F443905

General Info

Members Datasets Scaffolds Average Seq Length
437 400 172 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2957415311|2957415823
Length 240
Sequence RILVVDDEPQIQRFLRPALAAAGYDVIEAANGAQALKAAATAAPDVVILDLGLPDMDGKDVVANIRAWSQVPIIILSARDRESEKIAALDLGADDYIEKPFGIGELTARIRAALRHRIQMAGGQAQLSADGLSIDMVKRVVTRDGAALRLTPKEYDLLVMLAHHAGRVVTHRTLLTSVWGVAHGEDLHYLRVFIGQLRGKIERDPGNPKIVRTEPGVGYRFVGDEEELVQPTTSPIPGNA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
16 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
17 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
18 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
19 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
20 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
21 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
22 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
23 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
24 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
25 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
26 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
27 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
28 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
29 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
30 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
31 2643221557 Ensifer sp. Root558 Isolate Unclassified
32 2643221558 Rhizobium sp. Root149 Isolate Unclassified
33 2643221568 Rhizobium sp. Root564 Isolate Unclassified
34 2643221610 Ensifer sp. Root74 Isolate Unclassified
35 2643221618 Ensifer sp. Root231 Isolate Unclassified
36 2643221626 Ensifer sp. Root31 Isolate Unclassified
37 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
38 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
39 2643221655 Ensifer sp. Root1252 Isolate Unclassified
40 2643221659 Ensifer sp. Root127 Isolate Unclassified
41 2643221668 Ensifer sp. Root423 Isolate Unclassified
42 2643221675 Ensifer sp. Root1298 Isolate Unclassified
43 2643221680 Ensifer sp. Root1312 Isolate Unclassified
44 2643221698 Ensifer sp. Root142 Isolate Unclassified
45 2643221712 Ensifer sp. Root258 Isolate Unclassified
46 2643221718 Rhizobium sp. Root268 Isolate Unclassified
47 2643221719 Rhizobium sp. Root274 Isolate Unclassified
48 2643221723 Ensifer sp. Root278 Isolate Unclassified
49 2643221726 Ensifer sp. Root954 Isolate Unclassified
50 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
51 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
52 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
53 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
54 2773857925 Microvirga vignae BR3299 Isolate Unclassified
55 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
56 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
57 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
58 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
59 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
60 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
61 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
62 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
63 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
64 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
65 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
66 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
67 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
68 2844163670 Ensifer sp. 1H6 Isolate Unclassified
69 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
70 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
71 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
72 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
73 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
74 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
75 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
76 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
77 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
78 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
79 2909042592 Labrys sp. LIt4 Isolate Nodule
80 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
81 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
82 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
83 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
84 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
85 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
86 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
87 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
88 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
89 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
90 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
91 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
92 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
93 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
94 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
95 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
96 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
97 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
98 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
99 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
100 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
101 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
102 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
103 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
104 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
105 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
106 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
107 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
108 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
109 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
110 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
111 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
112 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
113 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
114 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
115 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
116 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
117 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
118 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
119 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
120 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
121 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
122 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
123 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
124 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
125 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
126 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
127 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
128 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
129 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
130 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
131 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
132 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
133 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
134 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
135 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
136 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
137 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
138 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
139 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
140 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
141 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
142 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
143 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
144 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
145 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
146 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
147 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
148 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
149 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
150 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
151 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
152 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
153 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
154 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
155 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
156 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
157 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
158 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
159 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
160 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
161 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
162 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
163 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
164 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
165 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
166 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
167 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
168 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
169 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
170 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
171 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
172 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
173 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
174 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
175 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
176 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
177 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
178 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
179 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
180 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
181 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
182 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
183 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
184 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
185 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
186 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
187 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
188 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
189 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
190 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
191 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
192 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
193 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
194 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
195 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
196 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
197 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
198 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
199 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
200 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
201 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
202 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
203 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
204 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
205 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
206 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
207 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
208 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
209 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
210 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
211 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
212 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
213 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
214 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
215 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
216 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
217 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
218 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
219 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
220 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
221 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
222 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
223 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
224 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
225 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
226 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
227 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
228 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
229 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
230 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
231 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
232 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
233 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
234 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
235 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
236 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
237 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
238 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
239 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
240 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
241 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
242 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
243 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
244 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
245 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
246 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
247 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
248 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
249 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
250 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
251 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
252 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
253 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
254 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
255 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
256 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
257 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
258 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
259 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
260 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
261 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
262 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
263 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
264 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
265 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
266 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
267 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
268 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
269 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
270 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
271 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
272 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
273 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
274 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
275 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
276 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
277 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
278 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
279 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
280 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
281 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
282 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
283 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
284 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
285 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
286 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
287 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
289 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
290 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
291 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
292 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
293 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
294 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
295 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
296 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
297 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
298 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
299 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
300 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
301 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
302 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
303 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
304 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
305 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
306 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
307 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
308 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
309 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
311 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
313 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
315 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
316 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
330 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
331 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
332 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
333 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
334 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
335 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
336 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
337 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
338 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
339 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
340 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
341 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
342 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
343 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
344 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
345 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
346 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
347 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
352 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
353 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
354 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
355 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
356 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
357 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
358 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
363 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
364 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
365 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
366 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
387 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
388 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
391 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
392 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
393 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
394 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
395 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
396 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
397 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
398 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
399 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
400 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 39.36
Metatranscriptomes 0
Isolates 60.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 7.78
Nodule 49.66
Rhizoplane 0.92
Rhizosphere 24.94
Stem 0
Stem Tuber 0
Unclassified 16.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000003 3300002987 Bacteria 274069
2 JGI25151J46595_10032489 3300003187 Bacteria 2022
3 JGI25160J50197_1000003 3300003354 Bacteria 482719
4 JGI25161J50226_1000373 3300003374 Bacteria 22529
5 Ga0055526_1002068 3300003771 Bacteria 13783
6 Ga0055524_1000660 3300003775 Bacteria 24371
7 Ga0055524_1020631 3300003775 Bacteria 2212
8 Ga0055536_1004825 3300003781 Bacteria 6744
9 Ga0055540_1015025 3300003792 Bacteria 2275
10 Ga0055531_10010822 3300003794 Bacteria 4484
11 Ga0055543_1000203 3300004625 Bacteria 48554
12 Ga0065165_1000025 3300005262 Bacteria 246909
13 Ga0070658_10010502 3300005327 Bacteria 7421
14 Ga0070658_10068152 3300005327 Bacteria 2908
15 Ga0070676_10302402 3300005328 Bacteria 1085
16 Ga0068869_100057998 3300005334 Bacteria 2829
17 Ga0068869_100109664 3300005334 Bacteria 2098
18 Ga0070660_100097785 3300005339 Bacteria 2323
19 Ga0070661_100032962 3300005344 Bacteria 3752
20 Ga0070668_100097346 3300005347 Bacteria 2327
21 Ga0070669_100030318 3300005353 Bacteria 3902
22 Ga0070674_100039797 3300005356 Bacteria 3177
23 Ga0070659_100429619 3300005366 Bacteria 1118
24 Ga0070699_100198170 3300005518 Bacteria 1785
25 Ga0070704_100802110 3300005549 Bacteria 841
26 Ga0068854_100382950 3300005578 Bacteria 1159
27 Ga0068856_100009291 3300005614 Bacteria 9549
28 Ga0068852_100787472 3300005616 Bacteria 964
29 Ga0068859_100269164 3300005617 Bacteria 1796
30 Ga0068861_100047935 3300005719 Bacteria 3227
31 Ga0068858_100547033 3300005842 Unclassified 1121
32 Ga0075363_100228353 3300006048 Bacteria 1068
33 Ga0075367_10035039 3300006178 Bacteria 2903
34 Ga0075366_10061184 3300006195 Bacteria 2237
35 Ga0097620_100269179 3300006931 Bacteria 1796
36 Ga0079104_1003013 3300006946 Bacteria 8270
37 Ga0079104_1026317 3300006946 Bacteria 1504
38 Ga0114129_10010465 3300009147 Bacteria 13229
39 Ga0105243_10096082 3300009148 Bacteria 2450
40 Ga0105241_10162626 3300009174 Bacteria 1836
41 Ga0105249_10156496 3300009553 Bacteria 2198
42 Ga0105249_10182198 3300009553 Bacteria 2044
43 Ga0105249_10278739 3300009553 Bacteria 1669
44 Ga0105033_106138 3300009986 Bacteria 1038
45 Ga0157373_10385307 3300013100 Bacteria 1003
46 Ga0157370_10019013 3300013104 Bacteria 6906
47 Ga0157370_10054570 3300013104 Bacteria 3809
48 Ga0157369_10010942 3300013105 Bacteria 10328
49 Ga0157369_10024722 3300013105 Bacteria 6676
50 Ga0171463_1001 3300013249 Bacteria 1406070
51 Ga0157372_10498002 3300013307 Bacteria 1421
52 Ga0157379_10623709 3300014968 Bacteria 1008
53 Ga0183363_1157 3300015690 Bacteria 16650
54 Ga0163161_10353252 3300017792 Bacteria 1169
55 Ga0214542_1004397 3300021321 Bacteria 27975
56 Ga0214543_1000027 3300021327 Bacteria 215065
57 Ga0213875_10003950 3300021388 Bacteria 8284
58 Ga0213875_10155004 3300021388 Bacteria 1074
59 Ga0228711_1009677 3300022739 Bacteria 12965
60 Ga0228710_1000227 3300022740 Bacteria 59028
61 Ga0209436_100487 3300025208 Bacteria 17545
62 Ga0209130_1000005 3300025284 Bacteria 599620
63 Ga0209676_1004301 3300025292 Bacteria 8020
64 Ga0209025_1000148 3300025294 Bacteria 179802
65 Ga0209025_1000479 3300025294 Bacteria 77489
66 Ga0209025_1041616 3300025294 Bacteria 1965
67 Ga0209025_1064232 3300025294 Bacteria 1349
68 Ga0209564_1000093 3300025295 Bacteria 245793
69 Ga0209758_1087201 3300025297 Bacteria 925
70 Ga0209050_1005400 3300025298 Bacteria 8064
71 Ga0209256_1000027 3300025299 Bacteria 423283
72 Ga0209256_1001179 3300025299 Bacteria 29395
73 Ga0207426_1000015 3300025302 Bacteria 599316
74 Ga0209257_1002436 3300025304 Bacteria 18504
75 Ga0207705_10045926 3300025909 Bacteria 3139
76 Ga0207695_10170124 3300025913 Bacteria 2105
77 Ga0207657_10196438 3300025919 Bacteria 1625
78 Ga0207649_10048697 3300025920 Bacteria 2615
79 Ga0207694_10117381 3300025924 Bacteria 2121
80 Ga0207709_10091309 3300025935 Bacteria 1991
81 Ga0207669_10025819 3300025937 Bacteria 3183
82 Ga0207689_10204776 3300025942 Bacteria 1629
83 Ga0207668_10054676 3300025972 Bacteria 2772
84 Ga0207708_10563949 3300026075 Bacteria 961
85 Ga0207702_10107264 3300026078 Bacteria 2476
86 Ga0207675_100014862 3300026118 Bacteria 7266
87 Ga0209281_1000348 3300027111 Bacteria 76877
88 Ga0209281_1001850 3300027111 Bacteria 10266
89 Ga0209282_1000070 3300027666 Bacteria 85274
90 Ga0307515_10272434 3300028794 Bacteria 1412
91 Ga0307515_10364278 3300028794 Bacteria 1085
92 Ga0265328_10000012 3300031239 Bacteria 157661
93 Ga0265328_10000455 3300031239 Bacteria 19057
94 Ga0265328_10001182 3300031239 Bacteria 12080
95 Ga0265328_10009195 3300031239 Bacteria 4033
96 Ga0265328_10022820 3300031239 Bacteria 2377
97 Ga0265329_10006667 3300031242 Bacteria 4556
98 Ga0265331_10000005 3300031250 Bacteria 465192
99 Ga0265331_10000639 3300031250 Bacteria 30292
100 Ga0265331_10006187 3300031250 Bacteria 7105
101 Ga0265327_10022802 3300031251 Bacteria 3728
102 Ga0265327_10024451 3300031251 Bacteria 3549
103 Ga0265316_10003218 3300031344 Bacteria 16591
104 Ga0265342_10147465 3300031712 Bacteria 1309
105 Ga0307516_10000115 3300031730 Bacteria 92959
106 Ga0315914_1000082 3300031967 Bacteria 78317
107 Ga0307409_100852598 3300031995 Bacteria 922
108 Ga0307416_100576531 3300032002 Bacteria 1202
109 Ga0307510_10408994 3300033180 Bacteria 799
110 Ga0315913_1000028 3300033430 Bacteria 78319
111 Ga0315915_1000004 3300033464 Bacteria 403083
112 Ga0373927_0000127 3300035695 Bacteria 58182
113 Ga0373947_0371872 3300035725 Bacteria 961
114 Ga0373925_0001717 3300037068 Bacteria 18461
115 Ga0395900_0084776 3300037418 Bacteria 3256
116 Ga0395900_0779929 3300037418 Bacteria 885
117 Ga0395898_0013929 3300037466 Bacteria 8263
118 Ga0395905_0000510 3300037471 Bacteria 53278
119 Ga0395905_0004003 3300037471 Bacteria 15481
120 Ga0436364_0505046 3300037853 Bacteria 1052
121 Ga0436364_0810010 3300037853 Bacteria 985
122 Ga0436364_1158546 3300037853 Bacteria 10695
123 Ga0395901_0215402 3300038443 Bacteria 2009
124 Ga0436365_1432485 3300039437 Bacteria 1359
125 Ga0439465_0127655 3300041413 Bacteria 896
126 Ga0451853_4045482 3300041512 Bacteria 1097
127 Ga0439449_0069981 3300042007 Bacteria 1293
128 Ga0466966_0068031 3300044684 Bacteria 2236
129 Ga0466964_0100451 3300044706 Bacteria 1275
130 Ga0466959_0069010 3300045049 Bacteria 2561
131 Ga0466958_0062340 3300045836 Bacteria 2273
132 Ga0495638_0102076 3300046460 Bacteria 1714
133 Ga0495625_0161255 3300046660 Bacteria 1502
134 Ga0496116_0000100 3300048919 Bacteria 194740
135 Ga0496117_0124831 3300048920 Bacteria 1573
136 Ga0496118_0018814 3300048921 Bacteria 6203
137 Ga0496118_0180335 3300048921 Bacteria 1276
138 Ga0496120_0165228 3300048923 Bacteria 1099
139 Ga0496121_0354064 3300048924 Bacteria 977
140 Ga0496122_0000032 3300048925 Bacteria 327099
141 Ga0496122_0004142 3300048925 Bacteria 18314
142 Ga0496122_0014548 3300048925 Bacteria 7597
143 Ga0496123_0000093 3300048926 Bacteria 179205
144 Ga0496123_0000539 3300048926 Bacteria 65166
145 Ga0496123_0115321 3300048926 Bacteria 1525
146 Ga0496124_0001614 3300048927 Bacteria 32295
147 Ga0496124_0448969 3300048927 Bacteria 880
148 Ga0496125_0000041 3300048928 Bacteria 310158
149 Ga0496126_0000299 3300048929 Bacteria 105208
150 Ga0496126_0000311 3300048929 Bacteria 103353
151 Ga0501032_0142344 3300049569 Bacteria 1579
152 Ga0501034_0012829 3300049571 Bacteria 8642
153 Ga0501034_0047860 3300049571 Bacteria 4316
154 Ga0501036_0705757 3300049572 Bacteria 833
155 Ga0501046_0029718 3300049580 Bacteria 4441
156 Ga0501047_0281814 3300049581 Bacteria 1506
157 Ga0501047_0645227 3300049581 Bacteria 878
158 Ga0501067_0067384 3300049583 Bacteria 1982
159 Ga0501073_0314844 3300049589 Bacteria 1080
160 Ga0501280_000902 3300049776 Bacteria 6349
161 Ga0501035_0000181 3300049822 Bacteria 76816
162 Ga0501035_0240918 3300049822 Bacteria 1538
163 Ga0501044_0383205 3300049823 Bacteria 1321
164 Ga0501044_0512111 3300049823 Bacteria 1100
165 nmdc:mga05p37_197886_c1 3300050507 Bacteria 2436
166 Ga0495619_0278030 3300053085 Bacteria 1160
167 Ga0500559_0060787 3300053136 Bacteria 1684
168 Ga0500604_0001945 3300053151 Bacteria 5742
169 Ga0500622_0004040 3300053156 Bacteria 9443
170 Ga0500634_0075209 3300053161 Bacteria 1756
171 Ga0500636_0003767 3300053177 Bacteria 8563
172 Ga0466962_0019268 3300061719 Bacteria 3278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031239 Ga0265328_10000012 Ga0265328_1000001288 194
2 3300031242 Ga0265329_10006667 Ga0265329_100066674 194
3 3300031250 Ga0265331_10000639 Ga0265331_1000063912 194
4 3300031251 Ga0265327_10022802 Ga0265327_100228022 194
5 3300031344 Ga0265316_10003218 Ga0265316_100032188 194
6 3300031712 Ga0265342_10147465 Ga0265342_101474651 194
7 3300028794 Ga0307515_10364278 Ga0307515_103642782 202
8 3300048927 Ga0496124_0448969 Ga0496124_0448969_240_869 209
9 iso_pu_bacteria 2909042592 2909047321 222
10 iso_pu_bacteria 2919450847 2919451272 223
11 3300049581 Ga0501047_0281814 Ga0501047_0281814_96_779 224
12 3300049823 Ga0501044_0512111 Ga0501044_0512111_82_765 224
13 iso_pu_bacteria 2510461069 2510839089 224
14 iso_pu_bacteria 2643221568 2643855206 224
15 iso_pu_bacteria 2767802442 2770196551 224
16 iso_pu_bacteria 2775506902 2776269346 224
17 iso_pu_bacteria 2775506904 2776283515 224
18 iso_pu_bacteria 2839993093 2839993581 224
19 iso_pu_bacteria 2842871566 2842873748 224
20 iso_pu_bacteria 2894652903 2894653497 224
21 iso_pu_bacteria 2904578770 2904579722 224
22 iso_pu_bacteria 2919119836 2919120611 224
23 iso_pu_bacteria 2919166419 2919166776 224
24 iso_pu_bacteria 2928521798 2928526162 224
25 iso_pu_bacteria 2954011201 2954014941 224
26 iso_pu_bacteria 2978969890 2978973192 224
27 iso_pu_bacteria 2984587000 2984591441 224
28 iso_pu_bacteria 8001845381 8001848735 224
29 iso_pu_bacteria 8054460903 8054464526 224
30 3300013104 Ga0157370_10019013 Ga0157370_100190133 225
31 3300031239 Ga0265328_10001182 Ga0265328_100011827 225
32 3300031250 Ga0265331_10000005 Ga0265331_10000005278 225
33 3300037853 Ga0436364_0505046 Ga0436364_0505046_25_705 225
34 3300048925 Ga0496122_0014548 Ga0496122_0014548_1084_1767 225
35 3300048926 Ga0496123_0000539 Ga0496123_0000539_5411_6094 225
36 iso_pu_bacteria 2643221558 2643814593 225
37 iso_pu_bacteria 2643221653 2644297543 225
38 iso_pu_bacteria 2643221719 2644655796 225
39 iso_pu_bacteria 2738541317 2738948048 225
40 iso_pu_bacteria 2773857925 2774869485 225
41 iso_pu_bacteria 2775506901 2776261215 225
42 iso_pu_bacteria 2818991272 2819244501 225
43 iso_pu_bacteria 2835312727 2835319112 225
44 iso_pu_bacteria 2854916844 2854917350 225
45 iso_pu_bacteria 2882456835 2882459465 225
46 iso_pu_bacteria 2891373044 2891375882 225
47 iso_pu_bacteria 2899803654 2899805396 225
48 iso_pu_bacteria 2913308742 2913313113 225
49 iso_pu_bacteria 2989776772 2989781274 225
50 iso_pu_bacteria 8005246636 8005250432 225
51 iso_pu_bacteria 8018150411 8018150764 225
52 iso_pu_bacteria 8056875544 8056877922 225
53 3300048921 Ga0496118_0180335 Ga0496118_0180335_74_754 226
54 3300053136 Ga0500559_0060787 Ga0500559_0060787_155_844 226
55 iso_pu_bacteria 2508501122 2509109062 226
56 iso_pu_bacteria 2509276019 2509375204 226
57 iso_pu_bacteria 2510065057 2510304865 226
58 iso_pu_bacteria 2511231052 2511499238 226
59 iso_pu_bacteria 2512047086 2512530520 226
60 iso_pu_bacteria 2512875026 2512975086 226
61 iso_pu_bacteria 2513237086 2513587325 226
62 iso_pu_bacteria 2513237089 2513605124 226
63 iso_pu_bacteria 2513237091 2513618664 226
64 iso_pu_bacteria 2513237140 2513883269 226
65 iso_pu_bacteria 2513237143 2513902722 226
66 iso_pu_bacteria 2513237156 2513987582 226
67 iso_pu_bacteria 2513237160 2514007845 226
68 iso_pu_bacteria 2515154107 2515610172 226
69 iso_pu_bacteria 2516653046 2516897993 226
70 iso_pu_bacteria 2517487022 2517567730 226
71 iso_pu_bacteria 2524023207 2524452262 226
72 iso_pu_bacteria 2551306084 2551677682 226
73 iso_pu_bacteria 2551306085 2551689988 226
74 iso_pu_bacteria 2551306086 2551694754 226
75 iso_pu_bacteria 2551306087 2551697532 226
76 iso_pu_bacteria 2551306089 2551714263 226
77 iso_pu_bacteria 2551306090 2551717013 226
78 iso_pu_bacteria 2551306091 2551729314 226
79 iso_pu_bacteria 2551306092 2551731886 226
80 iso_pu_bacteria 2551306093 2551740482 226
81 iso_pu_bacteria 2558860100 2558866307 226
82 iso_pu_bacteria 2558860983 2561468516 226
83 iso_pu_bacteria 2599185352 2600191192 226
84 iso_pu_bacteria 2643221557 2643806078 226
85 iso_pu_bacteria 2643221610 2644070368 226
86 iso_pu_bacteria 2643221618 2644103502 226
87 iso_pu_bacteria 2643221626 2644144381 226
88 iso_pu_bacteria 2643221637 2644206656 226
89 iso_pu_bacteria 2643221655 2644306432 226
90 iso_pu_bacteria 2643221659 2644330622 226
91 iso_pu_bacteria 2643221668 2644377339 226
92 iso_pu_bacteria 2643221675 2644421130 226
93 iso_pu_bacteria 2643221680 2644454653 226
94 iso_pu_bacteria 2643221698 2644542574 226
95 iso_pu_bacteria 2643221712 2644612043 226
96 iso_pu_bacteria 2643221718 2644650303 226
97 iso_pu_bacteria 2643221723 2644671762 226
98 iso_pu_bacteria 2643221726 2644692592 226
99 iso_pu_bacteria 2757320392 2757572356 226
100 iso_pu_bacteria 2765235802 2765465947 226
101 iso_pu_bacteria 2802428858 2802721054 226
102 iso_pu_bacteria 2802428859 2802728143 226
103 iso_pu_bacteria 2802428860 2802733609 226
104 iso_pu_bacteria 2802428861 2802736648 226
105 iso_pu_bacteria 2802428862 2802746715 226
106 iso_pu_bacteria 2802428863 2802749787 226
107 iso_pu_bacteria 2844163670 2844170230 226
108 iso_pu_bacteria 2850079185 2850079734 226
109 iso_pu_bacteria 2855825444 2855829944 226
110 iso_pu_bacteria 2855839649 2855844872 226
111 iso_pu_bacteria 2858800743 2858804770 226
112 iso_pu_bacteria 2915980308 2915986731 226
113 iso_pu_bacteria 2915986958 2915987237 226
114 iso_pu_bacteria 2915993759 2915999102 226
115 iso_pu_bacteria 2916000859 2916004332 226
116 iso_pu_bacteria 2916007675 2916010065 226
117 iso_pu_bacteria 2916014648 2916017790 226
118 iso_pu_bacteria 2916021584 2916025551 226
119 iso_pu_bacteria 2916028427 2916032394 226
120 iso_pu_bacteria 2916035215 2916035463 226
121 iso_pu_bacteria 2916041962 2916043131 226
122 iso_pu_bacteria 2916048683 2916049463 226
123 iso_pu_bacteria 2916055098 2916056450 226
124 iso_pu_bacteria 2916061851 2916064145 226
125 iso_pu_bacteria 2916068649 2916070028 226
126 iso_pu_bacteria 2916076590 2916076679 226
127 iso_pu_bacteria 2920822456 2920823112 226
128 iso_pu_bacteria 2921201388 2921204494 226
129 iso_pu_bacteria 2921208531 2921208565 226
130 iso_pu_bacteria 2921237296 2921238500 226
131 iso_pu_bacteria 2921244191 2921248162 226
132 iso_pu_bacteria 2921250672 2921254063 226
133 iso_pu_bacteria 2921257292 2921262880 226
134 iso_pu_bacteria 2921263974 2921265479 226
135 iso_pu_bacteria 2921282425 2921285724 226
136 iso_pu_bacteria 2921289301 2921296555 226
137 iso_pu_bacteria 2921296804 2921303433 226
138 iso_pu_bacteria 2924144063 2924145209 226
139 iso_pu_bacteria 2924150972 2924153459 226
140 iso_pu_bacteria 2924158325 2924162687 226
141 iso_pu_bacteria 2924165586 2924172045 226
142 iso_pu_bacteria 2924172951 2924173996 226
143 iso_pu_bacteria 2924179722 2924181737 226
144 iso_pu_bacteria 2924186466 2924192649 226
145 iso_pu_bacteria 2924193448 2924195585 226
146 iso_pu_bacteria 2924200457 2924201926 226
147 iso_pu_bacteria 2924207177 2924208566 226
148 iso_pu_bacteria 2924214083 2924218794 226
149 iso_pu_bacteria 2924221636 2924224928 226
150 iso_pu_bacteria 2924228884 2924231041 226
151 iso_pu_bacteria 2936996657 2936999545 226
152 iso_pu_bacteria 2937002841 2937008859 226
153 iso_pu_bacteria 2937009748 2937012012 226
154 iso_pu_bacteria 2937016420 2937021277 226
155 iso_pu_bacteria 2937023124 2937027868 226
156 iso_pu_bacteria 2937029754 2937035473 226
157 iso_pu_bacteria 2937036028 2937039938 226
158 iso_pu_bacteria 2937042894 2937044237 226
159 iso_pu_bacteria 2937049772 2937049781 226
160 iso_pu_bacteria 2937056579 2937056783 226
161 iso_pu_bacteria 2937063883 2937065247 226
162 iso_pu_bacteria 2937071275 2937075565 226
163 iso_pu_bacteria 2937078374 2937078961 226
164 iso_pu_bacteria 2937084907 2937087495 226
165 iso_pu_bacteria 2937091812 2937093703 226
166 iso_pu_bacteria 2937098957 2937102721 226
167 iso_pu_bacteria 2937106411 2937106886 226
168 iso_pu_bacteria 2937113482 2937113853 226
169 iso_pu_bacteria 2937119839 2937121327 226
170 iso_pu_bacteria 2937126314 2937126365 226
171 iso_pu_bacteria 2941499720 2941500925 226
172 iso_pu_bacteria 2957375807 2957376314 226
173 iso_pu_bacteria 2957382221 2957383971 226
174 iso_pu_bacteria 2957388812 2957391000 226
175 iso_pu_bacteria 2957395598 2957401008 226
176 iso_pu_bacteria 2957402308 2957405312 226
177 iso_pu_bacteria 2957408893 2957412681 226
178 iso_pu_bacteria 2957415311 2957415823 226
179 iso_pu_bacteria 2957422303 2957424985 226
180 iso_pu_bacteria 2957430029 2957434004 226
181 iso_pu_bacteria 2957437181 2957440488 226
182 iso_pu_bacteria 2957443900 2957448193 226
183 iso_pu_bacteria 2957450854 2957453431 226
184 iso_pu_bacteria 2957457609 2957462384 226
185 iso_pu_bacteria 2957464669 2957468537 226
186 iso_pu_bacteria 2957471148 2957476102 226
187 iso_pu_bacteria 2957478035 2957478047 226
188 iso_pu_bacteria 2957484790 2957485760 226
189 iso_pu_bacteria 2957491536 2957493473 226
190 iso_pu_bacteria 2957498199 2957498207 226
191 iso_pu_bacteria 2957505466 2957512389 226
192 iso_pu_bacteria 2960584000 2960588175 226
193 iso_pu_bacteria 2960591022 2960597389 226
194 iso_pu_bacteria 2960597568 2960599028 226
195 iso_pu_bacteria 2960603979 2960606127 226
196 iso_pu_bacteria 2960610863 2960611459 226
197 iso_pu_bacteria 2960617483 2960620613 226
198 iso_pu_bacteria 2960624210 2960630242 226
199 iso_pu_bacteria 2960631154 2960636582 226
200 iso_pu_bacteria 2960637947 2960642993 226
201 iso_pu_bacteria 2960645483 2960651754 226
202 iso_pu_bacteria 2960652885 2960653261 226
203 iso_pu_bacteria 2960660292 2960665923 226
204 iso_pu_bacteria 2960667422 2960673678 226
205 iso_pu_bacteria 2960674078 2960680031 226
206 iso_pu_bacteria 2960680706 2960686092 226
207 iso_pu_bacteria 2960687367 2960691207 226
208 iso_pu_bacteria 2960693952 2960695800 226
209 iso_pu_bacteria 2964607997 2964609254 226
210 iso_pu_bacteria 2964615318 2964621010 226
211 iso_pu_bacteria 2964621998 2964625772 226
212 iso_pu_bacteria 2964628898 2964629333 226
213 iso_pu_bacteria 2964636051 2964640034 226
214 iso_pu_bacteria 2964643177 2964647430 226
215 iso_pu_bacteria 2964649959 2964654714 226
216 iso_pu_bacteria 2964656573 2964658870 226
217 iso_pu_bacteria 2964663802 2964664611 226
218 iso_pu_bacteria 2964670856 2964676390 226
219 iso_pu_bacteria 2964678106 2964680471 226
220 iso_pu_bacteria 2964685014 2964688636 226
221 iso_pu_bacteria 2964691889 2964694517 226
222 iso_pu_bacteria 2964698721 2964701035 226
223 iso_pu_bacteria 2964705432 2964705483 226
224 iso_pu_bacteria 2964712639 2964718317 226
225 iso_pu_bacteria 2964719344 2964726401 226
226 iso_pu_bacteria 2967664464 2967667901 226
227 iso_pu_bacteria 2967671571 2967676645 226
228 iso_pu_bacteria 2967678726 2967684053 226
229 iso_pu_bacteria 2967686174 2967690968 226
230 iso_pu_bacteria 2967693043 2967693934 226
231 iso_pu_bacteria 2967699805 2967701500 226
232 iso_pu_bacteria 2967706974 2967712105 226
233 iso_pu_bacteria 2967714385 2967719749 226
234 iso_pu_bacteria 2967721400 2967727130 226
235 iso_pu_bacteria 2967728569 2967733712 226
236 iso_pu_bacteria 2967735183 2967738005 226
237 iso_pu_bacteria 2967742019 2967748652 226
238 iso_pu_bacteria 2967748971 2967751271 226
239 iso_pu_bacteria 2967755722 2967762325 226
240 iso_pu_bacteria 2967762386 2967768945 226
241 iso_pu_bacteria 2967769361 2967773697 226
242 iso_pu_bacteria 2967775926 2967776519 226
243 iso_pu_bacteria 2970019648 2970021833 226
244 iso_pu_bacteria 2970026789 2970029053 226
245 iso_pu_bacteria 2970033650 2970036550 226
246 iso_pu_bacteria 2970040964 2970041699 226
247 iso_pu_bacteria 2970047711 2970049042 226
248 iso_pu_bacteria 2970054988 2970056306 226
249 iso_pu_bacteria 2970061556 2970061564 226
250 iso_pu_bacteria 2970068827 2970072174 226
251 iso_pu_bacteria 2970076120 2970079971 226
252 iso_pu_bacteria 2970082768 2970085566 226
253 iso_pu_bacteria 2970088815 2970088823 226
254 iso_pu_bacteria 2970095765 2970098145 226
255 iso_pu_bacteria 2970102677 2970107627 226
256 iso_pu_bacteria 2970109326 2970113218 226
257 iso_pu_bacteria 2970116247 2970117251 226
258 iso_pu_bacteria 2970122695 2970125147 226
259 iso_pu_bacteria 2970129317 2970130709 226
260 iso_pu_bacteria 2970136068 2970139137 226
261 iso_pu_bacteria 2970143518 2970148058 226
262 iso_pu_bacteria 2970149975 2970156502 226
263 iso_pu_bacteria 2970156795 2970157445 226
264 iso_pu_bacteria 2970164137 2970164203 226
265 iso_pu_bacteria 2970170962 2970172606 226
266 iso_pu_bacteria 2970177841 2970180786 226
267 iso_pu_bacteria 2970184632 2970185149 226
268 iso_pu_bacteria 2970191845 2970193158 226
269 iso_pu_bacteria 2977516862 2977518909 226
270 iso_pu_bacteria 2977523885 2977529665 226
271 iso_pu_bacteria 2977530762 2977533395 226
272 iso_pu_bacteria 2977537788 2977541932 226
273 iso_pu_bacteria 2977544691 2977548849 226
274 iso_pu_bacteria 2977551784 2977555194 226
275 iso_pu_bacteria 2977558990 2977562465 226
276 iso_pu_bacteria 2977565890 2977571139 226
277 iso_pu_bacteria 2977572785 2977578624 226
278 iso_pu_bacteria 2977579622 2977581312 226
279 iso_pu_bacteria 648276728 648736332 226
280 iso_pu_bacteria 8003992118 8003997416 226
281 iso_pu_bacteria 8003999396 8004005276 226
282 iso_pu_bacteria 8005658619 8005661405 226
283 iso_pu_bacteria 8055431914 8055434502 226
284 3300005327 Ga0070658_10010502 Ga0070658_100105026 227
285 3300005339 Ga0070660_100097785 Ga0070660_1000977851 227
286 3300005344 Ga0070661_100032962 Ga0070661_1000329624 227
287 3300005366 Ga0070659_100429619 Ga0070659_1004296192 227
288 3300005578 Ga0068854_100382950 Ga0068854_1003829501 227
289 3300005614 Ga0068856_100009291 Ga0068856_10000929112 227
290 3300005616 Ga0068852_100787472 Ga0068852_1007874722 227
291 3300006048 Ga0075363_100228353 Ga0075363_1002283532 227
292 3300006178 Ga0075367_10035039 Ga0075367_100350392 227
293 3300006195 Ga0075366_10061184 Ga0075366_100611842 227
294 3300013104 Ga0157370_10054570 Ga0157370_100545704 227
295 3300013105 Ga0157369_10010942 Ga0157369_100109427 227
296 3300013307 Ga0157372_10498002 Ga0157372_104980022 227
297 3300025909 Ga0207705_10045926 Ga0207705_100459262 227
298 3300025913 Ga0207695_10170124 Ga0207695_101701241 227
299 3300025919 Ga0207657_10196438 Ga0207657_101964382 227
300 3300025920 Ga0207649_10048697 Ga0207649_100486972 227
301 3300025924 Ga0207694_10117381 Ga0207694_101173812 227
302 3300026078 Ga0207702_10107264 Ga0207702_101072642 227
303 3300041512 Ga0451853_4045482 Ga0451853_4045482_108_791 227
304 3300044684 Ga0466966_0068031 Ga0466966_0068031_1025_1708 227
305 3300044706 Ga0466964_0100451 Ga0466964_0100451_568_1251 227
306 3300045049 Ga0466959_0069010 Ga0466959_0069010_545_1228 227
307 3300045836 Ga0466958_0062340 Ga0466958_0062340_400_1083 227
308 3300046660 Ga0495625_0161255 Ga0495625_0161255_404_1087 227
309 3300048926 Ga0496123_0115321 Ga0496123_0115321_787_1470 227
310 3300049571 Ga0501034_0012829 Ga0501034_0012829_7280_7963 227
311 3300061719 Ga0466962_0019268 Ga0466962_0019268_1048_1731 227
312 3300005334 Ga0068869_100057998 Ga0068869_1000579982 228
313 3300013105 Ga0157369_10024722 Ga0157369_100247222 228
314 3300021388 Ga0213875_10003950 Ga0213875_100039505 228
315 3300025294 Ga0209025_1041616 Ga0209025_10416162 228
316 3300025294 Ga0209025_1064232 Ga0209025_10642322 228
317 3300028794 Ga0307515_10272434 Ga0307515_102724342 228
318 3300031239 Ga0265328_10000455 Ga0265328_1000045517 228
319 3300031239 Ga0265328_10009195 Ga0265328_100091952 228
320 3300031995 Ga0307409_100852598 Ga0307409_1008525981 228
321 3300032002 Ga0307416_100576531 Ga0307416_1005765312 228
322 3300033180 Ga0307510_10408994 Ga0307510_104089941 228
323 3300037418 Ga0395900_0084776 Ga0395900_0084776_1763_2449 228
324 3300037466 Ga0395898_0013929 Ga0395898_0013929_5897_6583 228
325 3300037471 Ga0395905_0000510 Ga0395905_0000510_24715_25404 228
326 3300037471 Ga0395905_0004003 Ga0395905_0004003_715_1404 228
327 3300037853 Ga0436364_1158546 Ga0436364_1158546_6812_7510 228
328 3300048919 Ga0496116_0000100 Ga0496116_0000100_80640_81326 228
329 3300048921 Ga0496118_0018814 Ga0496118_0018814_751_1437 228
330 3300048924 Ga0496121_0354064 Ga0496121_0354064_241_930 228
331 3300048925 Ga0496122_0004142 Ga0496122_0004142_4300_4986 228
332 3300048929 Ga0496126_0000311 Ga0496126_0000311_6486_7172 228
333 3300049572 Ga0501036_0705757 Ga0501036_0705757_134_820 228
334 3300049822 Ga0501035_0240918 Ga0501035_0240918_535_1221 228
335 3300049823 Ga0501044_0383205 Ga0501044_0383205_582_1271 228
336 3300003187 JGI25151J46595_10032489 JGI25151J46595_100324892 229
337 3300005327 Ga0070658_10068152 Ga0070658_100681522 229
338 3300013100 Ga0157373_10385307 Ga0157373_103853072 229
339 3300025294 Ga0209025_1000148 Ga0209025_100014819 229
340 3300031239 Ga0265328_10022820 Ga0265328_100228202 229
341 3300046460 Ga0495638_0102076 Ga0495638_0102076_141_833 229
342 3300048920 Ga0496117_0124831 Ga0496117_0124831_706_1395 229
343 3300048923 Ga0496120_0165228 Ga0496120_0165228_138_827 229
344 3300048925 Ga0496122_0000032 Ga0496122_0000032_233903_234592 229
345 3300048926 Ga0496123_0000093 Ga0496123_0000093_11089_11778 229
346 3300048927 Ga0496124_0001614 Ga0496124_0001614_16058_16747 229
347 3300048928 Ga0496125_0000041 Ga0496125_0000041_281157_281846 229
348 3300048929 Ga0496126_0000299 Ga0496126_0000299_33278_33967 229
349 3300049776 Ga0501280_000902 Ga0501280_000902_694_1383 229
350 3300053085 Ga0495619_0278030 Ga0495619_0278030_256_951 229
351 3300053151 Ga0500604_0001945 Ga0500604_0001945_1015_1707 229
352 3300053156 Ga0500622_0004040 Ga0500622_0004040_2536_3228 229
353 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003143 230
354 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003324 230
355 3300003374 JGI25161J50226_1000373 JGI25161J50226_100037318 230
356 3300003771 Ga0055526_1002068 Ga0055526_100206815 230
357 3300003775 Ga0055524_1000660 Ga0055524_10006608 230
358 3300003775 Ga0055524_1020631 Ga0055524_10206312 230
359 3300003781 Ga0055536_1004825 Ga0055536_10048252 230
360 3300003792 Ga0055540_1015025 Ga0055540_10150252 230
361 3300003794 Ga0055531_10010822 Ga0055531_100108223 230
362 3300004625 Ga0055543_1000203 Ga0055543_10002035 230
363 3300005262 Ga0065165_1000025 Ga0065165_10000252 230
364 3300005328 Ga0070676_10302402 Ga0070676_103024021 230
365 3300005334 Ga0068869_100109664 Ga0068869_1001096642 230
366 3300005347 Ga0070668_100097346 Ga0070668_1000973462 230
367 3300005353 Ga0070669_100030318 Ga0070669_1000303182 230
368 3300005356 Ga0070674_100039797 Ga0070674_1000397972 230
369 3300005518 Ga0070699_100198170 Ga0070699_1001981701 230
370 3300005549 Ga0070704_100802110 Ga0070704_1008021102 230
371 3300005617 Ga0068859_100269164 Ga0068859_1002691642 230
372 3300005719 Ga0068861_100047935 Ga0068861_1000479352 230
373 3300005842 Ga0068858_100547033 Ga0068858_1005470331 230
374 3300006931 Ga0097620_100269179 Ga0097620_1002691792 230
375 3300006946 Ga0079104_1003013 Ga0079104_10030135 230
376 3300006946 Ga0079104_1026317 Ga0079104_10263172 230
377 3300009147 Ga0114129_10010465 Ga0114129_100104656 230
378 3300009148 Ga0105243_10096082 Ga0105243_100960822 230
379 3300009174 Ga0105241_10162626 Ga0105241_101626262 230
380 3300009553 Ga0105249_10156496 Ga0105249_101564962 230
381 3300009553 Ga0105249_10182198 Ga0105249_101821982 230
382 3300009553 Ga0105249_10278739 Ga0105249_102787392 230
383 3300009986 Ga0105033_106138 Ga0105033_1061382 230
384 3300013249 Ga0171463_1001 Ga0171463_1001961 230
385 3300014968 Ga0157379_10623709 Ga0157379_106237091 230
386 3300015690 Ga0183363_1157 Ga0183363_115715 230
387 3300017792 Ga0163161_10353252 Ga0163161_103532521 230
388 3300021321 Ga0214542_1004397 Ga0214542_10043974 230
389 3300021327 Ga0214543_1000027 Ga0214543_1000027118 230
390 3300021388 Ga0213875_10155004 Ga0213875_101550041 230
391 3300022739 Ga0228711_1009677 Ga0228711_10096772 230
392 3300022740 Ga0228710_1000227 Ga0228710_10002274 230
393 3300025208 Ga0209436_100487 Ga0209436_1004875 230
394 3300025284 Ga0209130_1000005 Ga0209130_1000005154 230
395 3300025292 Ga0209676_1004301 Ga0209676_10043012 230
396 3300025294 Ga0209025_1000479 Ga0209025_100047985 230
397 3300025295 Ga0209564_1000093 Ga0209564_1000093157 230
398 3300025297 Ga0209758_1087201 Ga0209758_10872011 230
399 3300025298 Ga0209050_1005400 Ga0209050_10054003 230
400 3300025299 Ga0209256_1000027 Ga0209256_1000027258 230
401 3300025299 Ga0209256_1001179 Ga0209256_100117918 230
402 3300025302 Ga0207426_1000015 Ga0207426_1000015445 230
403 3300025304 Ga0209257_1002436 Ga0209257_10024362 230
404 3300025935 Ga0207709_10091309 Ga0207709_100913092 230
405 3300025937 Ga0207669_10025819 Ga0207669_100258191 230
406 3300025942 Ga0207689_10204776 Ga0207689_102047762 230
407 3300025972 Ga0207668_10054676 Ga0207668_100546762 230
408 3300026075 Ga0207708_10563949 Ga0207708_105639491 230
409 3300026118 Ga0207675_100014862 Ga0207675_1000148622 230
410 3300027111 Ga0209281_1000348 Ga0209281_100034852 230
411 3300027111 Ga0209281_1001850 Ga0209281_10018502 230
412 3300027666 Ga0209282_1000070 Ga0209282_100007023 230
413 3300031250 Ga0265331_10006187 Ga0265331_100061872 230
414 3300031251 Ga0265327_10024451 Ga0265327_100244512 230
415 3300031730 Ga0307516_10000115 Ga0307516_1000011569 230
416 3300031967 Ga0315914_1000082 Ga0315914_100008225 230
417 3300033430 Ga0315913_1000028 Ga0315913_100002824 230
418 3300033464 Ga0315915_1000004 Ga0315915_100000425 230
419 3300035695 Ga0373927_0000127 Ga0373927_0000127_6735_7442 230
420 3300035725 Ga0373947_0371872 Ga0373947_0371872_111_818 230
421 3300037068 Ga0373925_0001717 Ga0373925_0001717_4990_5697 230
422 3300037418 Ga0395900_0779929 Ga0395900_0779929_167_859 230
423 3300037853 Ga0436364_0810010 Ga0436364_0810010_149_850 230
424 3300038443 Ga0395901_0215402 Ga0395901_0215402_523_1215 230
425 3300039437 Ga0436365_1432485 Ga0436365_1432485_348_1049 230
426 3300041413 Ga0439465_0127655 Ga0439465_0127655_181_873 230
427 3300042007 Ga0439449_0069981 Ga0439449_0069981_462_1154 230
428 3300049569 Ga0501032_0142344 Ga0501032_0142344_120_812 230
429 3300049571 Ga0501034_0047860 Ga0501034_0047860_2608_3300 230
430 3300049580 Ga0501046_0029718 Ga0501046_0029718_2194_2886 230
431 3300049581 Ga0501047_0645227 Ga0501047_0645227_69_764 230
432 3300049583 Ga0501067_0067384 Ga0501067_0067384_1083_1775 230
433 3300049589 Ga0501073_0314844 Ga0501073_0314844_20_712 230
434 3300049822 Ga0501035_0000181 Ga0501035_0000181_40231_40923 230
435 3300050507 nmdc:mga05p37_197886_c1 nmdc:mga05p37_197886_c1_1093_1797 230
436 3300053161 Ga0500634_0075209 Ga0500634_0075209_918_1613 230
437 3300053177 Ga0500636_0003767 Ga0500636_0003767_4653_5354 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

2

111

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

145

221

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.978 4 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9746 4 119
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9743 4 119
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9737 3 119
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9728 4 119
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9969 3 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9923 5 81 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.99 4 86 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9881 4 86 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9822 2 79 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A177QVT5-F1-model_v4 Two-component system response regulator 0.9743 3 230 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A535DU01-F1-model_v4 Response regulator transcription factor 0.9738 3 205 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0P9H1K6-F1-model_v4 Fis family transcriptional regulator 0.973 27 229 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A177QVT5-F1-model_v4 Two-component system response regulator 0.9701 3 230 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2M7T0Y4-F1-model_v4 DNA-binding response regulator 0.9682 2 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
92.19 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map