F444069

General Info

Members Datasets Scaffolds Average Seq Length
438 234 876 133

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0003316|Ga0496114_0003316_8052_8531
Length 159
Sequence MLTPLDRVRRGDPVSPRIDIGTGGHMLKTYLGSCHCGAVRFEADIDLTLPTYRCNCSICRRNRFWPAIVTPDRFRLLAGEGELTEYRFNSRRNSHHFCRTCGVRPFGIGNNMPGEERVYGVNLGCLEDVAPEELDAAPVTYVDGAHDRWQETPRFTRYL

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
161 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
162 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 14.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0003316 3300048917 Bacteria 12370
2 Ga0065712_10435425 3300005290 Unclassified 689
3 Ga0065715_10588095 3300005293 Bacteria 715
4 Ga0070658_10511296 3300005327 Bacteria 1038
5 Ga0070658_10697925 3300005327 Bacteria 881
6 Ga0070676_10000472 3300005328 Bacteria 19298
7 Ga0070690_100291162 3300005330 Bacteria 1168
8 Ga0070690_100598771 3300005330 Bacteria 836
9 Ga0070690_100916864 3300005330 Bacteria 686
10 Ga0070670_100035529 3300005331 Bacteria 4290
11 Ga0070670_100061802 3300005331 Bacteria 3215
12 Ga0070670_100677055 3300005331 Bacteria 926
13 Ga0070670_100803591 3300005331 Bacteria 849
14 Ga0070677_10003912 3300005333 Bacteria 4831
15 Ga0070677_10046298 3300005333 Bacteria 1739
16 Ga0068869_100000782 3300005334 Bacteria 18135
17 Ga0068869_100002744 3300005334 Bacteria 10659
18 Ga0070666_10000383 3300005335 Bacteria 27824
19 Ga0070666_10685354 3300005335 Unclassified 751
20 Ga0070680_100571183 3300005336 Bacteria 970
21 Ga0068868_100235195 3300005338 Bacteria 1538
22 Ga0068868_101418037 3300005338 Unclassified 648
23 Ga0070660_100726849 3300005339 Unclassified 833
24 Ga0070689_100174206 3300005340 Bacteria 1744
25 Ga0070689_100437134 3300005340 Bacteria 1111
26 Ga0070689_101571916 3300005340 Bacteria 597
27 Ga0070661_101329538 3300005344 Bacteria 603
28 Ga0070692_10295448 3300005345 Bacteria 987
29 Ga0070668_100001273 3300005347 Bacteria 18006
30 Ga0070669_100002155 3300005353 Bacteria 14244
31 Ga0070675_100002617 3300005354 Bacteria 13517
32 Ga0070675_100009479 3300005354 Bacteria 7577
33 Ga0070675_100530904 3300005354 Bacteria 1062
34 Ga0070671_100144891 3300005355 Bacteria 2005
35 Ga0070671_100797966 3300005355 Unclassified 822
36 Ga0070674_100045204 3300005356 Bacteria 3008
37 Ga0070674_100125465 3300005356 Bacteria 1906
38 Ga0070673_100108870 3300005364 Unclassified 2295
39 Ga0070673_100231756 3300005364 Bacteria 1602
40 Ga0070673_100342452 3300005364 Bacteria 1325
41 Ga0070688_100150745 3300005365 Bacteria 1589
42 Ga0070688_100890267 3300005365 Bacteria 701
43 Ga0070659_101123437 3300005366 Bacteria 693
44 Ga0070667_100002701 3300005367 Bacteria 15360
45 Ga0070667_100405203 3300005367 Bacteria 1242
46 Ga0070701_10133969 3300005438 Bacteria 1410
47 Ga0070705_100000798 3300005440 Bacteria 17772
48 Ga0070694_100024699 3300005444 Bacteria 3880
49 Ga0070708_100555240 3300005445 Bacteria 1083
50 Ga0070663_100093865 3300005455 Bacteria 2227
51 Ga0070678_100028442 3300005456 Bacteria 3812
52 Ga0070678_100078499 3300005456 Bacteria 2494
53 Ga0070678_100080250 3300005456 Bacteria 2470
54 Ga0070678_100085960 3300005456 Bacteria 2398
55 Ga0070678_100124762 3300005456 Bacteria 2036
56 Ga0070678_100217580 3300005456 Bacteria 1586
57 Ga0070662_100002002 3300005457 Bacteria 12492
58 Ga0070662_100068815 3300005457 Bacteria 2604
59 Ga0070662_100202260 3300005457 Bacteria 1577
60 Ga0068867_100006666 3300005459 Bacteria 8165
61 Ga0070706_100185461 3300005467 Bacteria 1944
62 Ga0070707_100514320 3300005468 Bacteria 1159
63 Ga0070699_100017291 3300005518 Bacteria 6193
64 Ga0070699_102035945 3300005518 Bacteria 525
65 Ga0070684_101951525 3300005535 Unclassified 554
66 Ga0070697_100003801 3300005536 Bacteria 11595
67 Ga0068853_100041700 3300005539 Bacteria 3923
68 Ga0068853_100069018 3300005539 Unclassified 3074
69 Ga0070672_100002092 3300005543 Bacteria 12581
70 Ga0070672_100010069 3300005543 Bacteria 6545
71 Ga0070672_100037125 3300005543 Bacteria 3715
72 Ga0070672_101159974 3300005543 Bacteria 688
73 Ga0070686_100022911 3300005544 Bacteria 3726
74 Ga0070686_100439749 3300005544 Bacteria 1000
75 Ga0070695_100000996 3300005545 Bacteria 15419
76 Ga0070696_100001647 3300005546 Bacteria 14646
77 Ga0070693_100016298 3300005547 Bacteria 3844
78 Ga0070693_100260681 3300005547 Bacteria 1153
79 Ga0070693_100907363 3300005547 Unclassified 661
80 Ga0070665_100130159 3300005548 Bacteria 2519
81 Ga0070665_101393414 3300005548 Unclassified 710
82 Ga0070704_101122368 3300005549 Bacteria 715
83 Ga0068857_100631207 3300005577 Bacteria 1014
84 Ga0068857_101433672 3300005577 Bacteria 672
85 Ga0068854_100470980 3300005578 Bacteria 1053
86 Ga0068856_100039435 3300005614 Bacteria 4637
87 Ga0068852_100022201 3300005616 Bacteria 5085
88 Ga0068852_100069704 3300005616 Bacteria 3083
89 Ga0068852_100207087 3300005616 Bacteria 1859
90 Ga0068852_100241926 3300005616 Unclassified 1725
91 Ga0068852_100637838 3300005616 Unclassified 1072
92 Ga0068852_101588912 3300005616 Bacteria 676
93 Ga0068859_100129251 3300005617 Bacteria 2597
94 Ga0068859_100595888 3300005617 Bacteria 1198
95 Ga0068859_100881498 3300005617 Bacteria 980
96 Ga0068864_100008915 3300005618 Bacteria 8267
97 Ga0068864_100225138 3300005618 Bacteria 1732
98 Ga0068864_101048090 3300005618 Bacteria 810
99 Ga0068866_10007383 3300005718 Bacteria 4599
100 Ga0068861_100001459 3300005719 Bacteria 14966
101 Ga0068851_10126900 3300005834 Bacteria 1376
102 Ga0068851_10804232 3300005834 Bacteria 584
103 Ga0068851_10925374 3300005834 Bacteria 547
104 Ga0068870_10521900 3300005840 Bacteria 795
105 Ga0068863_100001611 3300005841 Bacteria 22315
106 Ga0068863_100014714 3300005841 Bacteria 7529
107 Ga0068863_100047025 3300005841 Bacteria 4095
108 Ga0068863_100057323 3300005841 Bacteria 3687
109 Ga0068863_100348490 3300005841 Bacteria 1442
110 Ga0068863_101367479 3300005841 Bacteria 715
111 Ga0068858_100519630 3300005842 Bacteria 1151
112 Ga0068858_101291725 3300005842 Bacteria 718
113 Ga0068860_100003919 3300005843 Bacteria 15290
114 Ga0068860_101500597 3300005843 Bacteria 696
115 Ga0068862_100002751 3300005844 Bacteria 15426
116 Ga0068862_100101592 3300005844 Bacteria 2516
117 Ga0070716_100481380 3300006173 Bacteria 911
118 Ga0075366_10257478 3300006195 Bacteria 1065
119 Ga0097621_100023069 3300006237 Bacteria 4840
120 Ga0097621_100073269 3300006237 Bacteria 2835
121 Ga0097621_100121736 3300006237 Bacteria 2213
122 Ga0097621_100166363 3300006237 Bacteria 1899
123 Ga0097621_100193053 3300006237 Unclassified 1764
124 Ga0097621_100263563 3300006237 Unclassified 1512
125 Ga0097621_102216056 3300006237 Bacteria 526
126 Ga0068871_100004228 3300006358 Bacteria 9944
127 Ga0068871_100010010 3300006358 Bacteria 6891
128 Ga0068871_100112979 3300006358 Bacteria 2287
129 Ga0068871_100155365 3300006358 Unclassified 1953
130 Ga0068871_100190726 3300006358 Unclassified 1765
131 Ga0068871_101849345 3300006358 Bacteria 574
132 Ga0075428_100098532 3300006844 Bacteria 3187
133 Ga0075429_100308678 3300006880 Bacteria 1385
134 Ga0075429_100550545 3300006880 Bacteria 1011
135 Ga0068865_100002156 3300006881 Bacteria 11594
136 Ga0068865_100239591 3300006881 Bacteria 1427
137 Ga0068865_100977503 3300006881 Bacteria 740
138 Ga0068865_101054616 3300006881 Bacteria 714
139 Ga0097620_100129243 3300006931 Bacteria 2597
140 Ga0097620_100595885 3300006931 Bacteria 1198
141 Ga0097620_100881266 3300006931 Bacteria 980
142 Ga0105240_10773243 3300009093 Bacteria 1042
143 Ga0111539_10001041 3300009094 Bacteria 36433
144 Ga0111539_10025764 3300009094 Bacteria 7203
145 Ga0111539_10161771 3300009094 Unclassified 2618
146 Ga0111539_11746678 3300009094 Bacteria 721
147 Ga0105245_10064028 3300009098 Unclassified 3323
148 Ga0105245_10101215 3300009098 Bacteria 2667
149 Ga0105247_10114069 3300009101 Bacteria 1743
150 Ga0114129_11613901 3300009147 Unclassified 794
151 Ga0105243_10332927 3300009148 Bacteria 1387
152 Ga0105243_11888815 3300009148 Unclassified 630
153 Ga0105241_10528860 3300009174 Bacteria 1055
154 Ga0105242_10021774 3300009176 Bacteria 5037
155 Ga0105242_10338107 3300009176 Unclassified 1387
156 Ga0105242_10433213 3300009176 Bacteria 1235
157 Ga0105242_10821518 3300009176 Unclassified 922
158 Ga0105248_10002726 3300009177 Bacteria 19624
159 Ga0105248_10009185 3300009177 Bacteria 10875
160 Ga0105248_10034622 3300009177 Bacteria 5650
161 Ga0105248_10035120 3300009177 Bacteria 5609
162 Ga0105248_10248590 3300009177 Unclassified 2002
163 Ga0105248_10306363 3300009177 Unclassified 1789
164 Ga0105249_10000996 3300009553 Bacteria 25124
165 Ga0105246_11201141 3300011119 Bacteria 698
166 Ga0157339_1014522 3300012505 Bacteria 766
167 Ga0157373_10984789 3300013100 Unclassified 629
168 Ga0157370_10200536 3300013104 Bacteria 1851
169 Ga0157370_10722549 3300013104 Unclassified 908
170 Ga0157374_10039898 3300013296 Bacteria 4322
171 Ga0157374_10071555 3300013296 Bacteria 3270
172 Ga0157374_10097449 3300013296 Bacteria 2814
173 Ga0157374_10300187 3300013296 Bacteria 1589
174 Ga0157374_12185159 3300013296 Bacteria 580
175 Ga0157378_10010904 3300013297 Bacteria 7950
176 Ga0157378_10044479 3300013297 Bacteria 3944
177 Ga0157378_10456278 3300013297 Bacteria 1269
178 Ga0157378_10753931 3300013297 Bacteria 996
179 Ga0163162_10021806 3300013306 Bacteria 6309
180 Ga0163162_10034779 3300013306 Bacteria 5016
181 Ga0163162_10255205 3300013306 Bacteria 1885
182 Ga0163162_10333308 3300013306 Bacteria 1650
183 Ga0163162_10342380 3300013306 Bacteria 1628
184 Ga0157375_10000906 3300013308 Bacteria 25775
185 Ga0157375_10011174 3300013308 Bacteria 7920
186 Ga0157375_10014952 3300013308 Bacteria 6939
187 Ga0157375_10078860 3300013308 Bacteria 3328
188 Ga0157375_10110006 3300013308 Bacteria 2852
189 Ga0163163_10446369 3300014325 Bacteria 1353
190 Ga0157380_10955027 3300014326 Bacteria 887
191 Ga0157377_10705650 3300014745 Unclassified 733
192 Ga0157377_10910798 3300014745 Bacteria 658
193 Ga0157379_10015165 3300014968 Bacteria 6760
194 Ga0157379_10320192 3300014968 Bacteria 1416
195 Ga0157376_10001379 3300014969 Bacteria 15994
196 Ga0157376_10023563 3300014969 Bacteria 4820
197 Ga0157376_10238144 3300014969 Bacteria 1694
198 Ga0157376_10397336 3300014969 Bacteria 1332
199 Ga0157376_10433366 3300014969 Unclassified 1278
200 Ga0157376_10683940 3300014969 Unclassified 1029
201 Ga0163161_10000551 3300017792 Bacteria 30373
202 Ga0207697_10022886 3300025315 Bacteria 2559
203 Ga0207656_10009223 3300025321 Bacteria 3660
204 Ga0207656_10088016 3300025321 Bacteria 1406
205 Ga0207656_10104265 3300025321 Bacteria 1303
206 Ga0207682_10005457 3300025893 Bacteria 5176
207 Ga0207682_10066332 3300025893 Bacteria 1521
208 Ga0207682_10301814 3300025893 Bacteria 751
209 Ga0207642_10289984 3300025899 Bacteria 945
210 Ga0207688_10060480 3300025901 Bacteria 2134
211 Ga0207680_10012679 3300025903 Unclassified 4301
212 Ga0207680_10200653 3300025903 Bacteria 1359
213 Ga0207645_10000390 3300025907 Bacteria 36191
214 Ga0207645_11232588 3300025907 Bacteria 502
215 Ga0207705_10515301 3300025909 Unclassified 929
216 Ga0207705_10593053 3300025909 Bacteria 862
217 Ga0207654_10190399 3300025911 Bacteria 1344
218 Ga0207695_10470697 3300025913 Bacteria 1139
219 Ga0207662_10076117 3300025918 Bacteria 2039
220 Ga0207657_10490370 3300025919 Unclassified 963
221 Ga0207681_10001344 3300025923 Bacteria 15876
222 Ga0207694_10888086 3300025924 Bacteria 754
223 Ga0207650_10500838 3300025925 Bacteria 1015
224 Ga0207650_10612924 3300025925 Unclassified 916
225 Ga0207659_10007942 3300025926 Bacteria 6562
226 Ga0207659_10332196 3300025926 Bacteria 1257
227 Ga0207659_10666371 3300025926 Bacteria 890
228 Ga0207687_10091667 3300025927 Bacteria 2217
229 Ga0207687_10944131 3300025927 Bacteria 739
230 Ga0207644_10205703 3300025931 Bacteria 1554
231 Ga0207644_11189213 3300025931 Bacteria 641
232 Ga0207706_10006984 3300025933 Bacteria 10435
233 Ga0207706_10011456 3300025933 Bacteria 8077
234 Ga0207706_10314834 3300025933 Bacteria 1363
235 Ga0207706_11149249 3300025933 Bacteria 647
236 Ga0207706_11363336 3300025933 Bacteria 584
237 Ga0207686_10075242 3300025934 Bacteria 2185
238 Ga0207709_10753018 3300025935 Bacteria 783
239 Ga0207709_11542291 3300025935 Unclassified 551
240 Ga0207670_10226906 3300025936 Bacteria 1433
241 Ga0207669_10005373 3300025937 Bacteria 5743
242 Ga0207704_10002919 3300025938 Bacteria 7721
243 Ga0207704_10683406 3300025938 Bacteria 848
244 Ga0207704_10783493 3300025938 Bacteria 795
245 Ga0207704_11026684 3300025938 Unclassified 698
246 Ga0207704_11172203 3300025938 Unclassified 654
247 Ga0207665_10143237 3300025939 Bacteria 1706
248 Ga0207691_10001079 3300025940 Bacteria 27155
249 Ga0207691_10004663 3300025940 Bacteria 13268
250 Ga0207691_10022820 3300025940 Bacteria 5899
251 Ga0207691_10024680 3300025940 Bacteria 5653
252 Ga0207691_10068524 3300025940 Bacteria 3205
253 Ga0207711_10040861 3300025941 Bacteria 3947
254 Ga0207711_10070439 3300025941 Bacteria 3033
255 Ga0207711_10148022 3300025941 Bacteria 2117
256 Ga0207711_10668034 3300025941 Bacteria 969
257 Ga0207689_10003499 3300025942 Bacteria 14351
258 Ga0207689_10008976 3300025942 Bacteria 8662
259 Ga0207651_10585834 3300025960 Unclassified 973
260 Ga0207651_10612114 3300025960 Unclassified 953
261 Ga0207651_11335035 3300025960 Bacteria 645
262 Ga0207712_10000987 3300025961 Bacteria 20375
263 Ga0207668_10039113 3300025972 Unclassified 3189
264 Ga0207658_10051803 3300025986 Unclassified 3026
265 Ga0207658_10483841 3300025986 Bacteria 1100
266 Ga0207658_10706182 3300025986 Bacteria 911
267 Ga0207677_10089960 3300026023 Unclassified 2229
268 Ga0207703_10004869 3300026035 Bacteria 10920
269 Ga0207703_10112533 3300026035 Bacteria 2325
270 Ga0207703_10320361 3300026035 Bacteria 1419
271 Ga0207703_11036371 3300026035 Bacteria 787
272 Ga0207639_10067510 3300026041 Unclassified 2783
273 Ga0207639_10077512 3300026041 Unclassified 2620
274 Ga0207639_10110496 3300026041 Unclassified 2239
275 Ga0207678_10034429 3300026067 Bacteria 4411
276 Ga0207678_10134857 3300026067 Bacteria 2107
277 Ga0207678_10379230 3300026067 Bacteria 1222
278 Ga0207702_10045319 3300026078 Bacteria 3700
279 Ga0207641_10012611 3300026088 Bacteria 6931
280 Ga0207641_10020591 3300026088 Bacteria 5419
281 Ga0207641_10258582 3300026088 Bacteria 1629
282 Ga0207641_11084224 3300026088 Unclassified 799
283 Ga0207648_10001878 3300026089 Bacteria 22968
284 Ga0207648_10188349 3300026089 Bacteria 1828
285 Ga0207676_10027601 3300026095 Bacteria 4230
286 Ga0207676_10207647 3300026095 Bacteria 1735
287 Ga0207674_10903936 3300026116 Bacteria 851
288 Ga0207675_100002444 3300026118 Bacteria 18401
289 Ga0207675_100085973 3300026118 Bacteria 2952
290 Ga0207683_10070502 3300026121 Bacteria 3088
291 Ga0207683_10104429 3300026121 Bacteria 2532
292 Ga0207683_10113083 3300026121 Bacteria 2432
293 Ga0207683_10210135 3300026121 Bacteria 1771
294 Ga0207698_10070944 3300026142 Bacteria 2762
295 Ga0207698_10225218 3300026142 Unclassified 1698
296 Ga0207698_10424861 3300026142 Bacteria 1276
297 Ga0207698_10684141 3300026142 Bacteria 1019
298 Ga0207698_11350009 3300026142 Bacteria 728
299 Ga0207698_11372457 3300026142 Unclassified 722
300 Ga0209969_1012299 3300027360 Bacteria 1233
301 Ga0210000_1018269 3300027462 Bacteria 1064
302 Ga0209995_1045003 3300027471 Unclassified 747
303 Ga0209995_1047567 3300027471 Bacteria 726
304 Ga0209968_1007801 3300027526 Bacteria 1623
305 Ga0209982_1010229 3300027552 Bacteria 1389
306 Ga0209982_1046664 3300027552 Bacteria 695
307 Ga0209982_1071300 3300027552 Unclassified 569
308 Ga0210002_1046029 3300027617 Bacteria 747
309 Ga0209974_10006598 3300027876 Bacteria 4040
310 Ga0209974_10019570 3300027876 Bacteria 2244
311 Ga0207428_10004837 3300027907 Bacteria 12715
312 Ga0207428_10909848 3300027907 Bacteria 621
313 Ga0268266_10170360 3300028379 Bacteria 1976
314 Ga0268266_10530094 3300028379 Bacteria 1127
315 Ga0268265_10006346 3300028380 Bacteria 8014
316 Ga0268265_10472297 3300028380 Bacteria 1176
317 Ga0307516_10001281 3300031730 Bacteria 34984
318 Ga0307405_10303821 3300031731 Bacteria 1212
319 Ga0307405_10786723 3300031731 Bacteria 796
320 Ga0307405_11381095 3300031731 Bacteria 615
321 Ga0307410_10742188 3300031852 Unclassified 831
322 Ga0307412_10173074 3300031911 Bacteria 1616
323 Ga0307416_100248052 3300032002 Bacteria 1731
324 Ga0307416_100334882 3300032002 Bacteria 1523
325 Ga0307416_100468967 3300032002 Bacteria 1316
326 Ga0307416_101413390 3300032002 Bacteria 801
327 Ga0307411_11787608 3300032005 Bacteria 570
328 Ga0373956_0189326 3300035119 Bacteria 974
329 Ga0373957_0030166 3300035120 Bacteria 1986
330 Ga0373943_0014995 3300035170 Bacteria 3518
331 Ga0373924_0308932 3300035410 Bacteria 702
332 Ga0373935_0105727 3300035692 Bacteria 1861
333 Ga0373937_0026757 3300036401 Bacteria 5213
334 Ga0373937_1141217 3300036401 Unclassified 728
335 Ga0373925_0125421 3300037068 Bacteria 1997
336 Ga0451797_1301464 3300041453 Bacteria 798
337 Ga0451845_0583611 3300041501 Unclassified 538
338 Ga0451849_0263988 3300041505 Bacteria 599
339 Ga0451853_0190596 3300041512 Unclassified 699
340 Ga0439432_251163 3300042006 Bacteria 507
341 Ga0439449_0018909 3300042007 Bacteria 2583
342 Ga0439452_053466 3300042010 Bacteria 919
343 Ga0439440_0015703 3300042993 Bacteria 1649
344 Ga0453683_0630970 3300044673 Unclassified 700
345 Ga0495603_0240318 3300046455 Bacteria 1043
346 Ga0495629_0064096 3300046459 Bacteria 2566
347 Ga0495580_0227567 3300046472 Bacteria 1281
348 Ga0495639_0333095 3300046475 Bacteria 760
349 Ga0495618_0839714 3300046514 Bacteria 533
350 Ga0495628_0556697 3300046516 Bacteria 823
351 Ga0495640_0153065 3300046533 Bacteria 1481
352 Ga0495598_0143658 3300046537 Bacteria 827
353 Ga0495621_0147581 3300046539 Bacteria 923
354 Ga0495645_0102491 3300046543 Bacteria 2034
355 Ga0495645_0135060 3300046543 Bacteria 1726
356 Ga0495667_0224393 3300046559 Bacteria 1199
357 Ga0495635_0060178 3300046663 Bacteria 2611
358 Ga0495646_0388380 3300046680 Bacteria 727
359 Ga0495647_0165816 3300046681 Bacteria 954
360 Ga0495647_0323139 3300046681 Bacteria 699
361 Ga0495613_0634233 3300046689 Bacteria 708
362 Ga0495670_0582164 3300046691 Bacteria 609
363 Ga0495670_0786831 3300046691 Unclassified 519
364 Ga0495674_0076834 3300047319 Bacteria 2872
365 Ga0495676_0977703 3300047321 Bacteria 541
366 Ga0496100_0969887 3300048903 Unclassified 669
367 Ga0496108_0413079 3300048911 Bacteria 1179
368 Ga0496110_0579502 3300048913 Bacteria 1019
369 Ga0496110_1076526 3300048913 Bacteria 712
370 Ga0496126_0069754 3300048929 Bacteria 3134
371 Ga0501032_0014604 3300049569 Bacteria 5563
372 Ga0501032_0654921 3300049569 Bacteria 667
373 Ga0501033_0025126 3300049570 Bacteria 4488
374 Ga0501034_0042621 3300049571 Bacteria 4594
375 Ga0501034_0131895 3300049571 Bacteria 2481
376 Ga0501034_0584224 3300049571 Unclassified 1024
377 Ga0501036_0011300 3300049572 Bacteria 7386
378 Ga0501036_0027474 3300049572 Bacteria 4807
379 Ga0501037_0003619 3300049573 Bacteria 11201
380 Ga0501037_0059633 3300049573 Unclassified 2783
381 Ga0501038_0007243 3300049574 Bacteria 10246
382 Ga0501038_0015410 3300049574 Bacteria 6949
383 Ga0501038_0830352 3300049574 Bacteria 685
384 Ga0501039_0030495 3300049575 Unclassified 4158
385 Ga0501039_0186249 3300049575 Bacteria 1632
386 Ga0501040_0022732 3300049576 Bacteria 4200
387 Ga0501040_0244800 3300049576 Bacteria 1279
388 Ga0501041_0004553 3300049577 Bacteria 8043
389 Ga0501042_0019621 3300049578 Bacteria 4698
390 Ga0501042_1238778 3300049578 Bacteria 544
391 Ga0501043_0014100 3300049579 Bacteria 6254
392 Ga0501043_0056335 3300049579 Bacteria 3087
393 Ga0501046_0156738 3300049580 Unclassified 1715
394 Ga0501047_0093072 3300049581 Bacteria 2893
395 Ga0501048_0320860 3300049582 Bacteria 1103
396 Ga0501048_0844271 3300049582 Bacteria 658
397 Ga0501048_1082673 3300049582 Bacteria 577
398 Ga0501068_0065919 3300049584 Unclassified 2205
399 Ga0501070_0018785 3300049586 Bacteria 5799
400 Ga0501071_0015015 3300049587 Bacteria 5308
401 Ga0501071_0214011 3300049587 Bacteria 1449
402 Ga0501072_0002752 3300049588 Bacteria 13209
403 Ga0501073_0023530 3300049589 Bacteria 4423
404 Ga0501074_0407397 3300049590 Unclassified 964
405 Ga0501075_0001645 3300049591 Bacteria 14682
406 Ga0501075_0556580 3300049591 Bacteria 875
407 Ga0501076_0003431 3300049592 Bacteria 11120
408 Ga0501077_0009563 3300049593 Bacteria 6027
409 Ga0501233_109357 3300049668 Bacteria 738
410 Ga0501225_0169741 3300049705 Unclassified 676
411 Ga0501079_0001743 3300049741 Bacteria 15508
412 Ga0501080_0022413 3300049742 Bacteria 5851
413 Ga0501080_0047370 3300049742 Bacteria 4001
414 Ga0501081_0006975 3300049743 Bacteria 7345
415 Ga0501081_0053444 3300049743 Bacteria 2789
416 Ga0501083_0010526 3300049744 Bacteria 6509
417 Ga0501035_0023054 3300049822 Bacteria 5713
418 Ga0501035_0079819 3300049822 Unclassified 2890
419 Ga0501044_0009987 3300049823 Bacteria 10312
420 Ga0501045_0056228 3300049824 Bacteria 2877
421 Ga0501045_1027204 3300049824 Bacteria 604
422 nmdc:mga04h51_320469_c1 3300050495 Bacteria 635
423 nmdc:mga09592_168906_c1 3300050508 Bacteria 1011
424 nmdc:mga09592_413021_c1 3300050508 Bacteria 1166
425 nmdc:mga06r32_930700_c1 3300050510 Bacteria 824
426 nmdc:mga08y16_131050_c1 3300050511 Bacteria 2607
427 nmdc:mga08y16_1376385_c1 3300050511 Bacteria 670
428 nmdc:mga08y16_7903_c1 3300050511 Bacteria 11131
429 nmdc:mga08y16_96629_c1 3300050511 Unclassified 3076
430 nmdc:mga0rr50_1328064_c1 3300050513 Bacteria 609
431 Ga0495601_0074361 3300053077 Bacteria 2174
432 Ga0495612_0255838 3300053078 Bacteria 779
433 Ga0495619_0077480 3300053085 Bacteria 2233
434 Ga0495619_0077631 3300053085 Bacteria 2231
435 Ga0500627_0311741 3300053158 Bacteria 685
436 Ga0501084_0007391 3300054114 Bacteria 9055
437 Ga0530510_0003596 3300061734 Bacteria 10671
438 2643916234 2643221581 Bacteria 3893603
439 Ga0496114_0003316
440 Ga0065712_10435425
441 Ga0065715_10588095
442 Ga0070658_10511296
443 Ga0070658_10697925
444 Ga0070676_10000472
445 Ga0070690_100291162
446 Ga0070690_100598771
447 Ga0070690_100916864
448 Ga0070670_100035529
449 Ga0070670_100061802
450 Ga0070670_100677055
451 Ga0070670_100803591
452 Ga0070677_10003912
453 Ga0070677_10046298
454 Ga0068869_100000782
455 Ga0068869_100002744
456 Ga0070666_10000383
457 Ga0070666_10685354
458 Ga0070680_100571183
459 Ga0068868_100235195
460 Ga0068868_101418037
461 Ga0070660_100726849
462 Ga0070689_100174206
463 Ga0070689_100437134
464 Ga0070689_101571916
465 Ga0070661_101329538
466 Ga0070692_10295448
467 Ga0070668_100001273
468 Ga0070669_100002155
469 Ga0070675_100002617
470 Ga0070675_100009479
471 Ga0070675_100530904
472 Ga0070671_100144891
473 Ga0070671_100797966
474 Ga0070674_100045204
475 Ga0070674_100125465
476 Ga0070673_100108870
477 Ga0070673_100231756
478 Ga0070673_100342452
479 Ga0070688_100150745
480 Ga0070688_100890267
481 Ga0070659_101123437
482 Ga0070667_100002701
483 Ga0070667_100405203
484 Ga0070701_10133969
485 Ga0070705_100000798
486 Ga0070694_100024699
487 Ga0070708_100555240
488 Ga0070663_100093865
489 Ga0070678_100028442
490 Ga0070678_100078499
491 Ga0070678_100080250
492 Ga0070678_100085960
493 Ga0070678_100124762
494 Ga0070678_100217580
495 Ga0070662_100002002
496 Ga0070662_100068815
497 Ga0070662_100202260
498 Ga0068867_100006666
499 Ga0070706_100185461
500 Ga0070707_100514320
501 Ga0070699_100017291
502 Ga0070699_102035945
503 Ga0070684_101951525
504 Ga0070697_100003801
505 Ga0068853_100041700
506 Ga0068853_100069018
507 Ga0070672_100002092
508 Ga0070672_100010069
509 Ga0070672_100037125
510 Ga0070672_101159974
511 Ga0070686_100022911
512 Ga0070686_100439749
513 Ga0070695_100000996
514 Ga0070696_100001647
515 Ga0070693_100016298
516 Ga0070693_100260681
517 Ga0070693_100907363
518 Ga0070665_100130159
519 Ga0070665_101393414
520 Ga0070704_101122368
521 Ga0068857_100631207
522 Ga0068857_101433672
523 Ga0068854_100470980
524 Ga0068856_100039435
525 Ga0068852_100022201
526 Ga0068852_100069704
527 Ga0068852_100207087
528 Ga0068852_100241926
529 Ga0068852_100637838
530 Ga0068852_101588912
531 Ga0068859_100129251
532 Ga0068859_100595888
533 Ga0068859_100881498
534 Ga0068864_100008915
535 Ga0068864_100225138
536 Ga0068864_101048090
537 Ga0068866_10007383
538 Ga0068861_100001459
539 Ga0068851_10126900
540 Ga0068851_10804232
541 Ga0068851_10925374
542 Ga0068870_10521900
543 Ga0068863_100001611
544 Ga0068863_100014714
545 Ga0068863_100047025
546 Ga0068863_100057323
547 Ga0068863_100348490
548 Ga0068863_101367479
549 Ga0068858_100519630
550 Ga0068858_101291725
551 Ga0068860_100003919
552 Ga0068860_101500597
553 Ga0068862_100002751
554 Ga0068862_100101592
555 Ga0070716_100481380
556 Ga0075366_10257478
557 Ga0097621_100023069
558 Ga0097621_100073269
559 Ga0097621_100121736
560 Ga0097621_100166363
561 Ga0097621_100193053
562 Ga0097621_100263563
563 Ga0097621_102216056
564 Ga0068871_100004228
565 Ga0068871_100010010
566 Ga0068871_100112979
567 Ga0068871_100155365
568 Ga0068871_100190726
569 Ga0068871_101849345
570 Ga0075428_100098532
571 Ga0075429_100308678
572 Ga0075429_100550545
573 Ga0068865_100002156
574 Ga0068865_100239591
575 Ga0068865_100977503
576 Ga0068865_101054616
577 Ga0097620_100129243
578 Ga0097620_100595885
579 Ga0097620_100881266
580 Ga0105240_10773243
581 Ga0111539_10001041
582 Ga0111539_10025764
583 Ga0111539_10161771
584 Ga0111539_11746678
585 Ga0105245_10064028
586 Ga0105245_10101215
587 Ga0105247_10114069
588 Ga0114129_11613901
589 Ga0105243_10332927
590 Ga0105243_11888815
591 Ga0105241_10528860
592 Ga0105242_10021774
593 Ga0105242_10338107
594 Ga0105242_10433213
595 Ga0105242_10821518
596 Ga0105248_10002726
597 Ga0105248_10009185
598 Ga0105248_10034622
599 Ga0105248_10035120
600 Ga0105248_10248590
601 Ga0105248_10306363
602 Ga0105249_10000996
603 Ga0105246_11201141
604 Ga0157339_1014522
605 Ga0157373_10984789
606 Ga0157370_10200536
607 Ga0157370_10722549
608 Ga0157374_10039898
609 Ga0157374_10071555
610 Ga0157374_10097449
611 Ga0157374_10300187
612 Ga0157374_12185159
613 Ga0157378_10010904
614 Ga0157378_10044479
615 Ga0157378_10456278
616 Ga0157378_10753931
617 Ga0163162_10021806
618 Ga0163162_10034779
619 Ga0163162_10255205
620 Ga0163162_10333308
621 Ga0163162_10342380
622 Ga0157375_10000906
623 Ga0157375_10011174
624 Ga0157375_10014952
625 Ga0157375_10078860
626 Ga0157375_10110006
627 Ga0163163_10446369
628 Ga0157380_10955027
629 Ga0157377_10705650
630 Ga0157377_10910798
631 Ga0157379_10015165
632 Ga0157379_10320192
633 Ga0157376_10001379
634 Ga0157376_10023563
635 Ga0157376_10238144
636 Ga0157376_10397336
637 Ga0157376_10433366
638 Ga0157376_10683940
639 Ga0163161_10000551
640 Ga0207697_10022886
641 Ga0207656_10009223
642 Ga0207656_10088016
643 Ga0207656_10104265
644 Ga0207682_10005457
645 Ga0207682_10066332
646 Ga0207682_10301814
647 Ga0207642_10289984
648 Ga0207688_10060480
649 Ga0207680_10012679
650 Ga0207680_10200653
651 Ga0207645_10000390
652 Ga0207645_11232588
653 Ga0207705_10515301
654 Ga0207705_10593053
655 Ga0207654_10190399
656 Ga0207695_10470697
657 Ga0207662_10076117
658 Ga0207657_10490370
659 Ga0207681_10001344
660 Ga0207694_10888086
661 Ga0207650_10500838
662 Ga0207650_10612924
663 Ga0207659_10007942
664 Ga0207659_10332196
665 Ga0207659_10666371
666 Ga0207687_10091667
667 Ga0207687_10944131
668 Ga0207644_10205703
669 Ga0207644_11189213
670 Ga0207706_10006984
671 Ga0207706_10011456
672 Ga0207706_10314834
673 Ga0207706_11149249
674 Ga0207706_11363336
675 Ga0207686_10075242
676 Ga0207709_10753018
677 Ga0207709_11542291
678 Ga0207670_10226906
679 Ga0207669_10005373
680 Ga0207704_10002919
681 Ga0207704_10683406
682 Ga0207704_10783493
683 Ga0207704_11026684
684 Ga0207704_11172203
685 Ga0207665_10143237
686 Ga0207691_10001079
687 Ga0207691_10004663
688 Ga0207691_10022820
689 Ga0207691_10024680
690 Ga0207691_10068524
691 Ga0207711_10040861
692 Ga0207711_10070439
693 Ga0207711_10148022
694 Ga0207711_10668034
695 Ga0207689_10003499
696 Ga0207689_10008976
697 Ga0207651_10585834
698 Ga0207651_10612114
699 Ga0207651_11335035
700 Ga0207712_10000987
701 Ga0207668_10039113
702 Ga0207658_10051803
703 Ga0207658_10483841
704 Ga0207658_10706182
705 Ga0207677_10089960
706 Ga0207703_10004869
707 Ga0207703_10112533
708 Ga0207703_10320361
709 Ga0207703_11036371
710 Ga0207639_10067510
711 Ga0207639_10077512
712 Ga0207639_10110496
713 Ga0207678_10034429
714 Ga0207678_10134857
715 Ga0207678_10379230
716 Ga0207702_10045319
717 Ga0207641_10012611
718 Ga0207641_10020591
719 Ga0207641_10258582
720 Ga0207641_11084224
721 Ga0207648_10001878
722 Ga0207648_10188349
723 Ga0207676_10027601
724 Ga0207676_10207647
725 Ga0207674_10903936
726 Ga0207675_100002444
727 Ga0207675_100085973
728 Ga0207683_10070502
729 Ga0207683_10104429
730 Ga0207683_10113083
731 Ga0207683_10210135
732 Ga0207698_10070944
733 Ga0207698_10225218
734 Ga0207698_10424861
735 Ga0207698_10684141
736 Ga0207698_11350009
737 Ga0207698_11372457
738 Ga0209969_1012299
739 Ga0210000_1018269
740 Ga0209995_1045003
741 Ga0209995_1047567
742 Ga0209968_1007801
743 Ga0209982_1010229
744 Ga0209982_1046664
745 Ga0209982_1071300
746 Ga0210002_1046029
747 Ga0209974_10006598
748 Ga0209974_10019570
749 Ga0207428_10004837
750 Ga0207428_10909848
751 Ga0268266_10170360
752 Ga0268266_10530094
753 Ga0268265_10006346
754 Ga0268265_10472297
755 Ga0307516_10001281
756 Ga0307405_10303821
757 Ga0307405_10786723
758 Ga0307405_11381095
759 Ga0307410_10742188
760 Ga0307412_10173074
761 Ga0307416_100248052
762 Ga0307416_100334882
763 Ga0307416_100468967
764 Ga0307416_101413390
765 Ga0307411_11787608
766 Ga0373956_0189326
767 Ga0373957_0030166
768 Ga0373943_0014995
769 Ga0373924_0308932
770 Ga0373935_0105727
771 Ga0373937_0026757
772 Ga0373937_1141217
773 Ga0373925_0125421
774 Ga0451797_1301464
775 Ga0451845_0583611
776 Ga0451849_0263988
777 Ga0451853_0190596
778 Ga0439432_251163
779 Ga0439449_0018909
780 Ga0439452_053466
781 Ga0439440_0015703
782 Ga0453683_0630970
783 Ga0495603_0240318
784 Ga0495629_0064096
785 Ga0495580_0227567
786 Ga0495639_0333095
787 Ga0495618_0839714
788 Ga0495628_0556697
789 Ga0495640_0153065
790 Ga0495598_0143658
791 Ga0495621_0147581
792 Ga0495645_0102491
793 Ga0495645_0135060
794 Ga0495667_0224393
795 Ga0495635_0060178
796 Ga0495646_0388380
797 Ga0495647_0165816
798 Ga0495647_0323139
799 Ga0495613_0634233
800 Ga0495670_0582164
801 Ga0495670_0786831
802 Ga0495674_0076834
803 Ga0495676_0977703
804 Ga0496100_0969887
805 Ga0496108_0413079
806 Ga0496110_0579502
807 Ga0496110_1076526
808 Ga0496126_0069754
809 Ga0501032_0014604
810 Ga0501032_0654921
811 Ga0501033_0025126
812 Ga0501034_0042621
813 Ga0501034_0131895
814 Ga0501034_0584224
815 Ga0501036_0011300
816 Ga0501036_0027474
817 Ga0501037_0003619
818 Ga0501037_0059633
819 Ga0501038_0007243
820 Ga0501038_0015410
821 Ga0501038_0830352
822 Ga0501039_0030495
823 Ga0501039_0186249
824 Ga0501040_0022732
825 Ga0501040_0244800
826 Ga0501041_0004553
827 Ga0501042_0019621
828 Ga0501042_1238778
829 Ga0501043_0014100
830 Ga0501043_0056335
831 Ga0501046_0156738
832 Ga0501047_0093072
833 Ga0501048_0320860
834 Ga0501048_0844271
835 Ga0501048_1082673
836 Ga0501068_0065919
837 Ga0501070_0018785
838 Ga0501071_0015015
839 Ga0501071_0214011
840 Ga0501072_0002752
841 Ga0501073_0023530
842 Ga0501074_0407397
843 Ga0501075_0001645
844 Ga0501075_0556580
845 Ga0501076_0003431
846 Ga0501077_0009563
847 Ga0501233_109357
848 Ga0501225_0169741
849 Ga0501079_0001743
850 Ga0501080_0022413
851 Ga0501080_0047370
852 Ga0501081_0006975
853 Ga0501081_0053444
854 Ga0501083_0010526
855 Ga0501035_0023054
856 Ga0501035_0079819
857 Ga0501044_0009987
858 Ga0501045_0056228
859 Ga0501045_1027204
860 nmdc:mga04h51_320469_c1
861 nmdc:mga09592_168906_c1
862 nmdc:mga09592_413021_c1
863 nmdc:mga06r32_930700_c1
864 nmdc:mga08y16_131050_c1
865 nmdc:mga08y16_1376385_c1
866 nmdc:mga08y16_7903_c1
867 nmdc:mga08y16_96629_c1
868 nmdc:mga0rr50_1328064_c1
869 Ga0495601_0074361
870 Ga0495612_0255838
871 Ga0495619_0077480
872 Ga0495619_0077631
873 Ga0500627_0311741
874 Ga0501084_0007391
875 Ga0530510_0003596
876 2643916234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

52

143

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8703 5 111
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8481 5 111
4aez-assembly2.cif.gz_D crystal structure of mitotic checkpoint complex 0.7028 54 83
5xog-assembly1.cif.gz_M rna polymerase ii elongation complex bound with spt5 kow5 and elf1 0.6153 56 88
3j9w-assembly1.cif.gz_BR cryo-em structure of the bacillus subtilis mifm-stalled ribosome complex 0.6063 55 87
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9525 6 122 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9194 5 118 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9006 6 122 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8657 5 113 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8512 5 113 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A2N7TK62-F1-model_v4 Aldehyde-activating protein 0.9858 2 132 GO:0016846
GO:0046872
AF-A0A7X9YDI4-F1-model_v4 deleted 0.9805 2 132
AF-A0A0K8P5Y1-F1-model_v4 CENP-V/GFA domain-containing protein 0.9736 14 132 GO:0016846
GO:0046872
AF-A0A2N7TK62-F1-model_v4 Aldehyde-activating protein 0.9711 2 132 GO:0016846
GO:0046872
AF-A0A7X9YDI4-F1-model_v4 deleted 0.9659 2 132

Map