49 Ga0105241_10019596 3300009174 Bacteria 4990
50 Ga0105242_10000153 3300009176 Bacteria 51027
51 Ga0105242_10028891 3300009176 Bacteria 4418
52 Ga0105239_10100540 3300010375 Bacteria 3199
53 Ga0157373_10082231 3300013100 Bacteria 2270
54 Ga0157378_10072750 3300013297 Bacteria 3089
55 Ga0182008_10000721 3300014497 Bacteria 23585
56 Ga0182006_1000002 3300015261 Bacteria 887990
57 Ga0182006_1000023 3300015261 Bacteria 275031
58 Ga0182007_10000090 3300015262 Bacteria 66706
59 Ga0182007_10003196 3300015262 Bacteria 7819
60 Ga0182005_1000006 3300015265 Bacteria 515188
61 Ga0182005_1000070 3300015265 Bacteria 85687
62 Ga0182005_1000628 3300015265 Bacteria 16985
63 Ga0163161_10004406 3300017792 Bacteria 9821
64 Ga0163161_10102348 3300017792 Bacteria 2133
65 Ga0213872_10002605 3300021361 Bacteria 10485
66 Ga0213872_10008391 3300021361 Bacteria 5002
67 Ga0213872_10013413 3300021361 Bacteria 3839
68 Ga0213872_10022046 3300021361 Bacteria 2934
69 Ga0209760_100976 3300025207 Bacteria 3445
70 Ga0209436_100040 3300025208 Bacteria 75392
71 Ga0209784_100010 3300025224 Bacteria 683664
72 Ga0209566_100008 3300025225 Bacteria 683664
73 Ga0209674_100019 3300025226 Bacteria 683664
74 Ga0209563_100003 3300025230 Bacteria 1932942
75 Ga0209563_100021 3300025230 Bacteria 683764
76 Ga0207427_100570 3300025231 Bacteria 18553
77 Ga0209437_100019 3300025233 Bacteria 683764
78 Ga0209437_100456 3300025233 Bacteria 32812
79 Ga0207425_1000048 3300025245 Bacteria 188748
80 Ga0207425_1000430 3300025245 Bacteria 27743
81 Ga0209646_1000222 3300025246 Bacteria 61152
82 Ga0209677_100011 3300025253 Bacteria 683664
83 Ga0209677_106295 3300025253 Bacteria 2843
84 Ga0209148_1000211 3300025254 Bacteria 102391
85 Ga0209129_1001011 3300025258 Bacteria 16764
86 Ga0209233_1000025 3300025261 Bacteria 683764
87 Ga0209565_1000015 3300025263 Bacteria 494091
88 Ga0209565_1000369 3300025263 Bacteria 38452
89 Ga0209565_1002001 3300025263 Bacteria 7918
90 Ga0209565_1004118 3300025263 Bacteria 4526
91 Ga0209455_1000044 3300025272 Bacteria 410787
92 Ga0209673_1000017 3300025273 Bacteria 492994
93 Ga0209673_1002495 3300025273 Bacteria 12674
94 Ga0209130_1000091 3300025284 Bacteria 149502
95 Ga0209130_1000217 3300025284 Bacteria 75515
96 Ga0209675_1000012 3300025291 Bacteria 494061
97 Ga0209675_1003368 3300025291 Bacteria 7643
98 Ga0209025_1005903 3300025294 Bacteria 9770
99 Ga0209564_1000011 3300025295 Bacteria 822327
100 Ga0209564_1000016 3300025295 Bacteria 613131
101 Ga0209564_1016764 3300025295 Bacteria 2895
102 Ga0209758_1002033 3300025297 Bacteria 21722
103 Ga0209050_1000011 3300025298 Bacteria 914037
104 Ga0209050_1002478 3300025298 Bacteria 15691
105 Ga0209256_1000314 3300025299 Bacteria 84164
106 Ga0209256_1000576 3300025299 Bacteria 52365
107 Ga0209256_1019073 3300025299 Bacteria 2199
108 Ga0207426_1001978 3300025302 Bacteria 14551
109 Ga0209257_1000003 3300025304 Bacteria 1702593
110 Ga0209257_1006716 3300025304 Bacteria 7274
111 Ga0207655_1008811 3300025728 Bacteria 6347
112 Ga0207705_10002801 3300025909 Bacteria 13336
113 Ga0207654_10026205 3300025911 Bacteria 3154
114 Ga0207695_10000369 3300025913 Bacteria 103133
115 Ga0207657_10043608 3300025919 Bacteria 3949
116 Ga0207706_10192136 3300025933 Bacteria 1792
117 Ga0207686_10001663 3300025934 Bacteria 12372
118 Ga0207686_10002803 3300025934 Bacteria 9429
119 Ga0207709_10000079 3300025935 Bacteria 166220
120 Ga0207709_10017706 3300025935 Bacteria 3981
121 Ga0207667_10043439 3300025949 Bacteria 4769
122 Ga0207698_10012397 3300026142 Bacteria 5576
123 Ga0209281_1000067 3300027111 Bacteria 284517
124 Ga0316181_1189350 3300030744 Bacteria 2622
125 Ga0307408_100000563 3300031548 Bacteria 31982
126 Ga0307408_100005331 3300031548 Bacteria 8613
127 Ga0307408_100012247 3300031548 Bacteria 5678
128 Ga0265314_10019704 3300031711 Bacteria 5219
129 Ga0395899_0001832 3300037312 Bacteria 17597
130 Ga0395899_0001951 3300037312 Bacteria 16957
131 Ga0395900_0000148 3300037418 Bacteria 117889
132 Ga0395900_0000297 3300037418 Bacteria 74817
133 Ga0395900_0012155 3300037418 Bacteria 8799
134 Ga0395900_0016233 3300037418 Bacteria 7586
135 Ga0395900_0038450 3300037418 Bacteria 4931
136 Ga0395900_0073704 3300037418 Bacteria 3510
137 Ga0395900_0142130 3300037418 Bacteria 2457
138 Ga0395900_0178273 3300037418 Bacteria 2161
139 Ga0395900_0290237 3300037418 Bacteria 1624
140 Ga0395898_0022060 3300037466 Bacteria 6450
141 Ga0395898_0044972 3300037466 Bacteria 4341
142 Ga0395905_0011397 3300037471 Bacteria 8591
143 Ga0395905_0017366 3300037471 Bacteria 6832
144 Ga0395901_0000182 3300038443 Bacteria 81583
145 Ga0395901_0037706 3300038443 Bacteria 4999
146 Ga0395901_0186117 3300038443 Bacteria 2178
147 Ga0436361_0126768 3300039447 Bacteria 10807
148 Ga0436361_0169426 3300039447 Bacteria 7449
149 Ga0436361_0217458 3300039447 Bacteria 6520
150 Ga0436361_0406312 3300039447 Bacteria 17480
151 Ga0466965_0082487 3300044683 Bacteria 1626
152 Ga0466966_0003721 3300044684 Bacteria 10056
153 Ga0466966_0065736 3300044684 Bacteria 2280
154 Ga0466957_0000033 3300044842 Bacteria 50844
155 Ga0466959_0012340 3300045049 Bacteria 6171
156 Ga0466958_0022929 3300045836 Bacteria 3660
157 Ga0466967_0014085 3300045976 Bacteria 6213
158 Ga0495617_000001 3300046452 Bacteria 877032
159 Ga0495617_000021 3300046452 Bacteria 215885
160 Ga0495617_008478 3300046452 Bacteria 3542
161 Ga0495627_000006 3300046453 Bacteria 581750
162 Ga0495627_000053 3300046453 Bacteria 152092
163 Ga0495590_0000006 3300046457 Bacteria 372949
164 Ga0495590_0000059 3300046457 Bacteria 92114
165 Ga0495590_0000288 3300046457 Bacteria 27099
166 Ga0495591_028441 3300046458 Bacteria 1710
167 Ga0495638_0049921 3300046460 Bacteria 2614
168 Ga0495653_0000011 3300046463 Bacteria 272314
169 Ga0495653_0013451 3300046463 Bacteria 6667
170 Ga0495650_0000051 3300046471 Bacteria 318297
171 Ga0495650_0000137 3300046471 Bacteria 171680
172 Ga0495650_0000159 3300046471 Bacteria 152501
173 Ga0495650_0000427 3300046471 Bacteria 68283
174 Ga0495650_0001558 3300046471 Bacteria 21622
175 Ga0495582_0018303 3300046473 Bacteria 3832
176 Ga0495605_0000004 3300046474 Bacteria 395282
177 Ga0495605_0000044 3300046474 Bacteria 182513
178 Ga0495605_0000146 3300046474 Bacteria 91196
179 Ga0495605_0049633 3300046474 Bacteria 2049
180 Ga0495584_0000017 3300046491 Bacteria 149686
181 Ga0495584_0000065 3300046491 Bacteria 75724
182 Ga0495584_0000778 3300046491 Bacteria 21054
183 Ga0495584_0011065 3300046491 Bacteria 4627
184 Ga0495585_0000125 3300046492 Bacteria 83087
185 Ga0495585_0003831 3300046492 Bacteria 10011
186 Ga0495585_0008337 3300046492 Bacteria 6284
187 Ga0495585_0014051 3300046492 Bacteria 4674
188 Ga0495585_0016220 3300046492 Bacteria 4315
189 Ga0495594_0061854 3300046499 Bacteria 2072
190 Ga0495596_0008348 3300046500 Bacteria 4615
191 Ga0495607_0000502 3300046501 Bacteria 39166
192 Ga0495607_0000867 3300046501 Bacteria 28348
193 Ga0495607_0001156 3300046501 Bacteria 23901
194 Ga0495607_0001595 3300046501 Bacteria 19697
195 Ga0495607_0016858 3300046501 Bacteria 4706
196 Ga0495607_0025395 3300046501 Bacteria 3684
197 Ga0495607_0032051 3300046501 Bacteria 3212
198 Ga0495607_0071640 3300046501 Bacteria 1931
199 Ga0495607_0071897 3300046501 Bacteria 1927
200 Ga0495583_0000402 3300046506 Bacteria 65718
201 Ga0495583_0000430 3300046506 Bacteria 63194
202 Ga0495583_0001133 3300046506 Bacteria 29196
203 Ga0495583_0003581 3300046506 Bacteria 11674
204 Ga0495583_0011831 3300046506 Bacteria 4985
205 Ga0495583_0025589 3300046506 Bacteria 2945
206 Ga0495606_0000024 3300046507 Bacteria 262080
207 Ga0495606_0000256 3300046507 Bacteria 93906
208 Ga0495606_0000284 3300046507 Bacteria 88119
209 Ga0495606_0001588 3300046507 Bacteria 29701
210 Ga0495606_0001698 3300046507 Bacteria 28439
211 Ga0495606_0028202 3300046507 Bacteria 3965
212 Ga0495606_0032716 3300046507 Bacteria 3598
213 Ga0495610_0000008 3300046512 Bacteria 622732
214 Ga0495610_0000607 3300046512 Bacteria 35451
215 Ga0495610_0003277 3300046512 Bacteria 12757
216 Ga0495610_0014466 3300046512 Bacteria 4632
217 Ga0495610_0019919 3300046512 Bacteria 3739
218 Ga0495616_0000139 3300046513 Bacteria 63327
219 Ga0495616_0000992 3300046513 Bacteria 20322
220 Ga0495616_0001086 3300046513 Bacteria 19319
221 Ga0495616_0006712 3300046513 Bacteria 6943
222 Ga0495616_0008570 3300046513 Bacteria 6042
223 Ga0495616_0011699 3300046513 Bacteria 5016
224 Ga0495616_0041576 3300046513 Bacteria 2344
225 Ga0495620_0009913 3300046515 Bacteria 5042
226 Ga0495630_0158473 3300046517 Bacteria 1723
227 Ga0495631_0002673 3300046518 Bacteria 9920
228 Ga0495631_0003297 3300046518 Bacteria 8878
229 Ga0495631_0007751 3300046518 Bacteria 5447
230 Ga0495631_0053296 3300046518 Bacteria 1765
231 Ga0495632_0000221 3300046519 Bacteria 57926
232 Ga0495637_0000011 3300046520 Bacteria 337279
233 Ga0495637_0000257 3300046520 Bacteria 41841
234 Ga0495643_0006149 3300046522 Bacteria 7972
235 Ga0495643_0006156 3300046522 Bacteria 7970
236 Ga0495643_0006967 3300046522 Bacteria 7350
237 Ga0495643_0060511 3300046522 Bacteria 2010
238 Ga0495644_0030160 3300046523 Bacteria 2048
239 Ga0495648_0000022 3300046524 Bacteria 242791
240 Ga0495648_0000053 3300046524 Bacteria 159860
241 Ga0495648_0001443 3300046524 Bacteria 23260
242 Ga0495648_0003531 3300046524 Bacteria 13696
243 Ga0495648_0005312 3300046524 Bacteria 10744
244 Ga0495648_0011883 3300046524 Bacteria 6532
245 Ga0495663_0037846 3300046525 Bacteria 1456
246 Ga0495642_0000001 3300046528 Bacteria 389656
247 Ga0495654_0000030 3300046530 Bacteria 216715
248 Ga0495654_0006899 3300046530 Bacteria 6404
249 Ga0495665_0000780 3300046531 Bacteria 16583
250 Ga0495587_0026468 3300046536 Bacteria 3537
251 Ga0495609_0000019 3300046538 Bacteria 297777
252 Ga0495609_0000201 3300046538 Bacteria 59598
253 Ga0495609_0000628 3300046538 Bacteria 27456
254 Ga0495609_0009122 3300046538 Bacteria 4813
255 Ga0495597_0000028 3300046542 Bacteria 137215
256 Ga0495597_0000071 3300046542 Bacteria 88148
257 Ga0495597_0000292 3300046542 Bacteria 44978
258 Ga0495597_0010574 3300046542 Bacteria 4503
259 Ga0495622_0000002 3300046557 Bacteria 321742
260 Ga0495633_0000332 3300046558 Bacteria 53300
261 Ga0495633_0000828 3300046558 Bacteria 27294
262 Ga0495633_0001177 3300046558 Bacteria 21028
263 Ga0495633_0013159 3300046558 Bacteria 4372
264 Ga0495633_0021001 3300046558 Bacteria 3272
265 Ga0495633_0036160 3300046558 Bacteria 2367
266 Ga0495633_0042263 3300046558 Bacteria 2165
267 Ga0495633_0072353 3300046558 Bacteria 1607
268 Ga0495656_0005214 3300046615 Bacteria 4480
269 Ga0495668_0000051 3300046616 Bacteria 214532
270 Ga0495668_0000243 3300046616 Bacteria 77845
271 Ga0495668_0000581 3300046616 Bacteria 44560
272 Ga0495668_0000606 3300046616 Bacteria 43443
273 Ga0495668_0000733 3300046616 Bacteria 39289
274 Ga0495668_0002164 3300046616 Bacteria 16872
275 Ga0495668_0007119 3300046616 Bacteria 7206
276 Ga0495634_0008818 3300046642 Bacteria 7479
277 Ga0495611_0000748 3300046648 Bacteria 18317
278 Ga0495611_0005581 3300046648 Bacteria 5367
279 Ga0495611_0010670 3300046648 Bacteria 3889
280 Ga0495611_0012984 3300046648 Bacteria 3542
281 Ga0495625_0000391 3300046660 Bacteria 66888
282 Ga0495625_0005939 3300046660 Bacteria 10987
283 Ga0495625_0031882 3300046660 Bacteria 3915
284 Ga0495625_0037347 3300046660 Bacteria 3564
285 Ga0495625_0081956 3300046660 Bacteria 2244
286 Ga0495661_0000500 3300046665 Bacteria 40811
287 Ga0495661_0003531 3300046665 Bacteria 11523
288 Ga0495661_0007559 3300046665 Bacteria 7572
289 Ga0495661_0012266 3300046665 Bacteria 5788
290 Ga0495661_0040592 3300046665 Bacteria 2884
291 Ga0495661_0045785 3300046665 Bacteria 2673
292 Ga0495661_0073868 3300046665 Bacteria 1985
293 Ga0495661_0075259 3300046665 Bacteria 1962
294 Ga0495669_0000086 3300046684 Bacteria 61977
295 Ga0495669_0001321 3300046684 Bacteria 10257
296 Ga0495669_0003838 3300046684 Bacteria 6176
297 Ga0495669_0017343 3300046684 Bacteria 3089
298 Ga0495670_0005466 3300046691 Bacteria 6236
299 Ga0495670_0107303 3300046691 Bacteria 1443
300 Ga0495671_0000002 3300046692 Bacteria 1136189
301 Ga0495671_0000267 3300046692 Bacteria 44109
302 Ga0495671_0004220 3300046692 Bacteria 8651
303 Ga0495671_0010833 3300046692 Bacteria 5040
304 Ga0495649_0000141 3300046694 Bacteria 62853
305 Ga0495649_0003157 3300046694 Bacteria 11261
306 Ga0495589_0000077 3300046794 Bacteria 90550
307 Ga0495589_0000078 3300046794 Bacteria 90390
308 Ga0495589_0000356 3300046794 Bacteria 35584
309 Ga0495589_0000690 3300046794 Bacteria 21962
310 Ga0495589_0001072 3300046794 Bacteria 16389
311 Ga0495589_0014339 3300046794 Bacteria 4082
312 Ga0495600_0048796 3300046809 Bacteria 2762
313 Ga0495660_0000118 3300046810 Bacteria 85202
314 Ga0495660_0000213 3300046810 Bacteria 59421
315 Ga0495660_0000271 3300046810 Bacteria 48672
316 Ga0495660_0010181 3300046810 Bacteria 5469
317 Ga0495660_0021139 3300046810 Bacteria 3729
318 Ga0495660_0069104 3300046810 Bacteria 1877
319 Ga0495636_0006080 3300047318 Bacteria 4739
320 Ga0495672_0000014 3300047320 Bacteria 505636
321 Ga0495672_0000094 3300047320 Bacteria 144774
322 Ga0495672_0000157 3300047320 Bacteria 98544
323 Ga0495672_0011617 3300047320 Bacteria 6200
324 Ga0495683_0000933 3300047323 Bacteria 20618
325 Ga0495683_0006808 3300047323 Bacteria 6212
326 Ga0495683_0029887 3300047323 Bacteria 2783
327 Ga0495687_000003 3300047443 Bacteria 859509
328 Ga0495687_000030 3300047443 Bacteria 279992
329 Ga0495687_000046 3300047443 Bacteria 210412
330 Ga0495687_000065 3300047443 Bacteria 162721
331 Ga0495687_001361 3300047443 Bacteria 22605
332 Ga0495687_004703 3300047443 Bacteria 9068
333 Ga0495687_007019 3300047443 Bacteria 6755
334 Ga0495675_0033959 3300047444 Bacteria 3257
335 Ga0495677_0000021 3300047445 Bacteria 103770
336 Ga0495677_0000755 3300047445 Bacteria 13048
337 Ga0495677_0007243 3300047445 Bacteria 4150
338 Ga0495677_0007623 3300047445 Bacteria 4038
339 Ga0495677_0021220 3300047445 Bacteria 2354
340 Ga0495679_000706 3300047446 Bacteria 21720
341 Ga0495679_004238 3300047446 Bacteria 6669
342 Ga0495679_007774 3300047446 Bacteria 4428
343 Ga0495679_030609 3300047446 Bacteria 1744
344 Ga0495685_000115 3300047447 Bacteria 27732
345 Ga0495673_0000003 3300047469 Bacteria 1491337
346 Ga0495673_0000016 3300047469 Bacteria 580643
347 Ga0495673_0000035 3300047469 Bacteria 316861
348 Ga0495673_0000064 3300047469 Bacteria 225793
349 Ga0495673_0025653 3300047469 Bacteria 2826
350 Ga0495681_0008481 3300047470 Bacteria 6444
351 Ga0495681_0009842 3300047470 Bacteria 5845
352 Ga0495681_0011903 3300047470 Bacteria 5141
353 Ga0495681_0025432 3300047470 Bacteria 3098
354 Ga0495686_0000054 3300047472 Bacteria 259400
355 Ga0495686_0004730 3300047472 Bacteria 11022
356 Ga0495686_0024809 3300047472 Bacteria 3935
357 Ga0495602_0001408 3300048088 Bacteria 23797
358 Ga0495602_0023224 3300048088 Bacteria 6048
359 Ga0495614_0025097 3300048089 Bacteria 2572
360 Ga0495626_0000359 3300048091 Bacteria 47614
361 Ga0495626_0002135 3300048091 Bacteria 14312
362 Ga0496102_0232185 3300048905 Bacteria 1739
363 Ga0496103_0000716 3300048906 Bacteria 24534
364 Ga0496113_0000575 3300048916 Bacteria 18301
365 Ga0496116_0022135 3300048919 Bacteria 4775
366 Ga0496117_0000001 3300048920 Bacteria 2526244
367 Ga0496118_0000078 3300048921 Bacteria 190946
368 Ga0496121_0002173 3300048924 Bacteria 30713
369 Ga0496121_0067944 3300048924 Bacteria 2886
370 Ga0496122_0000261 3300048925 Bacteria 118793
371 Ga0496122_0000445 3300048925 Bacteria 86566
372 Ga0496122_0001494 3300048925 Bacteria 37388
373 Ga0496122_0022995 3300048925 Bacteria 5516
374 Ga0496123_0000218 3300048926 Bacteria 116615
375 Ga0496123_0001531 3300048926 Bacteria 31933
376 Ga0496123_0001851 3300048926 Bacteria 27757
377 Ga0496123_0007957 3300048926 Bacteria 9835
378 Ga0496123_0037204 3300048926 Bacteria 3440
379 Ga0496123_0097971 3300048926 Bacteria 1716
380 Ga0496124_0008566 3300048927 Bacteria 10675
381 Ga0496124_0025119 3300048927 Bacteria 5402
382 Ga0496124_0046356 3300048927 Bacteria 3723
383 Ga0496124_0108369 3300048927 Bacteria 2240
384 Ga0496125_0000256 3300048928 Bacteria 109696
385 Ga0496125_0000484 3300048928 Bacteria 70115
386 Ga0496125_0002437 3300048928 Bacteria 24169
387 Ga0496125_0026622 3300048928 Bacteria 5263
388 Ga0496126_0240033 3300048929 Bacteria 1514
389 Ga0495678_000032 3300049459 Bacteria 212537
390 Ga0495678_000205 3300049459 Bacteria 68873
391 Ga0495678_008746 3300049459 Bacteria 5074
392 Ga0495682_0004098 3300049460 Bacteria 6329
393 Ga0501269_000553 3300049766 Bacteria 7081
394 Ga0501035_0001544 3300049822 Bacteria 23440
395 nmdc:mga00v17_6611_c1 3300050491 Bacteria 6154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002738 JGI25154J39366_1001504 JGI25154J39366_10015043 432
2 3300025246 Ga0209646_1000222 Ga0209646_100022241 432
3 3300046452 Ga0495617_000001 Ga0495617_000001_613718_615118 432
4 3300046453 Ga0495627_000053 Ga0495627_000053_114291_115691 432
5 3300046458 Ga0495591_028441 Ga0495591_028441_219_1619 432
6 3300046474 Ga0495605_0000004 Ga0495605_0000004_263590_264990 432
7 3300046501 Ga0495607_0001156 Ga0495607_0001156_3279_4679 432
8 3300046513 Ga0495616_0001086 Ga0495616_0001086_8876_10276 432
9 3300046518 Ga0495631_0007751 Ga0495631_0007751_1200_2600 432
10 3300046524 Ga0495648_0000022 Ga0495648_0000022_41006_42406 432
11 3300046528 Ga0495642_0000001 Ga0495642_0000001_354491_355891 432
12 3300046530 Ga0495654_0006899 Ga0495654_0006899_1299_2699 432
13 3300046538 Ga0495609_0009122 Ga0495609_0009122_541_1941 432
14 3300046615 Ga0495656_0005214 Ga0495656_0005214_1460_2860 432
15 3300046616 Ga0495668_0000581 Ga0495668_0000581_33835_35235 432
16 3300046684 Ga0495669_0003838 Ga0495669_0003838_3381_4781 432
17 3300046692 Ga0495671_0000267 Ga0495671_0000267_40549_41949 432
18 3300046794 Ga0495589_0000690 Ga0495589_0000690_6466_7866 432
19 3300047472 Ga0495686_0024809 Ga0495686_0024809_877_2277 432
20 3300047470 Ga0495681_0009842 Ga0495681_0009842_193_1629 434
21 3300048929 Ga0496126_0240033 Ga0496126_0240033_125_1471 434
22 iso_pu_bacteria 2894023352 2894024809 434
23 3300047446 Ga0495679_030609 Ga0495679_030609_184_1584 438
24 3300003763 Ga0055529_1000051 Ga0055529_100005112 439
25 3300025272 Ga0209455_1000044 Ga0209455_1000044196 439
26 3300031548 Ga0307408_100005331 Ga0307408_1000053316 439
27 3300037312 Ga0395899_0001951 Ga0395899_0001951_14944_16263 439
28 3300037418 Ga0395900_0016233 Ga0395900_0016233_5593_6912 439
29 3300037466 Ga0395898_0022060 Ga0395898_0022060_4902_6221 439
30 3300038443 Ga0395901_0037706 Ga0395901_0037706_255_1574 439
31 3300046471 Ga0495650_0000427 Ga0495650_0000427_47728_49047 439
32 3300046518 Ga0495631_0053296 Ga0495631_0053296_434_1753 439
33 3300048926 Ga0496123_0097971 Ga0496123_0097971_374_1693 439
34 3300044684 Ga0466966_0065736 Ga0466966_0065736_240_1622 444
35 3300003794 Ga0055531_10009197 Ga0055531_100091974 445
36 3300025273 Ga0209673_1002495 Ga0209673_10024956 445
37 3300025934 Ga0207686_10001663 Ga0207686_100016639 445
38 3300046542 Ga0495597_0000071 Ga0495597_0000071_19786_21168 446
39 3300046794 Ga0495589_0000356 Ga0495589_0000356_15118_16500 446
40 3300049459 Ga0495678_000205 Ga0495678_000205_35636_37036 446
41 3300031548 Ga0307408_100012247 Ga0307408_1000122475 447
42 3300046507 Ga0495606_0001698 Ga0495606_0001698_24297_25643 448
43 3300046522 Ga0495643_0006156 Ga0495643_0006156_5639_6985 448
44 3300046492 Ga0495585_0008337 Ga0495585_0008337_1616_2968 450
45 3300046517 Ga0495630_0158473 Ga0495630_0158473_236_1636 450
46 3300046648 Ga0495611_0010670 Ga0495611_0010670_1034_2386 450
47 3300047445 Ga0495677_0021220 Ga0495677_0021220_671_2023 450
48 3300047469 Ga0495673_0000003 Ga0495673_0000003_1241750_1243150 450
49 3300046501 Ga0495607_0000502 Ga0495607_0000502_32483_33838 451
50 3300046513 Ga0495616_0006712 Ga0495616_0006712_981_2336 451
51 3300046538 Ga0495609_0000019 Ga0495609_0000019_118057_119412 451
52 3300046665 Ga0495661_0000500 Ga0495661_0000500_35588_36943 451
53 3300046794 Ga0495589_0001072 Ga0495589_0001072_10982_12337 451
54 3300047443 Ga0495687_000003 Ga0495687_000003_118084_119439 451
55 3300047443 Ga0495687_000046 Ga0495687_000046_64727_66127 451
56 3300047445 Ga0495677_0000021 Ga0495677_0000021_98363_99718 451
57 iso_pu_bacteria 2839138175 2839143823 451
58 iso_pu_bacteria 2857564685 2857567113 451
59 3300045049 Ga0466959_0012340 Ga0466959_0012340_341_1702 453
60 3300003773 Ga0055537_1000060 Ga0055537_10000606 454
61 3300003784 Ga0055534_1000009 Ga0055534_100000945 454
62 3300003790 Ga0055528_1000012 Ga0055528_1000012134 454
63 3300025263 Ga0209565_1000015 Ga0209565_1000015321 454
64 3300025273 Ga0209673_1000017 Ga0209673_1000017212 454
65 3300025291 Ga0209675_1000012 Ga0209675_1000012161 454
66 3300025295 Ga0209564_1000016 Ga0209564_1000016274 454
67 3300025299 Ga0209256_1000314 Ga0209256_100031442 454
68 3300037418 Ga0395900_0073704 Ga0395900_0073704_578_1978 454
69 3300037471 Ga0395905_0011397 Ga0395905_0011397_7068_8468 454
70 3300046471 Ga0495650_0001558 Ga0495650_0001558_4877_6256 454
71 3300046542 Ga0495597_0000028 Ga0495597_0000028_13653_15035 454
72 3300046558 Ga0495633_0000828 Ga0495633_0000828_21362_22765 454
73 3300046616 Ga0495668_0007119 Ga0495668_0007119_4757_6136 454
74 3300046452 Ga0495617_000021 Ga0495617_000021_27235_28635 455
75 3300046471 Ga0495650_0000159 Ga0495650_0000159_146661_148061 455
76 3300046524 Ga0495648_0011883 Ga0495648_0011883_5075_6475 455
77 3300046616 Ga0495668_0000606 Ga0495668_0000606_14851_16251 455
78 3300046665 Ga0495661_0040592 Ga0495661_0040592_473_1873 455
79 3300047323 Ga0495683_0006808 Ga0495683_0006808_3842_5245 455
80 3300047446 Ga0495679_007774 Ga0495679_007774_698_2098 455
81 3300047469 Ga0495673_0000064 Ga0495673_0000064_111242_112642 455
82 3300046473 Ga0495582_0018303 Ga0495582_0018303_1304_2704 456
83 3300046499 Ga0495594_0061854 Ga0495594_0061854_90_1490 456
84 3300046536 Ga0495587_0026468 Ga0495587_0026468_853_2253 456
85 3300046642 Ga0495634_0008818 Ga0495634_0008818_4841_6241 456
86 3300046809 Ga0495600_0048796 Ga0495600_0048796_1266_2666 456
87 3300048927 Ga0496124_0025119 Ga0496124_0025119_1513_2910 456
88 3300049459 Ga0495678_000032 Ga0495678_000032_196911_198308 456
89 iso_pu_bacteria 2721755523 2722883030 456
90 iso_pu_bacteria 2855730933 2855735696 456
91 iso_pu_bacteria 2855767633 2855772634 456
92 iso_pu_bacteria 2881412998 2881417225 456
93 3300009176 Ga0105242_10000153 Ga0105242_1000015336 457
94 3300046507 Ga0495606_0032716 Ga0495606_0032716_1294_2730 457
95 3300046660 Ga0495625_0005939 Ga0495625_0005939_1145_2581 457
96 3300047320 Ga0495672_0000157 Ga0495672_0000157_79399_80862 457
97 3300013100 Ga0157373_10082231 Ga0157373_100822312 458
98 3300046520 Ga0495637_0000257 Ga0495637_0000257_23993_25369 458
99 3300046523 Ga0495644_0030160 Ga0495644_0030160_124_1524 458
100 3300046530 Ga0495654_0000030 Ga0495654_0000030_198332_199708 458
101 3300046558 Ga0495633_0072353 Ga0495633_0072353_10_1386 458
102 iso_pu_bacteria 2857553236 2857555972 458
103 3300046474 Ga0495605_0049633 Ga0495605_0049633_439_1884 459
104 3300046501 Ga0495607_0016858 Ga0495607_0016858_2003_3448 459
105 3300046524 Ga0495648_0003531 Ga0495648_0003531_156_1601 459
106 3300046810 Ga0495660_0000213 Ga0495660_0000213_52804_54204 459
107 iso_pu_bacteria 2643221664 2644360392 459
108 iso_pu_bacteria 2738541300 2738843061 459
109 iso_pu_bacteria 2738543018 2739273808 459
110 iso_pu_bacteria 2738543030 2739342852 459
111 3300003771 Ga0055526_1000193 Ga0055526_100019348 460
112 3300003773 Ga0055537_1004028 Ga0055537_10040285 460
113 3300003775 Ga0055524_1002778 Ga0055524_10027783 460
114 3300006051 Ga0075364_10002431 Ga0075364_100024313 460
115 3300006946 Ga0079104_1000026 Ga0079104_1000026213 460
116 3300009011 Ga0105251_10015687 Ga0105251_100156872 460
117 3300009092 Ga0105250_10003471 Ga0105250_100034717 460
118 3300009093 Ga0105240_10005711 Ga0105240_100057115 460
119 3300009148 Ga0105243_10004982 Ga0105243_100049825 460
120 3300025263 Ga0209565_1004118 Ga0209565_10041185 460
121 3300025299 Ga0209256_1019073 Ga0209256_10190733 460
122 3300025935 Ga0207709_10000079 Ga0207709_1000007920 460
123 3300027111 Ga0209281_1000067 Ga0209281_1000067271 460
124 3300046453 Ga0495627_000006 Ga0495627_000006_340471_341871 460
125 3300046507 Ga0495606_0001588 Ga0495606_0001588_25067_26467 460
126 3300046538 Ga0495609_0000201 Ga0495609_0000201_1898_3298 460
127 3300046810 Ga0495660_0000118 Ga0495660_0000118_53828_55237 460
128 3300048919 Ga0496116_0022135 Ga0496116_0022135_689_2089 460
129 3300048925 Ga0496122_0000261 Ga0496122_0000261_9072_10454 460
130 3300048926 Ga0496123_0000218 Ga0496123_0000218_6633_8015 460
131 3300050491 nmdc:mga00v17_6611_c1 nmdc:mga00v17_6611_c1_4309_5691 460
132 3300005327 Ga0070658_10033004 Ga0070658_100330044 461
133 3300046457 Ga0495590_0000006 Ga0495590_0000006_218329_219714 461
134 3300046460 Ga0495638_0049921 Ga0495638_0049921_1040_2440 461
135 3300046501 Ga0495607_0032051 Ga0495607_0032051_603_2003 461
136 3300046506 Ga0495583_0011831 Ga0495583_0011831_1001_2401 461
137 3300046513 Ga0495616_0041576 Ga0495616_0041576_471_1871 461
138 3300046518 Ga0495631_0002673 Ga0495631_0002673_4235_5635 461
139 3300046522 Ga0495643_0060511 Ga0495643_0060511_449_1849 461
140 3300046542 Ga0495597_0000292 Ga0495597_0000292_20883_22283 461
141 3300046542 Ga0495597_0010574 Ga0495597_0010574_2208_3608 461
142 3300046616 Ga0495668_0000243 Ga0495668_0000243_46711_48096 461
143 3300046616 Ga0495668_0000733 Ga0495668_0000733_34572_35972 461
144 3300046660 Ga0495625_0031882 Ga0495625_0031882_356_1756 461
145 3300046665 Ga0495661_0073868 Ga0495661_0073868_175_1575 461
146 3300046692 Ga0495671_0010833 Ga0495671_0010833_2560_3960 461
147 3300046794 Ga0495589_0000077 Ga0495589_0000077_16420_17820 461
148 3300047446 Ga0495679_004238 Ga0495679_004238_2533_3933 461
149 3300047470 Ga0495681_0025432 Ga0495681_0025432_1103_2503 461
150 3300021361 Ga0213872_10013413 Ga0213872_100134132 462
151 3300039447 Ga0436361_0406312 Ga0436361_0406312_5195_6586 462
152 iso_pu_bacteria 2548876994 2550694989 462
153 iso_pu_bacteria 2600255292 2601671707 462
154 iso_pu_bacteria 2643221554 2643787904 462
155 iso_pu_bacteria 2643221556 2643801328 462
156 iso_pu_bacteria 2643221684 2644471746 462
157 iso_pu_bacteria 2738541297 2738828630 462
158 iso_pu_bacteria 2738541297 2738829705 462
159 iso_pu_bacteria 2738541357 2739152426 462
160 iso_pu_bacteria 2738541357 2739153501 462
161 iso_pu_bacteria 2738543003 2739194346 462
162 iso_pu_bacteria 2738543003 2739195421 462
163 iso_pu_bacteria 2738543026 2739320822 462
164 iso_pu_bacteria 2738543026 2739321897 462
165 iso_pu_bacteria 2738543029 2739339063 462
166 iso_pu_bacteria 2738543029 2739340138 462
167 iso_pu_bacteria 2808606386 2808982136 462
168 iso_pu_bacteria 2808606415 2809130064 462
169 iso_pu_bacteria 2808606418 2809143347 462
170 iso_pu_bacteria 2808606419 2809148881 462
171 iso_pu_bacteria 2818991436 2819540694 462
172 iso_pu_bacteria 2821131069 2821133615 462
173 iso_pu_bacteria 2842711865 2842714670 462
174 iso_pu_bacteria 2852618963 2852619015 462
175 iso_pu_bacteria 2857547612 2857552007 462
176 iso_pu_bacteria 2884811622 2884812479 462
177 iso_pu_bacteria 2884836552 2884839467 462
178 iso_pu_bacteria 2884852848 2884856723 462
179 iso_pu_bacteria 2896154374 2896158069 462
180 iso_pu_bacteria 2904424332 2904427056 462
181 iso_pu_bacteria 2919476304 2919477456 462
182 iso_pu_bacteria 2932422444 2932426353 462
183 iso_pu_bacteria 8047673197 8047673214 462
184 3300003771 Ga0055526_1000411 Ga0055526_100041117 463
185 3300010375 Ga0105239_10100540 Ga0105239_101005403 463
186 3300025295 Ga0209564_1000011 Ga0209564_1000011326 463
187 3300031548 Ga0307408_100000563 Ga0307408_1000005634 463
188 3300046512 Ga0495610_0014466 Ga0495610_0014466_111_1502 463
189 3300046558 Ga0495633_0042263 Ga0495633_0042263_580_1971 463
190 3300046794 Ga0495589_0014339 Ga0495589_0014339_461_1852 463
191 3300048925 Ga0496122_0022995 Ga0496122_0022995_3390_4781 463
192 3300048928 Ga0496125_0000484 Ga0496125_0000484_68014_69405 463
193 3300002739 JGI25158J39367_1000051 JGI25158J39367_10000517 464
194 3300002987 JGI25159J45721_1000360 JGI25159J45721_100036015 464
195 3300003374 JGI25161J50226_1001185 JGI25161J50226_10011859 464
196 3300004625 Ga0055543_1000532 Ga0055543_10005322 464
197 3300005262 Ga0065165_1000495 Ga0065165_100049538 464
198 3300025208 Ga0209436_100040 Ga0209436_10004025 464
199 3300025284 Ga0209130_1000217 Ga0209130_100021752 464
200 3300046457 Ga0495590_0000288 Ga0495590_0000288_21916_23310 464
201 3300048927 Ga0496124_0108369 Ga0496124_0108369_761_2158 464
202 3300003775 Ga0055524_1022717 Ga0055524_10227172 465
203 3300003791 Ga0055530_10009994 Ga0055530_100099942 465
204 3300021361 Ga0213872_10002605 Ga0213872_1000260512 465
205 3300025245 Ga0207425_1000048 Ga0207425_100004859 465
206 3300025245 Ga0207425_1000430 Ga0207425_100043019 465
207 3300025258 Ga0209129_1001011 Ga0209129_10010117 465
208 3300025263 Ga0209565_1000369 Ga0209565_100036932 465
209 3300025291 Ga0209675_1003368 Ga0209675_10033683 465
210 3300025294 Ga0209025_1005903 Ga0209025_10059035 465
211 3300025295 Ga0209564_1016764 Ga0209564_10167642 465
212 3300025297 Ga0209758_1002033 Ga0209758_100203311 465
213 3300025298 Ga0209050_1000011 Ga0209050_100001112 465
214 3300025299 Ga0209256_1000576 Ga0209256_100057612 465
215 3300025302 Ga0207426_1001978 Ga0207426_10019788 465
216 3300025304 Ga0209257_1000003 Ga0209257_1000003784 465
217 3300039447 Ga0436361_0126768 Ga0436361_0126768_8558_9955 465
218 3300002737 JGI25162J39368_1000414 JGI25162J39368_100041423 466
219 3300002987 JGI25159J45721_1001338 JGI25159J45721_10013387 466
220 3300003214 JGI25165J46597_1000135 JGI25165J46597_10001357 466
221 3300003322 rootL2_10002627 rootL2_100026273 466
222 3300003322 rootL2_10002628 rootL2_100026289 466
223 3300003751 Ga0055538_1000055 Ga0055538_10000557 466
224 3300003752 Ga0055539_1000080 Ga0055539_100008097 466
225 3300003756 Ga0055533_1000086 Ga0055533_100008697 466
226 3300003759 Ga0055525_1000047 Ga0055525_1000047133 466
227 3300003759 Ga0055525_1000114 Ga0055525_10001147 466
228 3300003791 Ga0055530_10004710 Ga0055530_100047102 466
229 3300003841 Ga0055541_1000057 Ga0055541_100005797 466
230 3300005262 Ga0065165_1000055 Ga0065165_1000055102 466
231 3300005327 Ga0070658_10051897 Ga0070658_100518974 466
232 3300005339 Ga0070660_100029160 Ga0070660_1000291604 466
233 3300005339 Ga0070660_100036216 Ga0070660_1000362163 466
234 3300005344 Ga0070661_100142928 Ga0070661_1001429282 466
235 3300005366 Ga0070659_100011628 Ga0070659_1000116285 466
236 3300005563 Ga0068855_100013933 Ga0068855_1000139333 466
237 3300005563 Ga0068855_100029634 Ga0068855_1000296341 466
238 3300006028 Ga0070717_10021632 Ga0070717_100216323 466
239 3300006946 Ga0079104_1016994 Ga0079104_10169942 466
240 3300009036 Ga0105244_10013171 Ga0105244_100131714 466
241 3300009148 Ga0105243_10046418 Ga0105243_100464183 466
242 3300009174 Ga0105241_10019596 Ga0105241_100195963 466
243 3300009176 Ga0105242_10028891 Ga0105242_100288914 466
244 3300013297 Ga0157378_10072750 Ga0157378_100727502 466
245 3300014497 Ga0182008_10000721 Ga0182008_100007213 466
246 3300015261 Ga0182006_1000002 Ga0182006_1000002243 466
247 3300015261 Ga0182006_1000023 Ga0182006_1000023206 466
248 3300015262 Ga0182007_10000090 Ga0182007_1000009049 466
249 3300015262 Ga0182007_10003196 Ga0182007_100031968 466
250 3300015265 Ga0182005_1000006 Ga0182005_1000006164 466
251 3300015265 Ga0182005_1000070 Ga0182005_100007070 466
252 3300015265 Ga0182005_1000628 Ga0182005_100062814 466
253 3300017792 Ga0163161_10004406 Ga0163161_1000440613 466
254 3300017792 Ga0163161_10102348 Ga0163161_101023481 466
255 3300021361 Ga0213872_10008391 Ga0213872_100083912 466
256 3300021361 Ga0213872_10022046 Ga0213872_100220461 466
257 3300025207 Ga0209760_100976 Ga0209760_1009763 466
258 3300025224 Ga0209784_100010 Ga0209784_100010164 466
259 3300025225 Ga0209566_100008 Ga0209566_100008164 466
260 3300025226 Ga0209674_100019 Ga0209674_100019164 466
261 3300025230 Ga0209563_100003 Ga0209563_100003664 466
262 3300025230 Ga0209563_100021 Ga0209563_100021164 466
263 3300025231 Ga0207427_100570 Ga0207427_10057011 466
264 3300025233 Ga0209437_100019 Ga0209437_100019164 466
265 3300025233 Ga0209437_100456 Ga0209437_10045627 466
266 3300025253 Ga0209677_100011 Ga0209677_100011164 466
267 3300025253 Ga0209677_106295 Ga0209677_1062952 466
268 3300025254 Ga0209148_1000211 Ga0209148_100021169 466
269 3300025261 Ga0209233_1000025 Ga0209233_1000025164 466
270 3300025263 Ga0209565_1002001 Ga0209565_10020016 466
271 3300025284 Ga0209130_1000091 Ga0209130_100009165 466
272 3300025298 Ga0209050_1002478 Ga0209050_10024786 466
273 3300025304 Ga0209257_1006716 Ga0209257_10067162 466
274 3300025728 Ga0207655_1008811 Ga0207655_10088118 466
275 3300025909 Ga0207705_10002801 Ga0207705_1000280110 466
276 3300025911 Ga0207654_10026205 Ga0207654_100262053 466
277 3300025913 Ga0207695_10000369 Ga0207695_1000036967 466
278 3300025919 Ga0207657_10043608 Ga0207657_100436083 466
279 3300025933 Ga0207706_10192136 Ga0207706_101921361 466
280 3300025934 Ga0207686_10002803 Ga0207686_100028035 466
281 3300025935 Ga0207709_10017706 Ga0207709_100177062 466
282 3300025949 Ga0207667_10043439 Ga0207667_100434395 466
283 3300026142 Ga0207698_10012397 Ga0207698_100123973 466
284 3300030744 Ga0316181_1189350 Ga0316181_11893501 466
285 3300031711 Ga0265314_10019704 Ga0265314_100197043 466
286 3300037312 Ga0395899_0001832 Ga0395899_0001832_7380_8780 466
287 3300037418 Ga0395900_0000148 Ga0395900_0000148_86518_87918 466
288 3300037418 Ga0395900_0000297 Ga0395900_0000297_32180_33580 466
289 3300037418 Ga0395900_0012155 Ga0395900_0012155_4787_6187 466
290 3300037418 Ga0395900_0038450 Ga0395900_0038450_624_2024 466
291 3300037418 Ga0395900_0142130 Ga0395900_0142130_495_1895 466
292 3300037418 Ga0395900_0178273 Ga0395900_0178273_601_2115 466
293 3300037418 Ga0395900_0290237 Ga0395900_0290237_177_1577 466
294 3300037466 Ga0395898_0044972 Ga0395898_0044972_710_2110 466
295 3300037471 Ga0395905_0017366 Ga0395905_0017366_4230_5630 466
296 3300038443 Ga0395901_0000182 Ga0395901_0000182_47936_49336 466
297 3300038443 Ga0395901_0186117 Ga0395901_0186117_554_1954 466
298 3300039447 Ga0436361_0169426 Ga0436361_0169426_3535_4935 466
299 3300039447 Ga0436361_0217458 Ga0436361_0217458_1656_3056 466
300 3300044683 Ga0466965_0082487 Ga0466965_0082487_77_1477 466
301 3300044684 Ga0466966_0003721 Ga0466966_0003721_8453_9853 466
302 3300044842 Ga0466957_0000033 Ga0466957_0000033_34212_35612 466
303 3300045836 Ga0466958_0022929 Ga0466958_0022929_1209_2609 466
304 3300045976 Ga0466967_0014085 Ga0466967_0014085_1612_3012 466
305 3300046452 Ga0495617_008478 Ga0495617_008478_259_1662 466
306 3300046457 Ga0495590_0000059 Ga0495590_0000059_39971_41371 466
307 3300046463 Ga0495653_0000011 Ga0495653_0000011_115492_116898 466
308 3300046463 Ga0495653_0013451 Ga0495653_0013451_2744_4144 466
309 3300046471 Ga0495650_0000051 Ga0495650_0000051_65232_66644 466
310 3300046471 Ga0495650_0000137 Ga0495650_0000137_166275_167675 466
311 3300046474 Ga0495605_0000044 Ga0495605_0000044_123788_125188 466
312 3300046474 Ga0495605_0000146 Ga0495605_0000146_11948_13348 466
313 3300046491 Ga0495584_0000017 Ga0495584_0000017_2280_3680 466
314 3300046491 Ga0495584_0000065 Ga0495584_0000065_9251_10657 466
315 3300046491 Ga0495584_0000778 Ga0495584_0000778_8953_10353 466
316 3300046491 Ga0495584_0011065 Ga0495584_0011065_1340_2743 466
317 3300046492 Ga0495585_0000125 Ga0495585_0000125_8818_10236 466
318 3300046492 Ga0495585_0003831 Ga0495585_0003831_514_1914 466
319 3300046492 Ga0495585_0014051 Ga0495585_0014051_246_1649 466
320 3300046492 Ga0495585_0016220 Ga0495585_0016220_132_1532 466
321 3300046500 Ga0495596_0008348 Ga0495596_0008348_2475_3878 466
322 3300046501 Ga0495607_0000867 Ga0495607_0000867_1225_2628 466
323 3300046501 Ga0495607_0001595 Ga0495607_0001595_2887_4287 466
324 3300046501 Ga0495607_0025395 Ga0495607_0025395_1361_2761 466
325 3300046501 Ga0495607_0071640 Ga0495607_0071640_137_1540 466
326 3300046501 Ga0495607_0071897 Ga0495607_0071897_334_1737 466
327 3300046506 Ga0495583_0000402 Ga0495583_0000402_644_2044 466
328 3300046506 Ga0495583_0000430 Ga0495583_0000430_29867_31270 466
329 3300046506 Ga0495583_0001133 Ga0495583_0001133_15199_16599 466
330 3300046506 Ga0495583_0003581 Ga0495583_0003581_6260_7660 466
331 3300046506 Ga0495583_0025589 Ga0495583_0025589_752_2155 466
332 3300046507 Ga0495606_0000024 Ga0495606_0000024_189984_191402 466
333 3300046507 Ga0495606_0000256 Ga0495606_0000256_13169_14569 466
334 3300046507 Ga0495606_0000284 Ga0495606_0000284_70346_71752 466
335 3300046507 Ga0495606_0028202 Ga0495606_0028202_1213_2619 466
336 3300046512 Ga0495610_0000008 Ga0495610_0000008_119800_121200 466
337 3300046512 Ga0495610_0000607 Ga0495610_0000607_19884_21284 466
338 3300046512 Ga0495610_0003277 Ga0495610_0003277_3596_4996 466
339 3300046512 Ga0495610_0019919 Ga0495610_0019919_1441_2859 466
340 3300046513 Ga0495616_0000139 Ga0495616_0000139_48384_49784 466
341 3300046513 Ga0495616_0000992 Ga0495616_0000992_7318_8718 466
342 3300046513 Ga0495616_0008570 Ga0495616_0008570_192_1595 466
343 3300046513 Ga0495616_0011699 Ga0495616_0011699_1904_3304 466
344 3300046515 Ga0495620_0009913 Ga0495620_0009913_1604_3007 466
345 3300046518 Ga0495631_0003297 Ga0495631_0003297_3705_5105 466
346 3300046519 Ga0495632_0000221 Ga0495632_0000221_25202_26602 466
347 3300046520 Ga0495637_0000011 Ga0495637_0000011_30137_31537 466
348 3300046522 Ga0495643_0006149 Ga0495643_0006149_1066_2466 466
349 3300046522 Ga0495643_0006967 Ga0495643_0006967_700_2100 466
350 3300046524 Ga0495648_0000053 Ga0495648_0000053_92065_93483 466
351 3300046524 Ga0495648_0001443 Ga0495648_0001443_2425_3825 466
352 3300046524 Ga0495648_0005312 Ga0495648_0005312_2083_3483 466
353 3300046525 Ga0495663_0037846 Ga0495663_0037846_16_1416 466
354 3300046531 Ga0495665_0000780 Ga0495665_0000780_13156_14556 466
355 3300046538 Ga0495609_0000628 Ga0495609_0000628_2063_3466 466
356 3300046557 Ga0495622_0000002 Ga0495622_0000002_231840_233240 466
357 3300046558 Ga0495633_0000332 Ga0495633_0000332_2076_3476 466
358 3300046558 Ga0495633_0001177 Ga0495633_0001177_8324_9724 466
359 3300046558 Ga0495633_0013159 Ga0495633_0013159_2095_3498 466
360 3300046558 Ga0495633_0021001 Ga0495633_0021001_1146_2549 466
361 3300046558 Ga0495633_0036160 Ga0495633_0036160_371_1789 466
362 3300046616 Ga0495668_0000051 Ga0495668_0000051_64020_65438 466
363 3300046616 Ga0495668_0002164 Ga0495668_0002164_11218_12618 466
364 3300046648 Ga0495611_0000748 Ga0495611_0000748_60_1460 466
365 3300046648 Ga0495611_0005581 Ga0495611_0005581_1994_3394 466
366 3300046648 Ga0495611_0012984 Ga0495611_0012984_192_1595 466
367 3300046660 Ga0495625_0000391 Ga0495625_0000391_39216_40616 466
368 3300046660 Ga0495625_0037347 Ga0495625_0037347_494_1897 466
369 3300046660 Ga0495625_0081956 Ga0495625_0081956_176_1576 466
370 3300046665 Ga0495661_0003531 Ga0495661_0003531_5625_7025 466
371 3300046665 Ga0495661_0007559 Ga0495661_0007559_4237_5697 466
372 3300046665 Ga0495661_0012266 Ga0495661_0012266_888_2288 466
373 3300046665 Ga0495661_0045785 Ga0495661_0045785_666_2066 466
374 3300046665 Ga0495661_0075259 Ga0495661_0075259_146_1549 466
375 3300046684 Ga0495669_0000086 Ga0495669_0000086_58485_59885 466
376 3300046684 Ga0495669_0001321 Ga0495669_0001321_2428_3828 466
377 3300046684 Ga0495669_0017343 Ga0495669_0017343_280_1683 466
378 3300046691 Ga0495670_0005466 Ga0495670_0005466_1713_3116 466
379 3300046691 Ga0495670_0107303 Ga0495670_0107303_25_1428 466
380 3300046692 Ga0495671_0000002 Ga0495671_0000002_726127_727527 466
381 3300046692 Ga0495671_0004220 Ga0495671_0004220_4355_5755 466
382 3300046694 Ga0495649_0000141 Ga0495649_0000141_16132_17532 466
383 3300046694 Ga0495649_0003157 Ga0495649_0003157_102_1502 466
384 3300046794 Ga0495589_0000078 Ga0495589_0000078_57057_58457 466
385 3300046810 Ga0495660_0000271 Ga0495660_0000271_6631_8031 466
386 3300046810 Ga0495660_0010181 Ga0495660_0010181_375_1775 466
387 3300046810 Ga0495660_0021139 Ga0495660_0021139_936_2339 466
388 3300046810 Ga0495660_0069104 Ga0495660_0069104_391_1794 466
389 3300047318 Ga0495636_0006080 Ga0495636_0006080_275_1678 466
390 3300047320 Ga0495672_0000014 Ga0495672_0000014_322119_323519 466
391 3300047320 Ga0495672_0000094 Ga0495672_0000094_132909_134309 466
392 3300047320 Ga0495672_0011617 Ga0495672_0011617_392_1795 466
393 3300047323 Ga0495683_0000933 Ga0495683_0000933_10705_12105 466
394 3300047323 Ga0495683_0029887 Ga0495683_0029887_1282_2685 466
395 3300047443 Ga0495687_000030 Ga0495687_000030_252517_253917 466
396 3300047443 Ga0495687_000065 Ga0495687_000065_44374_45774 466
397 3300047443 Ga0495687_001361 Ga0495687_001361_873_2273 466
398 3300047443 Ga0495687_004703 Ga0495687_004703_2705_4105 466
399 3300047443 Ga0495687_007019 Ga0495687_007019_4393_5796 466
400 3300047444 Ga0495675_0033959 Ga0495675_0033959_1654_3054 466
401 3300047445 Ga0495677_0000755 Ga0495677_0000755_1895_3295 466
402 3300047445 Ga0495677_0007243 Ga0495677_0007243_2315_3775 466
403 3300047445 Ga0495677_0007623 Ga0495677_0007623_2105_3505 466
404 3300047446 Ga0495679_000706 Ga0495679_000706_17878_19278 466
405 3300047447 Ga0495685_000115 Ga0495685_000115_24603_26003 466
406 3300047469 Ga0495673_0000016 Ga0495673_0000016_459616_461016 466
407 3300047469 Ga0495673_0000035 Ga0495673_0000035_282481_283884 466
408 3300047469 Ga0495673_0025653 Ga0495673_0025653_1299_2702 466
409 3300047470 Ga0495681_0008481 Ga0495681_0008481_1744_3144 466
410 3300047470 Ga0495681_0011903 Ga0495681_0011903_901_2301 466
411 3300047472 Ga0495686_0000054 Ga0495686_0000054_243750_245150 466
412 3300047472 Ga0495686_0004730 Ga0495686_0004730_7945_9363 466
413 3300048088 Ga0495602_0001408 Ga0495602_0001408_3522_4922 466
414 3300048088 Ga0495602_0023224 Ga0495602_0023224_3646_5046 466
415 3300048089 Ga0495614_0025097 Ga0495614_0025097_1011_2411 466
416 3300048091 Ga0495626_0000359 Ga0495626_0000359_4022_5422 466
417 3300048091 Ga0495626_0002135 Ga0495626_0002135_11821_13221 466
418 3300048905 Ga0496102_0232185 Ga0496102_0232185_225_1625 466
419 3300048906 Ga0496103_0000716 Ga0496103_0000716_762_2162 466
420 3300048916 Ga0496113_0000575 Ga0496113_0000575_504_1904 466
421 3300048920 Ga0496117_0000001 Ga0496117_0000001_1804626_1806026 466
422 3300048921 Ga0496118_0000078 Ga0496118_0000078_113738_115138 466
423 3300048924 Ga0496121_0002173 Ga0496121_0002173_2069_3469 466
424 3300048924 Ga0496121_0067944 Ga0496121_0067944_658_2058 466
425 3300048925 Ga0496122_0000445 Ga0496122_0000445_84664_86064 466
426 3300048925 Ga0496122_0001494 Ga0496122_0001494_10563_11963 466
427 3300048926 Ga0496123_0001531 Ga0496123_0001531_30029_31429 466
428 3300048926 Ga0496123_0001851 Ga0496123_0001851_2137_3543 466
429 3300048926 Ga0496123_0007957 Ga0496123_0007957_4869_6269 466
430 3300048926 Ga0496123_0037204 Ga0496123_0037204_1955_3355 466
431 3300048927 Ga0496124_0008566 Ga0496124_0008566_3645_5045 466
432 3300048927 Ga0496124_0046356 Ga0496124_0046356_406_1806 466
433 3300048928 Ga0496125_0000256 Ga0496125_0000256_100632_102032 466
434 3300048928 Ga0496125_0002437 Ga0496125_0002437_22309_23709 466
435 3300048928 Ga0496125_0026622 Ga0496125_0026622_456_1856 466
436 3300049459 Ga0495678_008746 Ga0495678_008746_2503_3903 466
437 3300049460 Ga0495682_0004098 Ga0495682_0004098_4538_5941 466
438 3300049766 Ga0501269_000553 Ga0501269_000553_3571_4971 466
439 3300049822 Ga0501035_0001544 Ga0501035_0001544_20399_21799 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

65

127

0.98

PF00155

Aminotran_1_2

Aminotransferase class I and II

135

488

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2du9-assembly1.cif.gz_A crystal structure of the transcriptional factor from c.glutamicum 0.9251 24 91
6sbs-assembly1.cif.gz_A ytra from sulfolobus acidocaldarius, a gntr-family transcription factor 0.9094 15 91
3eet-assembly1.cif.gz_A-2 crystal structure of putative gntr-family transcriptional regulator 0.8978 25 91
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.8935 18 90
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.8868 22 90
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9569 47 89 1.10.10.10
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9477 18 91 1.10.10.10
af_Q2G0Q2_1_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9408 24 91 1.10.10.10
af_P0ACM5_16_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.933 18 89 1.10.10.10
2ek5D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9177 24 91 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A519GMX3-F1-model_v4 PLP-dependent aminotransferase family protein 0.9309 186 466 GO:0008483
GO:0009058
GO:0030170
AF-A0A4V1TY65-F1-model_v4 deleted 0.9307 129 455
AF-A0A0R3MPE4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9298 105 455 GO:0009058
GO:0016747
GO:0030170
AF-A0A6N7Z2S4-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9279 101 456 GO:0008483
GO:0017000
GO:0030170
AF-A0A519GMX3-F1-model_v4 PLP-dependent aminotransferase family protein 0.9278 186 466 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
79.15 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map