F444239

General Info

Members Datasets Scaffolds Average Seq Length
439 325 384 349

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0219067|Ga0316582_0219067_45_1139
Length 364
Sequence MSERDSTLRDKAFLVLLVLVTLAFGWILLPFYGAILWATVLATVFAPTHRWLLNVNAMAGRPNLAALVTLLIIVGIVLLPLALTVGSLIAEATSLYERVQSGQVDLGSIFQNFLDALPSWASSLFGRLGLTDVGDIQSRLVAILKEGGQFFATQAVLVGQGTANFVISLGIMLYLLFFLLRDGEAIAGAVRHAIPLRSEEKGALYERYTVVVRAMIKGTVLVAVVQGALGGLIFWLLGIHSPVLWGVVMAFMSLLPAIGAAAVWLPVAIYLLVTGAVLKGIVLIAFGAGVIGLVDNLLRPYLVGKSTRMPDFIVLLSTLGGIAILGLNGFVVGPLIAAMFFAAWDIAAGASTGTQAPDGPSQKT

Samples

Sample ID Description Type Environment
1 2511231010 Pseudomonas sp. GM25 Isolate Nodule
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738541307 Variovorax sp. GV008 Isolate Unclassified
17 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
18 2738543019 Variovorax sp. GV040 Isolate Unclassified
19 2791355199
20 2818991446 Variovorax sp. 1180 Isolate Unclassified
21 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2842677519 Variovorax sp. R-72495 Isolate Unclassified
24 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
25 2885198086 Variovorax sp. 679 Isolate Unclassified
26 2885211737 Variovorax sp. 553 Isolate Unclassified
27 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
28 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
29 2899924645 Variovorax sp. 369 Isolate Unclassified
30 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
31 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
32 2904456579 Variovorax sp. 2002 Isolate Unclassified
33 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
34 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
35 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
36 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
43 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
44 2929520902 Variovorax beijingensis 502 Isolate Unclassified
45 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
46 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
47 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
48 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
49 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
52 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
68 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
180 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
181 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
182 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
201 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
202 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
203 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
204 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
205 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
279 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
304 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
305 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
306 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
309 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
310 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
311 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
312 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
316 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
317 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
318 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
322 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
323 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
324 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
325 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.44
Metatranscriptomes 0.23
Isolates 12.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.74
Nodule 3.87
Rhizoplane 3.64
Rhizosphere 53.3
Stem 0
Stem Tuber 0
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030794 3300001979 Bacteria 1739
2 JGI25152J39213_1004543 3300002773 Bacteria 4336
3 JGI25150J39212_1000830 3300002774 Bacteria 10388
4 JGI25151J46595_10011705 3300003187 Bacteria 4020
5 JGI25153J46596_10007821 3300003215 Bacteria 5192
6 rootH1_10046429 3300003316 Bacteria 4487
7 Ga0006562J51391_1073750 3300003578 Bacteria 4780
8 Ga0055525_1003271 3300003759 Bacteria 1469
9 Ga0055535_1000075 3300003761 Bacteria 111667
10 Ga0055542_1000059 3300003762 Bacteria 162670
11 Ga0055542_1000492 3300003762 Bacteria 36378
12 Ga0055526_1005342 3300003771 Bacteria 7421
13 Ga0055537_1000837 3300003773 Bacteria 15045
14 Ga0055537_1006347 3300003773 Bacteria 3015
15 Ga0055524_1002063 3300003775 Bacteria 10667
16 Ga0055536_1012972 3300003781 Bacteria 3044
17 Ga0055536_1022343 3300003781 Bacteria 1890
18 Ga0055534_1000736 3300003784 Bacteria 15758
19 Ga0055534_1006835 3300003784 Bacteria 2813
20 Ga0055528_1002672 3300003790 Bacteria 9405
21 Ga0055540_1013419 3300003792 Bacteria 2503
22 Ga0055541_1000400 3300003841 Bacteria 13001
23 Ga0065714_10081624 3300005288 Bacteria 2361
24 Ga0065704_10181552 3300005289 Bacteria 1234
25 Ga0070676_10201864 3300005328 Bacteria 1304
26 Ga0070683_100318551 3300005329 Bacteria 1480
27 Ga0068869_100122372 3300005334 Bacteria 1991
28 Ga0068868_100075276 3300005338 Bacteria 2698
29 Ga0068868_100315538 3300005338 Bacteria 1331
30 Ga0070689_100234804 3300005340 Bacteria 1509
31 Ga0070661_100018105 3300005344 Bacteria 5005
32 Ga0070668_100038744 3300005347 Bacteria 3645
33 Ga0070668_100153639 3300005347 Bacteria 1863
34 Ga0070669_100048663 3300005353 Bacteria 3095
35 Ga0070669_100098562 3300005353 Bacteria 2202
36 Ga0070659_100132942 3300005366 Bacteria 2021
37 Ga0070667_100030847 3300005367 Bacteria 4470
38 Ga0070667_100207945 3300005367 Bacteria 1739
39 Ga0070663_100199494 3300005455 Bacteria 1561
40 Ga0070678_100006298 3300005456 Bacteria 6954
41 Ga0070678_100099661 3300005456 Bacteria 2248
42 Ga0070662_100075115 3300005457 Bacteria 2502
43 Ga0070662_100184008 3300005457 Bacteria 1649
44 Ga0070681_10001556 3300005458 Bacteria 20332
45 Ga0070685_10015586 3300005466 Bacteria 4039
46 Ga0070699_100261424 3300005518 Bacteria 1548
47 Ga0070679_100048657 3300005530 Bacteria 4223
48 Ga0068853_100017694 3300005539 Bacteria 5882
49 Ga0068853_100053977 3300005539 Bacteria 3462
50 Ga0070665_100015331 3300005548 Bacteria 7695
51 Ga0068855_100197533 3300005563 Bacteria 2266
52 Ga0068854_100263736 3300005578 Bacteria 1380
53 Ga0070702_100115724 3300005615 Bacteria 1670
54 Ga0068861_100038336 3300005719 Bacteria 3567
55 Ga0068858_100129256 3300005842 Bacteria 2367
56 Ga0068860_100009962 3300005843 Bacteria 9418
57 Ga0068860_100245597 3300005843 Bacteria 1742
58 Ga0081540_1000373 3300005983 Bacteria 44890
59 Ga0081540_1000904 3300005983 Bacteria 26798
60 Ga0081539_10015306 3300005985 Bacteria 5585
61 Ga0075365_10039301 3300006038 Bacteria 3080
62 Ga0075365_10152165 3300006038 Bacteria 1609
63 Ga0075365_10189872 3300006038 Bacteria 1438
64 Ga0075363_100005081 3300006048 Bacteria 5817
65 Ga0075363_100015875 3300006048 Bacteria 3709
66 Ga0075363_100043973 3300006048 Bacteria 2364
67 Ga0075363_100080752 3300006048 Bacteria 1778
68 Ga0075364_10103684 3300006051 Bacteria 1894
69 Ga0075362_10116737 3300006177 Bacteria 1260
70 Ga0075370_10011621 3300006353 Bacteria 4631
71 Ga0075370_10013642 3300006353 Bacteria 4324
72 Ga0075428_100302855 3300006844 Bacteria 1718
73 Ga0075431_100505225 3300006847 Bacteria 1200
74 Ga0099826_10000504 3300006948 Bacteria 19119
75 Ga0099826_10052343 3300006948 Bacteria 2728
76 Ga0105244_10008305 3300009036 Bacteria 6495
77 Ga0105250_10011219 3300009092 Bacteria 3719
78 Ga0105240_10138574 3300009093 Unclassified 2911
79 Ga0105245_10126806 3300009098 Bacteria 2390
80 Ga0105245_10295607 3300009098 Bacteria 1587
81 Ga0105245_10358390 3300009098 Bacteria 1447
82 Ga0114129_10097158 3300009147 Bacteria 4077
83 Ga0105243_10001924 3300009148 Bacteria 17707
84 Ga0105243_10045835 3300009148 Bacteria 3438
85 Ga0105242_10251734 3300009176 Bacteria 1592
86 Ga0105237_10087650 3300009545 Bacteria 3102
87 Ga0105237_10091963 3300009545 Bacteria 3023
88 Ga0105238_10098758 3300009551 Bacteria 2903
89 Ga0105239_10074442 3300010375 Unclassified 3734
90 Ga0105246_10060672 3300011119 Bacteria 2629
91 Ga0157370_10035531 3300013104 Bacteria 4842
92 Ga0157369_10003782 3300013105 Bacteria 17978
93 Ga0157374_10248465 3300013296 Bacteria 1750
94 Ga0163162_10316130 3300013306 Bacteria 1694
95 Ga0163162_10390199 3300013306 Bacteria 1525
96 Ga0157372_10028982 3300013307 Bacteria 6040
97 Ga0157375_10114095 3300013308 Bacteria 2803
98 Ga0157375_10477532 3300013308 Bacteria 1412
99 Ga0163163_10561971 3300014325 Bacteria 1204
100 Ga0182008_10003982 3300014497 Bacteria 8738
101 Ga0182008_10030820 3300014497 Bacteria 2702
102 Ga0157376_10133491 3300014969 Bacteria 2218
103 Ga0182006_1006221 3300015261 Bacteria 5571
104 Ga0182006_1047574 3300015261 Bacteria 1661
105 Ga0182007_10001421 3300015262 Bacteria 12850
106 Ga0163161_10002814 3300017792 Bacteria 12343
107 Ga0163161_10257860 3300017792 Bacteria 1361
108 Ga0209674_100131 3300025226 Bacteria 118079
109 Ga0209672_100686 3300025228 Bacteria 17031
110 Ga0209147_100661 3300025229 Bacteria 17862
111 Ga0209563_104458 3300025230 Bacteria 2672
112 Ga0209258_100078 3300025242 Bacteria 263996
113 Ga0207425_1000247 3300025245 Bacteria 41129
114 Ga0209646_1000058 3300025246 Bacteria 259999
115 Ga0209148_1000043 3300025254 Bacteria 461531
116 Ga0209148_1000086 3300025254 Bacteria 263996
117 Ga0209759_1002890 3300025256 Bacteria 7248
118 Ga0209129_1000116 3300025258 Bacteria 140716
119 Ga0209129_1003553 3300025258 Bacteria 6707
120 Ga0209129_1005090 3300025258 Bacteria 4819
121 Ga0209565_1000353 3300025263 Bacteria 40174
122 Ga0209565_1000921 3300025263 Bacteria 15679
123 Ga0209673_1000190 3300025273 Bacteria 123411
124 Ga0209673_1002054 3300025273 Bacteria 15226
125 Ga0209130_1000635 3300025284 Bacteria 33021
126 Ga0209130_1000823 3300025284 Bacteria 26100
127 Ga0209675_1000038 3300025291 Bacteria 250481
128 Ga0209675_1000349 3300025291 Bacteria 40171
129 Ga0209676_1000125 3300025292 Bacteria 191565
130 Ga0209676_1001150 3300025292 Bacteria 28948
131 Ga0209025_1000238 3300025294 Bacteria 128478
132 Ga0209025_1000256 3300025294 Bacteria 125758
133 Ga0209025_1000293 3300025294 Bacteria 111845
134 Ga0209025_1011228 3300025294 Bacteria 5935
135 Ga0209564_1000201 3300025295 Bacteria 136907
136 Ga0209564_1000918 3300025295 Bacteria 38443
137 Ga0209758_1000034 3300025297 Bacteria 467637
138 Ga0209758_1004806 3300025297 Bacteria 10912
139 Ga0209758_1005668 3300025297 Bacteria 9448
140 Ga0209758_1009383 3300025297 Bacteria 6092
141 Ga0209050_1000012 3300025298 Bacteria 813717
142 Ga0209050_1021029 3300025298 Bacteria 2399
143 Ga0209256_1000677 3300025299 Bacteria 46076
144 Ga0209256_1000969 3300025299 Bacteria 34493
145 Ga0207426_1000244 3300025302 Bacteria 120371
146 Ga0207426_1000795 3300025302 Bacteria 34244
147 Ga0209051_1000524 3300025303 Bacteria 47751
148 Ga0209051_1002812 3300025303 Bacteria 12006
149 Ga0209257_1000024 3300025304 Bacteria 726068
150 Ga0207656_10001163 3300025321 Bacteria 8646
151 Ga0207655_1041766 3300025728 Bacteria 1961
152 Ga0207688_10065471 3300025901 Bacteria 2054
153 Ga0207645_10133104 3300025907 Bacteria 1619
154 Ga0207707_10009035 3300025912 Bacteria 8661
155 Ga0207695_10068981 3300025913 Bacteria 3620
156 Ga0207649_10010842 3300025920 Bacteria 5010
157 Ga0207652_10083387 3300025921 Bacteria 2799
158 Ga0207681_10100716 3300025923 Bacteria 2083
159 Ga0207694_10167209 3300025924 Bacteria 1779
160 Ga0207690_10023608 3300025932 Bacteria 3840
161 Ga0207709_10000393 3300025935 Bacteria 43216
162 Ga0207709_10000610 3300025935 Bacteria 29558
163 Ga0207709_10002972 3300025935 Bacteria 10334
164 Ga0207709_10026757 3300025935 Bacteria 3316
165 Ga0207689_10015143 3300025942 Bacteria 6537
166 Ga0207679_10156420 3300025945 Bacteria 1862
167 Ga0207712_10047420 3300025961 Bacteria 2983
168 Ga0207712_10079222 3300025961 Bacteria 2386
169 Ga0207668_10017167 3300025972 Bacteria 4530
170 Ga0207640_10185138 3300025981 Bacteria 1565
171 Ga0207658_10151413 3300025986 Bacteria 1890
172 Ga0207639_10016065 3300026041 Bacteria 5289
173 Ga0207639_10069576 3300026041 Bacteria 2746
174 Ga0207639_10155562 3300026041 Bacteria 1920
175 Ga0207678_10116956 3300026067 Bacteria 2275
176 Ga0207678_10160799 3300026067 Bacteria 1918
177 Ga0207648_10045959 3300026089 Bacteria 3828
178 Ga0207674_10113504 3300026116 Bacteria 2682
179 Ga0207683_10064868 3300026121 Bacteria 3219
180 Ga0209282_1000751 3300027666 Bacteria 16345
181 Ga0209282_1037163 3300027666 Bacteria 2930
182 Ga0268266_10000544 3300028379 Bacteria 52629
183 Ga0268266_10072738 3300028379 Bacteria 2982
184 Ga0268266_10254874 3300028379 Bacteria 1624
185 Ga0268265_10148035 3300028380 Bacteria 1976
186 Ga0268265_10384280 3300028380 Bacteria 1292
187 Ga0268264_10037322 3300028381 Bacteria 4006
188 Ga0307517_10123164 3300028786 Bacteria 1906
189 Ga0316177_1189767 3300030731 Bacteria 4096
190 Ga0314311_1075878 3300030733 Bacteria 2697
191 Ga0316180_1125658 3300030736 Bacteria 2121
192 Ga0316183_1055144 3300030742 Bacteria 4359
193 Ga0307509_10208169 3300031507 Bacteria 1784
194 Ga0307408_100284892 3300031548 Bacteria 1377
195 Ga0307516_10244600 3300031730 Bacteria 1491
196 Ga0307405_10070240 3300031731 Bacteria 2248
197 Ga0307405_10152474 3300031731 Bacteria 1627
198 Ga0307413_10038382 3300031824 Bacteria 2775
199 Ga0307410_10113967 3300031852 Bacteria 1961
200 Ga0307406_10004851 3300031901 Bacteria 7325
201 Ga0307406_10072345 3300031901 Bacteria 2263
202 Ga0307412_10036572 3300031911 Bacteria 3147
203 Ga0307412_10116253 3300031911 Bacteria 1918
204 Ga0307412_10282787 3300031911 Bacteria 1303
205 Ga0307416_100222281 3300032002 Bacteria 1812
206 Ga0307416_100327011 3300032002 Bacteria 1539
207 Ga0307411_10045350 3300032005 Bacteria 2827
208 Ga0307411_10115164 3300032005 Bacteria 1933
209 Ga0307415_100034576 3300032126 Bacteria 3292
210 Ga0307415_100195971 3300032126 Bacteria 1598
211 Ga0307415_100241145 3300032126 Bacteria 1462
212 Ga0307510_10004428 3300033180 Bacteria 16533
213 Ga0373931_0020425 3300035691 Bacteria 3315
214 Ga0373935_0233088 3300035692 Bacteria 1283
215 Ga0316582_0219067 3300036647 Bacteria 1301
216 Ga0439466_0021704 3300041411 Bacteria 2272
217 Ga0439465_0013572 3300041413 Bacteria 2538
218 Ga0439465_0019809 3300041413 Bacteria 2104
219 Ga0451800_1505967 3300041459 Bacteria 1234
220 Ga0439442_004832 3300042002 Bacteria 2681
221 Ga0450898_012962 3300042134 Bacteria 1384
222 Ga0450906_020133 3300042145 Bacteria 1194
223 Ga0450910_001575 3300042147 Bacteria 2905
224 Ga0450908_008313 3300042184 Bacteria 1945
225 Ga0439434_0009637 3300042435 Bacteria 2842
226 Ga0450918_001535 3300042531 Bacteria 4555
227 Ga0466965_0025622 3300044683 Bacteria 2855
228 Ga0466957_0012425 3300044842 Bacteria 4928
229 Ga0495627_030027 3300046453 Bacteria 1725
230 Ga0495603_0014166 3300046455 Bacteria 4824
231 Ga0495629_0018559 3300046459 Bacteria 4974
232 Ga0495638_0028723 3300046460 Bacteria 3589
233 Ga0495638_0035509 3300046460 Bacteria 3177
234 Ga0495651_0018464 3300046462 Bacteria 5401
235 Ga0495653_0041874 3300046463 Bacteria 3572
236 Ga0495585_0078032 3300046492 Bacteria 1797
237 Ga0495608_0070542 3300046511 Bacteria 2280
238 Ga0495610_0030640 3300046512 Bacteria 2815
239 Ga0495616_0003489 3300046513 Bacteria 10059
240 Ga0495620_0010863 3300046515 Bacteria 4782
241 Ga0495631_0002133 3300046518 Bacteria 11448
242 Ga0495637_0028620 3300046520 Bacteria 2487
243 Ga0495652_0014113 3300046529 Bacteria 7175
244 Ga0495654_0031035 3300046530 Bacteria 2714
245 Ga0495656_0002595 3300046615 Bacteria 6028
246 Ga0495656_0014493 3300046615 Bacteria 2957
247 Ga0495668_0034699 3300046616 Bacteria 2829
248 Ga0495668_0092277 3300046616 Bacteria 1659
249 Ga0495634_0021794 3300046642 Bacteria 4523
250 Ga0495611_0115649 3300046648 Bacteria 1250
251 Ga0495625_0000317 3300046660 Bacteria 73568
252 Ga0495625_0009575 3300046660 Bacteria 8094
253 Ga0495625_0048587 3300046660 Bacteria 3054
254 Ga0495625_0069593 3300046660 Bacteria 2472
255 Ga0495625_0129951 3300046660 Bacteria 1707
256 Ga0495635_0001873 3300046663 Bacteria 14252
257 Ga0495661_0152012 3300046665 Bacteria 1250
258 Ga0495588_0021600 3300046674 Bacteria 3173
259 Ga0495657_0006464 3300046675 Bacteria 9168
260 Ga0495624_0010228 3300046690 Bacteria 6468
261 Ga0495671_0008968 3300046692 Bacteria 5615
262 Ga0495581_0031582 3300047315 Bacteria 3068
263 Ga0495604_0003570 3300047317 Bacteria 12403
264 Ga0495674_0244407 3300047319 Bacteria 1478
265 Ga0495672_0023819 3300047320 Bacteria 3955
266 Ga0495672_0044892 3300047320 Bacteria 2648
267 Ga0495676_0094010 3300047321 Bacteria 2234
268 Ga0495686_0208146 3300047472 Bacteria 1119
269 Ga0495602_0027002 3300048088 Bacteria 5529
270 Ga0495614_0089648 3300048089 Bacteria 1337
271 Ga0496100_0050567 3300048903 Bacteria 2694
272 Ga0496102_0049264 3300048905 Bacteria 3832
273 Ga0496102_0184469 3300048905 Bacteria 1966
274 Ga0496102_0256303 3300048905 Bacteria 1649
275 Ga0496104_0001785 3300048907 Bacteria 18633
276 Ga0496105_0010712 3300048908 Bacteria 7215
277 Ga0496106_0086583 3300048909 Bacteria 2413
278 Ga0496106_0196507 3300048909 Bacteria 1605
279 Ga0496108_0076893 3300048911 Bacteria 2822
280 Ga0496111_0410949 3300048914 Bacteria 1000
281 Ga0496114_0091418 3300048917 Bacteria 2585
282 Ga0496115_0363675 3300048918 Bacteria 1179
283 Ga0496116_0030763 3300048919 Bacteria 3852
284 Ga0496117_0020413 3300048920 Bacteria 5401
285 Ga0496118_0022408 3300048921 Bacteria 5521
286 Ga0496118_0074779 3300048921 Bacteria 2420
287 Ga0496119_0005077 3300048922 Bacteria 12779
288 Ga0496120_0004945 3300048923 Bacteria 10829
289 Ga0496121_0000657 3300048924 Bacteria 64819
290 Ga0496121_0015817 3300048924 Bacteria 7853
291 Ga0496121_0031555 3300048924 Bacteria 4837
292 Ga0496121_0064316 3300048924 Bacteria 2991
293 Ga0496122_0073088 3300048925 Bacteria 2434
294 Ga0496122_0089630 3300048925 Bacteria 2102
295 Ga0496123_0085320 3300048926 Bacteria 1900
296 Ga0496124_0003777 3300048927 Bacteria 18188
297 Ga0496124_0038288 3300048927 Bacteria 4165
298 Ga0496124_0080905 3300048927 Bacteria 2672
299 Ga0496125_0056895 3300048928 Bacteria 3172
300 Ga0496125_0095611 3300048928 Bacteria 2209
301 Ga0496125_0096287 3300048928 Bacteria 2198
302 Ga0496126_0002447 3300048929 Bacteria 25067
303 Ga0496126_0010928 3300048929 Bacteria 9456
304 Ga0496126_0138551 3300048929 Bacteria 2096
305 Ga0496126_0139919 3300048929 Bacteria 2084
306 Ga0496126_0229862 3300048929 Bacteria 1554
307 Ga0495678_031146 3300049459 Bacteria 2227
308 Ga0501037_0008623 3300049573 Bacteria 7474
309 Ga0501038_0030734 3300049574 Bacteria 4749
310 Ga0501038_0155448 3300049574 Bacteria 1863
311 Ga0501039_0013310 3300049575 Bacteria 6289
312 Ga0501039_0114018 3300049575 Bacteria 2114
313 Ga0501039_0195226 3300049575 Bacteria 1591
314 Ga0501040_0039424 3300049576 Bacteria 3212
315 Ga0501041_0028667 3300049577 Bacteria 3358
316 Ga0501046_0065067 3300049580 Bacteria 2845
317 Ga0501048_0060608 3300049582 Bacteria 2681
318 Ga0501070_0192525 3300049586 Bacteria 1676
319 Ga0501071_0072130 3300049587 Bacteria 2518
320 Ga0501074_0049862 3300049590 Bacteria 3022
321 Ga0501075_0095003 3300049591 Bacteria 2262
322 Ga0501076_0112031 3300049592 Bacteria 2206
323 Ga0501077_0033072 3300049593 Bacteria 3292
324 Ga0501249_003761 3300049679 Bacteria 3059
325 Ga0501225_0005379 3300049705 Bacteria 3762
326 Ga0501079_0341715 3300049741 Bacteria 1173
327 Ga0501080_0090973 3300049742 Bacteria 2834
328 Ga0501081_0036258 3300049743 Bacteria 3362
329 Ga0501083_0005761 3300049744 Bacteria 8767
330 Ga0501262_002652 3300049759 Bacteria 2022
331 Ga0501035_0007303 3300049822 Bacteria 10333
332 Ga0501035_0009010 3300049822 Bacteria 9280
333 Ga0501035_0022843 3300049822 Bacteria 5744
334 Ga0501044_0013034 3300049823 Bacteria 8998
335 Ga0501044_0032718 3300049823 Bacteria 5466
336 Ga0501044_0290445 3300049823 Bacteria 1566
337 Ga0501045_0042693 3300049824 Bacteria 3301
338 nmdc:mga03683_10601_c1 3300050489 Bacteria 3310
339 nmdc:mga03683_10673_c1 3300050489 Bacteria 3300
340 nmdc:mga03n38_54365_c1 3300050490 Bacteria 1799
341 nmdc:mga03n38_8675_c1 3300050490 Bacteria 3661
342 nmdc:mga00v17_33900_c1 3300050491 Bacteria 3029
343 nmdc:mga0yw44_57504_c1 3300050492 Bacteria 2373
344 nmdc:mga0k408_3020_c1 3300050493 Bacteria 8922
345 nmdc:mga0k408_36738_c1 3300050493 Bacteria 2812
346 nmdc:mga06z11_40680_c1 3300050494 Bacteria 2321
347 nmdc:mga07m45_1344_c1 3300050496 Bacteria 11210
348 nmdc:mga07m45_246_c1 3300050496 Bacteria 22038
349 nmdc:mga07m45_3901_c1 3300050496 Bacteria 7244
350 nmdc:mga07m45_5601_c1 3300050496 Bacteria 6272
351 nmdc:mga05p37_116256_c1 3300050507 Bacteria 3287
352 nmdc:mga08y16_310429_c1 3300050511 Bacteria 1624
353 nmdc:mga0sz30_57048_c1 3300050516 Bacteria 1664
354 Ga0500610_0000697 3300053079 Bacteria 10426
355 Ga0500643_000026 3300053087 Bacteria 259231
356 Ga0500643_001825 3300053087 Bacteria 11632
357 Ga0500651_0000028 3300053093 Bacteria 114592
358 Ga0500651_0101277 3300053093 Bacteria 1765
359 Ga0500566_0000678 3300053094 Bacteria 19108
360 Ga0500562_025697 3300053108 Bacteria 1542
361 Ga0500569_027456 3300053109 Bacteria 1569
362 Ga0500571_000350 3300053110 Bacteria 18224
363 Ga0500593_004706 3300053117 Bacteria 5319
364 Ga0500594_0001091 3300053118 Bacteria 5821
365 Ga0500595_008923 3300053119 Bacteria 4073
366 Ga0500595_010510 3300053119 Bacteria 3675
367 Ga0500607_006333 3300053121 Bacteria 7507
368 Ga0500608_013614 3300053122 Bacteria 3608
369 Ga0500618_013219 3300053125 Bacteria 2142
370 Ga0500655_000215 3300053133 Bacteria 13763
371 Ga0500658_0000764 3300053134 Bacteria 13251
372 Ga0500658_0003514 3300053134 Bacteria 5916
373 Ga0500658_0042074 3300053134 Bacteria 1835
374 Ga0500559_0015096 3300053136 Bacteria 3264
375 Ga0500568_0002845 3300053139 Bacteria 9976
376 Ga0500568_0034737 3300053139 Bacteria 2061
377 Ga0500574_013984 3300053141 Bacteria 1881
378 Ga0500590_013608 3300053148 Bacteria 4180
379 Ga0500627_0041207 3300053158 Bacteria 1984
380 Ga0500638_001409 3300053162 Bacteria 7507
381 Ga0500638_084254 3300053162 Bacteria 1506
382 Ga0501084_0115572 3300054114 Bacteria 2255
383 Ga0501082_0020129 3300060353 Bacteria 5750
384 Ga0501082_0085780 3300060353 Bacteria 2716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0410949 Ga0496111_0410949_32_988 267
2 3300046642 Ga0495634_0021794 Ga0495634_0021794_491_1456 270
3 3300003759 Ga0055525_1003271 Ga0055525_10032711 296
4 3300025230 Ga0209563_104458 Ga0209563_1044583 296
5 3300050491 nmdc:mga00v17_33900_c1 nmdc:mga00v17_33900_c1_306_1451 297
6 3300035692 Ga0373935_0233088 Ga0373935_0233088_186_1247 299
7 3300046459 Ga0495629_0018559 Ga0495629_0018559_777_1838 299
8 3300046462 Ga0495651_0018464 Ga0495651_0018464_3469_4530 299
9 3300046463 Ga0495653_0041874 Ga0495653_0041874_1682_2743 299
10 3300046511 Ga0495608_0070542 Ga0495608_0070542_147_1208 299
11 3300046529 Ga0495652_0014113 Ga0495652_0014113_1631_2692 299
12 3300046663 Ga0495635_0001873 Ga0495635_0001873_6234_7295 299
13 3300046675 Ga0495657_0006464 Ga0495657_0006464_5676_6737 299
14 3300046690 Ga0495624_0010228 Ga0495624_0010228_1274_2335 299
15 3300047315 Ga0495581_0031582 Ga0495581_0031582_1574_2635 299
16 3300047317 Ga0495604_0003570 Ga0495604_0003570_9686_10747 299
17 3300047319 Ga0495674_0244407 Ga0495674_0244407_359_1420 299
18 3300048088 Ga0495602_0027002 Ga0495602_0027002_2860_3921 299
19 3300048905 Ga0496102_0049264 Ga0496102_0049264_2170_3231 299
20 3300048907 Ga0496104_0001785 Ga0496104_0001785_3563_4624 299
21 3300048908 Ga0496105_0010712 Ga0496105_0010712_2158_3219 299
22 3300048922 Ga0496119_0005077 Ga0496119_0005077_3219_4280 299
23 3300048923 Ga0496120_0004945 Ga0496120_0004945_8586_9647 299
24 3300048927 Ga0496124_0080905 Ga0496124_0080905_1294_2355 299
25 3300048928 Ga0496125_0096287 Ga0496125_0096287_517_1578 299
26 3300053136 Ga0500559_0015096 Ga0500559_0015096_2129_3190 299
27 3300048929 Ga0496126_0138551 Ga0496126_0138551_1171_2076 300
28 3300053094 Ga0500566_0000678 Ga0500566_0000678_1979_3049 300
29 3300005458 Ga0070681_10001556 Ga0070681_1000155611 302
30 3300005530 Ga0070679_100048657 Ga0070679_1000486571 302
31 3300025912 Ga0207707_10009035 Ga0207707_100090356 302
32 3300025921 Ga0207652_10083387 Ga0207652_100833874 302
33 3300032002 Ga0307416_100327011 Ga0307416_1003270112 304
34 3300049822 Ga0501035_0022843 Ga0501035_0022843_672_1736 304
35 3300049823 Ga0501044_0032718 Ga0501044_0032718_264_1328 304
36 3300031548 Ga0307408_100284892 Ga0307408_1002848921 312
37 3300005985 Ga0081539_10015306 Ga0081539_100153062 313
38 3300005719 Ga0068861_100038336 Ga0068861_1000383363 315
39 3300047320 Ga0495672_0044892 Ga0495672_0044892_54_1130 315
40 3300026041 Ga0207639_10155562 Ga0207639_101555622 316
41 3300047472 Ga0495686_0208146 Ga0495686_0208146_13_1026 316
42 3300005353 Ga0070669_100048663 Ga0070669_1000486633 317
43 3300005367 Ga0070667_100207945 Ga0070667_1002079452 317
44 3300005456 Ga0070678_100006298 Ga0070678_1000062988 317
45 3300005615 Ga0070702_100115724 Ga0070702_1001157242 317
46 3300013306 Ga0163162_10390199 Ga0163162_103901992 317
47 3300013308 Ga0157375_10114095 Ga0157375_101140952 317
48 3300014969 Ga0157376_10133491 Ga0157376_101334912 317
49 3300025923 Ga0207681_10100716 Ga0207681_101007163 317
50 3300025935 Ga0207709_10026757 Ga0207709_100267574 317
51 3300025961 Ga0207712_10047420 Ga0207712_100474202 317
52 3300026067 Ga0207678_10160799 Ga0207678_101607993 317
53 3300026089 Ga0207648_10045959 Ga0207648_100459593 317
54 3300028379 Ga0268266_10254874 Ga0268266_102548742 317
55 3300006038 Ga0075365_10189872 Ga0075365_101898722 321
56 3300009098 Ga0105245_10295607 Ga0105245_102956072 321
57 3300046615 Ga0495656_0014493 Ga0495656_0014493_938_1996 321
58 3300046648 Ga0495611_0115649 Ga0495611_0115649_52_1131 321
59 3300046665 Ga0495661_0152012 Ga0495661_0152012_107_1186 321
60 3300048903 Ga0496100_0050567 Ga0496100_0050567_1232_2290 321
61 3300005338 Ga0068868_100315538 Ga0068868_1003155382 322
62 3300005578 Ga0068854_100263736 Ga0068854_1002637361 322
63 3300025932 Ga0207690_10023608 Ga0207690_100236083 322
64 3300025981 Ga0207640_10185138 Ga0207640_101851381 322
65 3300048917 Ga0496114_0091418 Ga0496114_0091418_177_1235 322
66 3300009176 Ga0105242_10251734 Ga0105242_102517343 323
67 3300014325 Ga0163163_10561971 Ga0163163_105619711 324
68 3300041413 Ga0439465_0013572 Ga0439465_0013572_1329_2384 325
69 3300049574 Ga0501038_0155448 Ga0501038_0155448_82_1137 325
70 3300005843 Ga0068860_100245597 Ga0068860_1002455971 326
71 3300006038 Ga0075365_10039301 Ga0075365_100393013 326
72 3300009098 Ga0105245_10358390 Ga0105245_103583902 326
73 3300009147 Ga0114129_10097158 Ga0114129_100971584 326
74 3300013306 Ga0163162_10316130 Ga0163162_103161302 326
75 3300032126 Ga0307415_100241145 Ga0307415_1002411451 326
76 3300046616 Ga0495668_0092277 Ga0495668_0092277_534_1610 326
77 3300048929 Ga0496126_0139919 Ga0496126_0139919_191_1258 326
78 3300050489 nmdc:mga03683_10673_c1 nmdc:mga03683_10673_c1_1353_2423 326
79 3300050492 nmdc:mga0yw44_57504_c1 nmdc:mga0yw44_57504_c1_1219_2289 326
80 3300050507 nmdc:mga05p37_116256_c1 nmdc:mga05p37_116256_c1_393_1463 326
81 3300050516 nmdc:mga0sz30_57048_c1 nmdc:mga0sz30_57048_c1_165_1235 326
82 3300053109 Ga0500569_027456 Ga0500569_027456_259_1335 326
83 3300005455 Ga0070663_100199494 Ga0070663_1001994942 327
84 3300005518 Ga0070699_100261424 Ga0070699_1002614241 327
85 3300017792 Ga0163161_10257860 Ga0163161_102578601 327
86 3300031730 Ga0307516_10244600 Ga0307516_102446002 327
87 3300046660 Ga0495625_0048587 Ga0495625_0048587_1711_2787 327
88 3300048905 Ga0496102_0184469 Ga0496102_0184469_157_1215 327
89 3300048924 Ga0496121_0000657 Ga0496121_0000657_50270_51328 327
90 3300005328 Ga0070676_10201864 Ga0070676_102018641 328
91 3300005334 Ga0068869_100122372 Ga0068869_1001223723 328
92 3300005338 Ga0068868_100075276 Ga0068868_1000752764 328
93 3300005353 Ga0070669_100098562 Ga0070669_1000985623 328
94 3300005366 Ga0070659_100132942 Ga0070659_1001329422 328
95 3300005457 Ga0070662_100184008 Ga0070662_1001840081 328
96 3300005843 Ga0068860_100009962 Ga0068860_1000099626 328
97 3300006844 Ga0075428_100302855 Ga0075428_1003028553 328
98 3300006847 Ga0075431_100505225 Ga0075431_1005052252 328
99 3300009092 Ga0105250_10011219 Ga0105250_100112195 328
100 3300009545 Ga0105237_10087650 Ga0105237_100876501 328
101 3300025297 Ga0209758_1004806 Ga0209758_10048068 328
102 3300025907 Ga0207645_10133104 Ga0207645_101331042 328
103 3300025942 Ga0207689_10015143 Ga0207689_100151438 328
104 3300025961 Ga0207712_10079222 Ga0207712_100792221 328
105 3300028380 Ga0268265_10384280 Ga0268265_103842801 328
106 3300028381 Ga0268264_10037322 Ga0268264_100373223 328
107 3300046460 Ga0495638_0035509 Ga0495638_0035509_360_1436 328
108 3300046492 Ga0495585_0078032 Ga0495585_0078032_120_1196 328
109 3300046660 Ga0495625_0009575 Ga0495625_0009575_402_1478 328
110 3300005340 Ga0070689_100234804 Ga0070689_1002348042 329
111 3300005367 Ga0070667_100030847 Ga0070667_1000308473 329
112 3300005456 Ga0070678_100099661 Ga0070678_1000996611 329
113 3300005466 Ga0070685_10015586 Ga0070685_100155866 329
114 3300005548 Ga0070665_100015331 Ga0070665_1000153315 329
115 3300005842 Ga0068858_100129256 Ga0068858_1001292562 329
116 3300013296 Ga0157374_10248465 Ga0157374_102484651 329
117 3300025986 Ga0207658_10151413 Ga0207658_101514131 329
118 3300026067 Ga0207678_10116956 Ga0207678_101169562 329
119 3300028379 Ga0268266_10000544 Ga0268266_1000054434 329
120 3300032126 Ga0307415_100195971 Ga0307415_1001959712 329
121 3300048909 Ga0496106_0196507 Ga0496106_0196507_406_1485 329
122 3300048911 Ga0496108_0076893 Ga0496108_0076893_111_1190 329
123 3300048928 Ga0496125_0056895 Ga0496125_0056895_73_1284 329
124 3300053134 Ga0500658_0042074 Ga0500658_0042074_80_1156 329
125 3300049459 Ga0495678_031146 Ga0495678_031146_716_1792 330
126 3300049822 Ga0501035_0007303 Ga0501035_0007303_5006_6058 330
127 3300049823 Ga0501044_0013034 Ga0501044_0013034_4795_5847 330
128 3300053093 Ga0500651_0101277 Ga0500651_0101277_193_1269 330
129 3300053108 Ga0500562_025697 Ga0500562_025697_299_1375 330
130 3300005983 Ga0081540_1000373 Ga0081540_10003735 331
131 3300013308 Ga0157375_10477532 Ga0157375_104775321 331
132 3300046660 Ga0495625_0129951 Ga0495625_0129951_37_1113 331
133 3300049744 Ga0501083_0005761 Ga0501083_0005761_3512_4564 331
134 3300050496 nmdc:mga07m45_3901_c1 nmdc:mga07m45_3901_c1_4345_5583 331
135 3300053087 Ga0500643_000026 Ga0500643_000026_122104_123156 331
136 3300060353 Ga0501082_0020129 Ga0501082_0020129_4582_5634 331
137 3300005329 Ga0070683_100318551 Ga0070683_1003185511 332
138 3300005344 Ga0070661_100018105 Ga0070661_1000181052 332
139 3300005539 Ga0068853_100053977 Ga0068853_1000539772 332
140 3300025920 Ga0207649_10010842 Ga0207649_100108426 332
141 3300026041 Ga0207639_10069576 Ga0207639_100695763 332
142 3300028379 Ga0268266_10072738 Ga0268266_100727382 332
143 3300049574 Ga0501038_0030734 Ga0501038_0030734_2443_3492 335
144 3300049575 Ga0501039_0195226 Ga0501039_0195226_509_1558 335
145 3300049576 Ga0501040_0039424 Ga0501040_0039424_1455_2504 335
146 3300049577 Ga0501041_0028667 Ga0501041_0028667_1736_2785 335
147 3300049580 Ga0501046_0065067 Ga0501046_0065067_1633_2682 335
148 3300049582 Ga0501048_0060608 Ga0501048_0060608_1526_2575 335
149 3300049586 Ga0501070_0192525 Ga0501070_0192525_138_1187 335
150 3300049587 Ga0501071_0072130 Ga0501071_0072130_798_1847 335
151 3300049590 Ga0501074_0049862 Ga0501074_0049862_1286_2335 335
152 3300049591 Ga0501075_0095003 Ga0501075_0095003_884_1933 335
153 3300049592 Ga0501076_0112031 Ga0501076_0112031_105_1154 335
154 3300049593 Ga0501077_0033072 Ga0501077_0033072_1875_2924 335
155 3300049741 Ga0501079_0341715 Ga0501079_0341715_117_1145 335
156 3300049742 Ga0501080_0090973 Ga0501080_0090973_1697_2746 335
157 3300049824 Ga0501045_0042693 Ga0501045_0042693_294_1343 335
158 3300054114 Ga0501084_0115572 Ga0501084_0115572_427_1476 335
159 3300060353 Ga0501082_0085780 Ga0501082_0085780_1298_2347 335
160 3300003762 Ga0055542_1000492 Ga0055542_100049213 336
161 3300003841 Ga0055541_1000400 Ga0055541_100040011 336
162 3300005347 Ga0070668_100038744 Ga0070668_1000387443 336
163 3300011119 Ga0105246_10060672 Ga0105246_100606722 336
164 3300025226 Ga0209674_100131 Ga0209674_10013186 336
165 3300025246 Ga0209646_1000058 Ga0209646_100005873 336
166 3300025254 Ga0209148_1000043 Ga0209148_1000043269 336
167 3300025256 Ga0209759_1002890 Ga0209759_10028904 336
168 3300025972 Ga0207668_10017167 Ga0207668_100171676 336
169 3300026121 Ga0207683_10064868 Ga0207683_100648684 336
170 3300050511 nmdc:mga08y16_310429_c1 nmdc:mga08y16_310429_c1_267_1460 336
171 3300005983 Ga0081540_1000904 Ga0081540_10009048 337
172 3300025901 Ga0207688_10065471 Ga0207688_100654711 337
173 3300028786 Ga0307517_10123164 Ga0307517_101231642 338
174 3300031507 Ga0307509_10208169 Ga0307509_102081693 340
175 3300033180 Ga0307510_10004428 Ga0307510_1000442811 340
176 3300046455 Ga0495603_0014166 Ga0495603_0014166_3388_4464 340
177 3300048929 Ga0496126_0229862 Ga0496126_0229862_171_1232 340
178 3300049743 Ga0501081_0036258 Ga0501081_0036258_1486_2553 340
179 3300053119 Ga0500595_010510 Ga0500595_010510_854_1915 340
180 3300053148 Ga0500590_013608 Ga0500590_013608_1413_2489 340
181 3300053162 Ga0500638_084254 Ga0500638_084254_76_1137 340
182 3300035691 Ga0373931_0020425 Ga0373931_0020425_1232_2299 341
183 3300048909 Ga0496106_0086583 Ga0496106_0086583_1103_2170 341
184 3300048924 Ga0496121_0015817 Ga0496121_0015817_5501_6697 343
185 3300048925 Ga0496122_0073088 Ga0496122_0073088_1147_2262 343
186 3300048929 Ga0496126_0002447 Ga0496126_0002447_16503_17699 343
187 3300053139 Ga0500568_0034737 Ga0500568_0034737_518_1576 343
188 iso_pu_bacteria 2791355199 2793080992 343
189 iso_pu_bacteria 2889033259 2889036992 343
190 iso_pu_bacteria 8056681323 8056683755 344
191 3300044683 Ga0466965_0025622 Ga0466965_0025622_870_1949 345
192 3300044842 Ga0466957_0012425 Ga0466957_0012425_1597_2676 345
193 3300047320 Ga0495672_0023819 Ga0495672_0023819_653_1750 345
194 3300049573 Ga0501037_0008623 Ga0501037_0008623_4792_5850 345
195 3300049575 Ga0501039_0013310 Ga0501039_0013310_3532_4590 345
196 3300049822 Ga0501035_0009010 Ga0501035_0009010_6233_7291 345
197 3300049823 Ga0501044_0290445 Ga0501044_0290445_493_1551 345
198 iso_pu_bacteria 2511231010 2511288311 345
199 iso_pu_bacteria 2513237098 2513671508 345
200 3300053119 Ga0500595_008923 Ga0500595_008923_714_1916 346
201 iso_pu_bacteria 2513237101 2513693549 346
202 iso_pu_bacteria 2738543016 2739267631 346
203 iso_pu_bacteria 8006984368 8006988923 346
204 3300048905 Ga0496102_0256303 Ga0496102_0256303_199_1266 347
205 iso_pu_bacteria 2885383462 2885388495 347
206 iso_pu_bacteria 2903768456 2903773315 347
207 3300003316 rootH1_10046429 rootH1_100464292 348
208 iso_pu_bacteria 2721755755 2723848442 348
209 iso_pu_bacteria 2874604998 2874609217 348
210 iso_pu_bacteria 2922361189 2922363626 348
211 iso_pu_bacteria 2922386360 2922392805 348
212 iso_pu_bacteria 8006964411 8006967882 348
213 iso_pu_bacteria 8006994254 8006999620 348
214 iso_pu_bacteria 2889033259 2889038651 349
215 3300005347 Ga0070668_100153639 Ga0070668_1001536392 350
216 3300006038 Ga0075365_10152165 Ga0075365_101521652 350
217 3300006048 Ga0075363_100080752 Ga0075363_1000807522 350
218 3300009093 Ga0105240_10138574 Ga0105240_101385744 350
219 3300010375 Ga0105239_10074442 Ga0105239_100744422 350
220 3300031824 Ga0307413_10038382 Ga0307413_100383822 350
221 3300031901 Ga0307406_10072345 Ga0307406_100723452 350
222 3300031911 Ga0307412_10282787 Ga0307412_102827871 350
223 3300032126 Ga0307415_100034576 Ga0307415_1000345762 350
224 3300025297 Ga0209758_1005668 Ga0209758_100566812 351
225 3300032005 Ga0307411_10115164 Ga0307411_101151642 351
226 3300048918 Ga0496115_0363675 Ga0496115_0363675_56_1114 351
227 3300048929 Ga0496126_0010928 Ga0496126_0010928_5663_6721 351
228 3300049575 Ga0501039_0114018 Ga0501039_0114018_399_1457 351
229 iso_pu_bacteria 2524023210 2524464812 351
230 iso_pu_bacteria 2954767861 2954768659 351
231 3300025298 Ga0209050_1021029 Ga0209050_10210292 352
232 3300046615 Ga0495656_0002595 Ga0495656_0002595_4666_5742 352
233 3300048919 Ga0496116_0030763 Ga0496116_0030763_1565_2707 352
234 3300048920 Ga0496117_0020413 Ga0496117_0020413_1099_2241 352
235 3300048924 Ga0496121_0031555 Ga0496121_0031555_341_1483 352
236 iso_pu_bacteria 8056673599 8056676900 354
237 3300006048 Ga0075363_100015875 Ga0075363_1000158753 355
238 3300036647 Ga0316582_0219067 Ga0316582_0219067_45_1139 355
239 3300050490 nmdc:mga03n38_54365_c1 nmdc:mga03n38_54365_c1_365_1438 355
240 3300050493 nmdc:mga0k408_3020_c1 nmdc:mga0k408_3020_c1_7688_8761 355
241 iso_pu_bacteria 2904449895 2904452011 356
242 iso_pu_bacteria 2904456579 2904458843 356
243 iso_pu_bacteria 2929520902 2929523450 356
244 iso_pu_bacteria 2945945610 2945946319 356
245 iso_pu_bacteria 2945972063 2945975920 356
246 3300031731 Ga0307405_10152474 Ga0307405_101524742 359
247 3300048921 Ga0496118_0022408 Ga0496118_0022408_849_1961 359
248 3300003578 Ga0006562J51391_1073750 Ga0006562J51391_10737501 360
249 3300003773 Ga0055537_1000837 Ga0055537_100083710 360
250 3300003784 Ga0055534_1000736 Ga0055534_100073610 360
251 3300003790 Ga0055528_1002672 Ga0055528_10026725 360
252 3300005288 Ga0065714_10081624 Ga0065714_100816241 360
253 3300005289 Ga0065704_10181552 Ga0065704_101815521 360
254 3300006048 Ga0075363_100043973 Ga0075363_1000439732 360
255 3300006051 Ga0075364_10103684 Ga0075364_101036842 360
256 3300006353 Ga0075370_10013642 Ga0075370_100136422 360
257 3300006948 Ga0099826_10000504 Ga0099826_1000050416 360
258 3300006948 Ga0099826_10052343 Ga0099826_100523433 360
259 3300015261 Ga0182006_1047574 Ga0182006_10475741 360
260 3300025263 Ga0209565_1000921 Ga0209565_10009215 360
261 3300025273 Ga0209673_1002054 Ga0209673_100205410 360
262 3300025291 Ga0209675_1000038 Ga0209675_1000038252 360
263 3300025303 Ga0209051_1000524 Ga0209051_100052437 360
264 3300027666 Ga0209282_1000751 Ga0209282_10007517 360
265 3300027666 Ga0209282_1037163 Ga0209282_10371633 360
266 3300031901 Ga0307406_10004851 Ga0307406_100048515 360
267 3300046660 Ga0495625_0000317 Ga0495625_0000317_72372_73454 360
268 3300050489 nmdc:mga03683_10601_c1 nmdc:mga03683_10601_c1_1088_2170 360
269 3300050490 nmdc:mga03n38_8675_c1 nmdc:mga03n38_8675_c1_1655_2737 360
270 3300050493 nmdc:mga0k408_36738_c1 nmdc:mga0k408_36738_c1_678_1760 360
271 3300050494 nmdc:mga06z11_40680_c1 nmdc:mga06z11_40680_c1_628_1710 360
272 3300050496 nmdc:mga07m45_246_c1 nmdc:mga07m45_246_c1_3453_4535 360
273 iso_pu_bacteria 2643221628 2644162026 361
274 iso_pu_bacteria 2919462493 2919467599 361
275 3300041411 Ga0439466_0021704 Ga0439466_0021704_1077_2165 362
276 3300041413 Ga0439465_0019809 Ga0439465_0019809_258_1346 362
277 3300042002 Ga0439442_004832 Ga0439442_004832_1199_2287 362
278 3300042145 Ga0450906_020133 Ga0450906_020133_86_1174 362
279 3300042147 Ga0450910_001575 Ga0450910_001575_587_1675 362
280 3300042184 Ga0450908_008313 Ga0450908_008313_85_1173 362
281 3300042435 Ga0439434_0009637 Ga0439434_0009637_529_1617 362
282 3300042531 Ga0450918_001535 Ga0450918_001535_3406_4494 362
283 iso_pu_bacteria 2904541872 2904547458 362
284 iso_pu_bacteria 2929160207 2929165040 362
285 iso_pu_bacteria 2513020051 2513231889 363
286 iso_pu_bacteria 2842677519 2842677748 363
287 iso_pu_bacteria 2928084124 2928090078 364
288 3300006048 Ga0075363_100005081 Ga0075363_1000050817 365
289 3300006177 Ga0075362_10116737 Ga0075362_101167371 365
290 3300025258 Ga0209129_1005090 Ga0209129_10050905 365
291 3300025294 Ga0209025_1000238 Ga0209025_100023893 365
292 3300025935 Ga0207709_10002972 Ga0207709_1000297210 365
293 3300028380 Ga0268265_10148035 Ga0268265_101480351 365
294 3300031731 Ga0307405_10070240 Ga0307405_100702403 365
295 3300031852 Ga0307410_10113967 Ga0307410_101139672 365
296 3300031911 Ga0307412_10116253 Ga0307412_101162532 365
297 3300032002 Ga0307416_100222281 Ga0307416_1002222812 365
298 3300032005 Ga0307411_10045350 Ga0307411_100453502 365
299 3300042134 Ga0450898_012962 Ga0450898_012962_207_1304 365
300 3300049759 Ga0501262_002652 Ga0501262_002652_801_1898 365
301 3300050496 nmdc:mga07m45_1344_c1 nmdc:mga07m45_1344_c1_3741_4838 365
302 iso_pu_bacteria 2643221683 2644467302 365
303 iso_pu_bacteria 2818991446 2819602525 365
304 iso_pu_bacteria 2885198086 2885198480 365
305 iso_pu_bacteria 2885211737 2885212140 365
306 iso_pu_bacteria 2899924645 2899928674 365
307 iso_pu_bacteria 2928037797 2928043381 365
308 iso_pu_bacteria 2928044640 2928050823 365
309 iso_pu_bacteria 2928051484 2928056275 365
310 iso_pu_bacteria 2928064002 2928066242 365
311 3300003187 JGI25151J46595_10011705 JGI25151J46595_100117053 366
312 3300025294 Ga0209025_1000256 Ga0209025_100025660 366
313 3300046453 Ga0495627_030027 Ga0495627_030027_52_1155 366
314 3300046515 Ga0495620_0010863 Ga0495620_0010863_1611_2714 366
315 3300046616 Ga0495668_0034699 Ga0495668_0034699_667_1770 366
316 3300046674 Ga0495588_0021600 Ga0495588_0021600_1034_2137 366
317 3300046692 Ga0495671_0008968 Ga0495671_0008968_1077_2180 366
318 3300053079 Ga0500610_0000697 Ga0500610_0000697_7890_8993 366
319 3300053117 Ga0500593_004706 Ga0500593_004706_3295_4398 366
320 3300053121 Ga0500607_006333 Ga0500607_006333_1062_2165 366
321 3300053158 Ga0500627_0041207 Ga0500627_0041207_369_1472 366
322 iso_pu_bacteria 2599185214 2599623011 366
323 iso_pu_bacteria 2599185226 2599674658 366
324 iso_pu_bacteria 2599185227 2599680615 366
325 iso_pu_bacteria 2599185229 2599692630 366
326 iso_pu_bacteria 2928070936 2928075879 366
327 3300006353 Ga0075370_10011621 Ga0075370_100116213 367
328 3300009036 Ga0105244_10008305 Ga0105244_100083052 367
329 3300009098 Ga0105245_10126806 Ga0105245_101268063 367
330 3300009148 Ga0105243_10045835 Ga0105243_100458352 367
331 3300015261 Ga0182006_1006221 Ga0182006_10062212 367
332 3300015262 Ga0182007_10001421 Ga0182007_100014212 367
333 3300025728 Ga0207655_1041766 Ga0207655_10417662 367
334 3300025935 Ga0207709_10000610 Ga0207709_1000061010 367
335 3300025945 Ga0207679_10156420 Ga0207679_101564202 367
336 3300026116 Ga0207674_10113504 Ga0207674_101135042 367
337 3300030731 Ga0316177_1189767 Ga0316177_11897673 367
338 3300030733 Ga0314311_1075878 Ga0314311_10758783 367
339 3300030736 Ga0316180_1125658 Ga0316180_11256582 367
340 3300030742 Ga0316183_1055144 Ga0316183_10551443 367
341 3300046520 Ga0495637_0028620 Ga0495637_0028620_818_1924 367
342 3300048928 Ga0496125_0095611 Ga0496125_0095611_456_1559 367
343 3300049679 Ga0501249_003761 Ga0501249_003761_1646_2749 367
344 3300049705 Ga0501225_0005379 Ga0501225_0005379_295_1398 367
345 3300050496 nmdc:mga07m45_5601_c1 nmdc:mga07m45_5601_c1_4526_5629 367
346 iso_pu_bacteria 2643221658 2644325297 367
347 iso_pu_bacteria 2643221672 2644399034 367
348 iso_pu_bacteria 2738541277 2738720906 367
349 iso_pu_bacteria 2738541307 2738886348 367
350 iso_pu_bacteria 2738543019 2739280105 367
351 iso_pu_bacteria 2831265667 2831272057 367
352 iso_pu_bacteria 2838054893 2838059876 367
353 iso_pu_bacteria 2945909444 2945910352 367
354 iso_pu_bacteria 2945984333 2945987606 367
355 3300005457 Ga0070662_100075115 Ga0070662_1000751153 368
356 3300046460 Ga0495638_0028723 Ga0495638_0028723_1894_3000 368
357 3300046512 Ga0495610_0030640 Ga0495610_0030640_1554_2660 368
358 3300046513 Ga0495616_0003489 Ga0495616_0003489_8277_9383 368
359 3300046518 Ga0495631_0002133 Ga0495631_0002133_9251_10357 368
360 3300046530 Ga0495654_0031035 Ga0495654_0031035_411_1517 368
361 3300046660 Ga0495625_0069593 Ga0495625_0069593_142_1248 368
362 3300048924 Ga0496121_0064316 Ga0496121_0064316_1150_2256 368
363 3300053118 Ga0500594_0001091 Ga0500594_0001091_907_2013 368
364 3300053134 Ga0500658_0003514 Ga0500658_0003514_1190_2296 368
365 3300053139 Ga0500568_0002845 Ga0500568_0002845_8085_9191 368
366 3300003761 Ga0055535_1000075 Ga0055535_100007557 369
367 3300003762 Ga0055542_1000059 Ga0055542_1000059104 369
368 3300003781 Ga0055536_1012972 Ga0055536_10129723 369
369 3300003792 Ga0055540_1013419 Ga0055540_10134192 369
370 3300009148 Ga0105243_10001924 Ga0105243_100019246 369
371 3300013307 Ga0157372_10028982 Ga0157372_100289822 369
372 3300025228 Ga0209672_100686 Ga0209672_1006864 369
373 3300025229 Ga0209147_100661 Ga0209147_1006618 369
374 3300025242 Ga0209258_100078 Ga0209258_10007843 369
375 3300025254 Ga0209148_1000086 Ga0209148_100008643 369
376 3300025292 Ga0209676_1001150 Ga0209676_100115013 369
377 3300025303 Ga0209051_1002812 Ga0209051_10028123 369
378 3300025321 Ga0207656_10001163 Ga0207656_100011634 369
379 3300025935 Ga0207709_10000393 Ga0207709_100003936 369
380 3300002774 JGI25150J39212_1000830 JGI25150J39212_10008307 370
381 3300025245 Ga0207425_1000247 Ga0207425_10002476 370
382 3300025258 Ga0209129_1000116 Ga0209129_1000116112 370
383 3300025284 Ga0209130_1000635 Ga0209130_10006355 370
384 3300025294 Ga0209025_1000293 Ga0209025_100029328 370
385 3300025295 Ga0209564_1000201 Ga0209564_100020128 370
386 3300025297 Ga0209758_1000034 Ga0209758_100003428 370
387 3300025299 Ga0209256_1000677 Ga0209256_10006779 370
388 3300025302 Ga0207426_1000244 Ga0207426_100024476 370
389 3300001979 JGI24740J21852_10030794 JGI24740J21852_100307942 371
390 3300002773 JGI25152J39213_1004543 JGI25152J39213_10045431 371
391 3300003215 JGI25153J46596_10007821 JGI25153J46596_100078212 371
392 3300003771 Ga0055526_1005342 Ga0055526_10053423 371
393 3300003773 Ga0055537_1006347 Ga0055537_10063472 371
394 3300003775 Ga0055524_1002063 Ga0055524_10020635 371
395 3300003781 Ga0055536_1022343 Ga0055536_10223431 371
396 3300003784 Ga0055534_1006835 Ga0055534_10068353 371
397 3300005539 Ga0068853_100017694 Ga0068853_1000176945 371
398 3300005563 Ga0068855_100197533 Ga0068855_1001975331 371
399 3300009545 Ga0105237_10091963 Ga0105237_100919633 371
400 3300009551 Ga0105238_10098758 Ga0105238_100987582 371
401 3300013104 Ga0157370_10035531 Ga0157370_100355314 371
402 3300013105 Ga0157369_10003782 Ga0157369_100037821 371
403 3300014497 Ga0182008_10003982 Ga0182008_100039823 371
404 3300014497 Ga0182008_10030820 Ga0182008_100308201 371
405 3300017792 Ga0163161_10002814 Ga0163161_100028147 371
406 3300025258 Ga0209129_1003553 Ga0209129_10035532 371
407 3300025263 Ga0209565_1000353 Ga0209565_10003535 371
408 3300025273 Ga0209673_1000190 Ga0209673_100019023 371
409 3300025284 Ga0209130_1000823 Ga0209130_100082310 371
410 3300025291 Ga0209675_1000349 Ga0209675_10003495 371
411 3300025292 Ga0209676_1000125 Ga0209676_100012563 371
412 3300025294 Ga0209025_1011228 Ga0209025_10112281 371
413 3300025295 Ga0209564_1000918 Ga0209564_100091823 371
414 3300025297 Ga0209758_1009383 Ga0209758_10093832 371
415 3300025298 Ga0209050_1000012 Ga0209050_1000012721 371
416 3300025299 Ga0209256_1000969 Ga0209256_100096923 371
417 3300025302 Ga0207426_1000795 Ga0207426_100079523 371
418 3300025304 Ga0209257_1000024 Ga0209257_1000024667 371
419 3300025913 Ga0207695_10068981 Ga0207695_100689812 371
420 3300025924 Ga0207694_10167209 Ga0207694_101672092 371
421 3300026041 Ga0207639_10016065 Ga0207639_100160652 371
422 3300031911 Ga0307412_10036572 Ga0307412_100365723 371
423 3300041459 Ga0451800_1505967 Ga0451800_1505967_28_1161 371
424 3300047321 Ga0495676_0094010 Ga0495676_0094010_912_2027 371
425 3300048089 Ga0495614_0089648 Ga0495614_0089648_77_1192 371
426 3300048921 Ga0496118_0074779 Ga0496118_0074779_1006_2121 371
427 3300048925 Ga0496122_0089630 Ga0496122_0089630_302_1429 371
428 3300048926 Ga0496123_0085320 Ga0496123_0085320_688_1803 371
429 3300048927 Ga0496124_0003777 Ga0496124_0003777_13572_14699 371
430 3300048927 Ga0496124_0038288 Ga0496124_0038288_831_1946 371
431 3300053087 Ga0500643_001825 Ga0500643_001825_1761_2876 371
432 3300053093 Ga0500651_0000028 Ga0500651_0000028_83766_84881 371
433 3300053110 Ga0500571_000350 Ga0500571_000350_3453_4568 371
434 3300053122 Ga0500608_013614 Ga0500608_013614_1027_2154 371
435 3300053125 Ga0500618_013219 Ga0500618_013219_191_1306 371
436 3300053133 Ga0500655_000215 Ga0500655_000215_9084_10199 371
437 3300053134 Ga0500658_0000764 Ga0500658_0000764_3538_4653 371
438 3300053141 Ga0500574_013984 Ga0500574_013984_682_1797 371
439 3300053162 Ga0500638_001409 Ga0500638_001409_3394_4509 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01594

AI-2E_transport

AI-2E family transporter

14

347

0.93

Feature Viewer

pLDDT pTM Quality
55.32 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map