F443895

General Info

Members Datasets Scaffolds Average Seq Length
437 337 229 428

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510917028|2511185324
Length 456
Sequence PFSAARSLLPLPHRAIEMIPQEIIRQKRNGGTLSEEDIQSFIAALASGQLSEGQIGAFAMAVWFKGMSRDEVVALTRAMARSGDTLSWADIDRPIADKHSTGGVGDNVSLMLAPIAAACGLAVPMISGRGLGHTGGTLDKLEAIPGYTITPDAALFRRVVKDVGCAIIGQTGALAPADGKLYAVRDVTATVDSIPLITASILSKKLAAGLQTLVLDVKVGSGAFMAEPKDAETLARALVDVANSAGVRTSALITDMNQPLADAAGNAVEIRNCLEFLAGRKKNTRLEAAVLAFAAEMLMKSGMASSLQDGETKAADALSAGKAAENFGRMVHLLGGPSDLLEKPDKYLVKAPVTKAVPAPQSGWLSGCDVREIGMTVVDLGGGRRHPDDRIDHRVGISDILPVGTRVERGDPIALVHAASEVSADAAIAALAANYRIGERQPAIPDVVCERIVAIA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
13 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2519899620 Rhizobium sp. Pop5 Isolate Nodule
22 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
25 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
26 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
27 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
28 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
29 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
30 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
31 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
32 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
33 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
34 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
35 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
36 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
37 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
38 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
39 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
40 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
41 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
42 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
43 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
44 2619618881 Frankia sp. ACN1ag Isolate Unclassified
45 2619619003 Frankia sp. CpI1-P Isolate Nodule
46 2626541554 Frankia sp. AvcI.1 Isolate Nodule
47 2643221599 Rhizobium sp. Root708 Isolate Unclassified
48 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
49 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
50 2643221688 Rhizobium sp. Root482 Isolate Unclassified
51 2718217927 Rhizobium sp. N324 Isolate Nodule
52 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
53 2718218009 Rhizobium sp. N561 Isolate Nodule
54 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
55 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
56 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
57 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
58 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
59 2718218363 Rhizobium sp. N113 Isolate Nodule
60 2718218365 Rhizobium sp. N731 Isolate Nodule
61 2718218366 Rhizobium sp. N621 Isolate Nodule
62 2718218423 Rhizobium sp. N941 Isolate Nodule
63 2721755514 Rhizobium sp. N6212 Isolate Nodule
64 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
65 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
66 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
67 2721755809 Rhizobium sp. N541 Isolate Nodule
68 2721755810 Rhizobium sp. N871 Isolate Nodule
69 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
70 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
71 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
72 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
73 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
74 2728369365 Rhizobium sp. N1341 Isolate Nodule
75 2728369397 Rhizobium sp. N1314 Isolate Nodule
76 2738541293 Rhizobium sp. GV031 Isolate Unclassified
77 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
78 2791355256 Rhizobium sp. M10 Isolate Nodule
79 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
80 2791355261 Rhizobium sp. J15 Isolate Nodule
81 2791355262 Rhizobium sp. M1 Isolate Nodule
82 2791355263 Rhizobium chutanense C5 Isolate Nodule
83 2791355264 Rhizobium sp. S9 Isolate Nodule
84 2791355265 Rhizobium sp. H4 Isolate Nodule
85 2791355266 Rhizobium sp. L43 Isolate Nodule
86 2791355267 Rhizobium sp. L18 Isolate Nodule
87 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
88 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
89 2802429633 Rhizobium anhuiense J3 Isolate Nodule
90 2802429634 Rhizobium anhuiense S10 Isolate Nodule
91 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
92 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
93 2802429637 Rhizobium anhuiense C15 Isolate Nodule
94 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
95 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
96 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
97 2838048938 Rhizobium pisi 27/80 Isolate Nodule
98 2838061910 Rhizobium phaseoli L15 Isolate Nodule
99 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
100 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
101 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
102 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
103 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
104 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
105 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
106 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
107 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
108 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
109 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
110 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
111 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
112 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
113 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
114 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
115 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
116 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
117 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
118 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
119 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
120 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
121 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
122 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
123 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
124 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
125 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
126 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
127 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
128 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
129 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
130 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
131 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
132 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
133 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
134 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
135 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
136 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
137 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
138 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
139 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
140 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
141 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
142 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
143 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
144 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
145 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
146 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
147 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
148 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
149 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
150 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
151 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
152 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
153 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
154 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
155 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
156 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
157 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
158 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
159 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
160 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
161 2933599457 Rhizobium phaseoli M3 Isolate Nodule
162 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
163 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
164 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
165 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
166 2936381700 Rhizobium chutanense C16 Isolate Unclassified
167 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
168 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
169 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
170 2996887358 Rhizobium sp. R711 Isolate Nodule
171 2996893221 Rhizobium sp. R635 Isolate Nodule
172 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
173 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
174 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
175 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
176 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
177 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
178 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
179 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
180 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
181 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
182 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
183 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
184 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
185 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
186 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
187 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
188 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
189 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
190 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
191 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
192 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
193 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
194 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
195 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
196 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
197 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
198 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
199 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
200 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
201 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
202 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
203 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
204 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
205 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
206 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
207 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
208 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
209 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
210 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
211 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
212 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
213 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
214 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
215 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
216 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
218 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
222 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
242 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
243 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
244 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
296 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
299 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
306 8005258706 Rhizobium sp. R693 Isolate Nodule
307 8005275841 Rhizobium sp. N4311 Isolate Nodule
308 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
309 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
310 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
311 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
312 8005321885 Rhizobium sp. R72 Isolate Nodule
313 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
314 8005382845 Rhizobium sp. R634 Isolate Nodule
315 8005395548 Rhizobium sp. R339 Isolate Nodule
316 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
317 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
318 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
319 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
320 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
321 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
322 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
323 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
324 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
325 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
326 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
327 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
328 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
329 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
330 8018176218 Rhizobium sp. N122 Isolate Nodule
331 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
332 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
333 8024501048 Rhizobium sp. H4 Isolate Nodule
334 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
335 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
336 8056382006 Rhizobium croatiense 13T Isolate Nodule
337 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.4
Metatranscriptomes 0
Isolates 47.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.11
Nodule 38.22
Rhizoplane 1.6
Rhizosphere 15.79
Stem 0
Stem Tuber 0
Unclassified 21.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000110 3300002704 Bacteria 43893
2 JGI25156J39149_1000192 3300002705 Bacteria 44040
3 JGI25154J39366_1000196 3300002738 Bacteria 44040
4 JGI25157J39369_1000228 3300002741 Bacteria 44040
5 JGI25152J39213_1000869 3300002773 Bacteria 14910
6 JGI25152J39213_1009804 3300002773 Bacteria 2242
7 JGI25150J39212_1000266 3300002774 Bacteria 27840
8 JGI25151J46595_10000355 3300003187 Bacteria 48795
9 JGI25151J46595_10000660 3300003187 Bacteria 29371
10 JGI25151J46595_10007774 3300003187 Bacteria 5217
11 JGI25151J46595_10010521 3300003187 Bacteria 4293
12 JGI25165J46597_1001741 3300003214 Bacteria 9593
13 JGI25153J46596_10003933 3300003215 Bacteria 8143
14 JGI25153J46596_10007015 3300003215 Bacteria 5611
15 JGI25153J46596_10007137 3300003215 Bacteria 5543
16 JGI25153J46596_10007533 3300003215 Bacteria 5333
17 JGI25153J46596_10023535 3300003215 Bacteria 2242
18 JGI25153J46596_10023537 3300003215 Bacteria 2242
19 rootH2_10079948 3300003320 Bacteria 2232
20 JGI25160J50197_1003769 3300003354 Bacteria 6672
21 JGI25160J50197_1017276 3300003354 Bacteria 2292
22 JGI25161J50226_1000078 3300003374 Bacteria 83416
23 JGI25161J50226_1006787 3300003374 Bacteria 2013
24 Ga0055526_1012978 3300003771 Bacteria 3572
25 Ga0055526_1013813 3300003771 Bacteria 3380
26 Ga0055524_1004262 3300003775 Bacteria 6648
27 Ga0055524_1013670 3300003775 Bacteria 3052
28 Ga0055528_1000113 3300003790 Bacteria 65323
29 Ga0055528_1001190 3300003790 Bacteria 16795
30 Ga0055528_1005448 3300003790 Bacteria 5930
31 Ga0055528_1015743 3300003790 Bacteria 2714
32 Ga0055540_1001653 3300003792 Bacteria 12938
33 Ga0055540_1007715 3300003792 Bacteria 4006
34 Ga0055543_1000069 3300004625 Bacteria 94040
35 Ga0055543_1002126 3300004625 Bacteria 6861
36 Ga0070668_100026912 3300005347 Bacteria 4366
37 Ga0070663_100114893 3300005455 Bacteria 2027
38 Ga0070681_10001193 3300005458 Bacteria 22526
39 Ga0075365_10004347 3300006038 Bacteria 7489
40 Ga0075365_10017265 3300006038 Bacteria 4411
41 Ga0075363_100074448 3300006048 Bacteria 1849
42 Ga0075362_10001958 3300006177 Bacteria 6764
43 Ga0075367_10004267 3300006178 Bacteria 6952
44 Ga0075366_10005204 3300006195 Bacteria 7040
45 Ga0075370_10000842 3300006353 Bacteria 12429
46 Ga0105251_10009825 3300009011 Bacteria 5608
47 Ga0123341_1000642 3300009765 Bacteria 22722
48 Ga0123342_1010090 3300009766 Bacteria 10966
49 Ga0123342_1021055 3300009766 Bacteria 4648
50 Ga0213876_10030813 3300021384 Bacteria 2830
51 Ga0213875_10000343 3300021388 Bacteria 43778
52 Ga0209435_100087 3300025206 Bacteria 44093
53 Ga0209436_100022 3300025208 Bacteria 96695
54 Ga0209437_100205 3300025233 Bacteria 115669
55 Ga0207425_1000052 3300025245 Bacteria 162123
56 Ga0207425_1001736 3300025245 Bacteria 8600
57 Ga0207425_1010493 3300025245 Bacteria 2252
58 Ga0209646_1000285 3300025246 Bacteria 44093
59 Ga0209026_1000347 3300025250 Bacteria 44093
60 Ga0209759_1000482 3300025256 Bacteria 44093
61 Ga0209129_1000066 3300025258 Bacteria 226820
62 Ga0209129_1000141 3300025258 Bacteria 119150
63 Ga0209129_1001039 3300025258 Bacteria 16421
64 Ga0209129_1001099 3300025258 Bacteria 15766
65 Ga0209129_1001848 3300025258 Bacteria 11206
66 Ga0209129_1002246 3300025258 Bacteria 9651
67 Ga0209129_1004783 3300025258 Bacteria 5115
68 Ga0209233_1000187 3300025261 Bacteria 133091
69 Ga0209673_1000024 3300025273 Bacteria 409632
70 Ga0209673_1000911 3300025273 Bacteria 37766
71 Ga0209673_1002137 3300025273 Bacteria 14721
72 Ga0209673_1002283 3300025273 Bacteria 13700
73 Ga0209130_1000002 3300025284 Bacteria 722648
74 Ga0209675_1012333 3300025291 Bacteria 2764
75 Ga0209025_1000144 3300025294 Bacteria 181446
76 Ga0209025_1000274 3300025294 Bacteria 119322
77 Ga0209025_1000275 3300025294 Bacteria 119220
78 Ga0209025_1008610 3300025294 Bacteria 7302
79 Ga0209025_1013390 3300025294 Bacteria 5160
80 Ga0209025_1015100 3300025294 Bacteria 4686
81 Ga0209025_1021176 3300025294 Bacteria 3515
82 Ga0209564_1000474 3300025295 Bacteria 67143
83 Ga0209564_1000486 3300025295 Bacteria 66011
84 Ga0209564_1006365 3300025295 Bacteria 6399
85 Ga0209564_1010276 3300025295 Bacteria 4333
86 Ga0209564_1010422 3300025295 Bacteria 4286
87 Ga0209758_1000229 3300025297 Bacteria 119657
88 Ga0209758_1000466 3300025297 Bacteria 66920
89 Ga0209758_1000971 3300025297 Bacteria 38600
90 Ga0209758_1001494 3300025297 Bacteria 27240
91 Ga0209758_1003684 3300025297 Bacteria 13618
92 Ga0209758_1009079 3300025297 Bacteria 6272
93 Ga0209050_1006063 3300025298 Bacteria 7313
94 Ga0209256_1000715 3300025299 Bacteria 44055
95 Ga0209256_1000868 3300025299 Bacteria 37527
96 Ga0209256_1003327 3300025299 Bacteria 11402
97 Ga0209256_1006448 3300025299 Bacteria 6200
98 Ga0207426_1000013 3300025302 Bacteria 721897
99 Ga0207426_1000142 3300025302 Bacteria 194023
100 Ga0207426_1002097 3300025302 Bacteria 13739
101 Ga0209051_1000170 3300025303 Bacteria 119026
102 Ga0209051_1002082 3300025303 Bacteria 15092
103 Ga0209051_1006497 3300025303 Bacteria 6575
104 Ga0209051_1007516 3300025303 Bacteria 5940
105 Ga0209257_1007148 3300025304 Bacteria 6862
106 Ga0207707_10007003 3300025912 Bacteria 9837
107 Ga0207681_10071983 3300025923 Bacteria 2413
108 Ga0207678_10121399 3300026067 Bacteria 2230
109 Ga0209281_1000043 3300027111 Bacteria 341543
110 Ga0209371_1002100 3300027312 Bacteria 11818
111 Ga0265318_10033630 3300028577 Bacteria 1978
112 Ga0307515_10000283 3300028794 Bacteria 124822
113 Ga0307515_10000448 3300028794 Bacteria 98768
114 Ga0307515_10070922 3300028794 Bacteria 4732
115 Ga0268256_1003765 3300030500 Bacteria 6646
116 Ga0307513_10028778 3300031456 Bacteria 6346
117 Ga0307405_10001661 3300031731 Bacteria 9477
118 Ga0307406_10008771 3300031901 Bacteria 5652
119 Ga0307412_10053361 3300031911 Bacteria 2679
120 Ga0436364_0699238 3300037853 Bacteria 158550
121 Ga0451833_0024651 3300041491 Bacteria 3034
122 Ga0451837_0590853 3300041494 Bacteria 2084
123 Ga0451841_0110248 3300041498 Bacteria 2715
124 Ga0451845_0170958 3300041501 Bacteria 2724
125 Ga0451847_0340308 3300041503 Bacteria 3203
126 Ga0451847_0567321 3300041503 Bacteria 2569
127 Ga0451851_0121898 3300041507 Bacteria 2083
128 Ga0451851_0315093 3300041507 Bacteria 2222
129 Ga0495638_0016085 3300046460 Bacteria 5013
130 Ga0495638_0072799 3300046460 Bacteria 2099
131 Ga0495650_0036928 3300046471 Bacteria 2132
132 Ga0495605_0009235 3300046474 Bacteria 5540
133 Ga0495607_0113634 3300046501 Bacteria 1432
134 Ga0495583_0003929 3300046506 Bacteria 10998
135 Ga0495606_0005067 3300046507 Bacteria 12819
136 Ga0495632_0003799 3300046519 Bacteria 10538
137 Ga0495632_0012650 3300046519 Bacteria 4856
138 Ga0495648_0037906 3300046524 Bacteria 3092
139 Ga0495656_0007518 3300046615 Bacteria 3853
140 Ga0495668_0032955 3300046616 Bacteria 2912
141 Ga0495625_0070882 3300046660 Bacteria 2447
142 Ga0495625_0074394 3300046660 Bacteria 2379
143 Ga0495625_0133306 3300046660 Bacteria 1681
144 Ga0495661_0014352 3300046665 Bacteria 5309
145 Ga0495660_0040102 3300046810 Bacteria 2597
146 Ga0495660_0110720 3300046810 Bacteria 1401
147 Ga0495687_031472 3300047443 Bacteria 2434
148 Ga0495686_0002334 3300047472 Bacteria 18121
149 Ga0496101_0054938 3300048904 Bacteria 2875
150 Ga0496102_0147046 3300048905 Bacteria 2212
151 Ga0496104_0117240 3300048907 Bacteria 2555
152 Ga0496106_0006761 3300048909 Bacteria 8490
153 Ga0496106_0229412 3300048909 Bacteria 1482
154 Ga0496111_0017994 3300048914 Bacteria 4888
155 Ga0496116_0029105 3300048919 Bacteria 3987
156 Ga0496116_0035568 3300048919 Bacteria 3496
157 Ga0496116_0047629 3300048919 Bacteria 2884
158 Ga0496116_0052521 3300048919 Bacteria 2699
159 Ga0496116_0057026 3300048919 Bacteria 2556
160 Ga0496116_0140040 3300048919 Bacteria 1363
161 Ga0496117_0007245 3300048920 Bacteria 10910
162 Ga0496117_0021071 3300048920 Bacteria 5292
163 Ga0496117_0065313 3300048920 Bacteria 2475
164 Ga0496118_0015080 3300048921 Bacteria 7181
165 Ga0496118_0017956 3300048921 Bacteria 6412
166 Ga0496118_0020837 3300048921 Bacteria 5800
167 Ga0496119_0076515 3300048922 Bacteria 1941
168 Ga0496121_0009474 3300048924 Bacteria 11185
169 Ga0496121_0009970 3300048924 Bacteria 10805
170 Ga0496121_0023381 3300048924 Bacteria 5954
171 Ga0496121_0044238 3300048924 Bacteria 3845
172 Ga0496121_0056726 3300048924 Bacteria 3251
173 Ga0496121_0056828 3300048924 Bacteria 3247
174 Ga0496121_0075196 3300048924 Bacteria 2699
175 Ga0496121_0091778 3300048924 Bacteria 2370
176 Ga0496121_0105532 3300048924 Bacteria 2162
177 Ga0496121_0141492 3300048924 Bacteria 1784
178 Ga0496122_0020668 3300048925 Bacteria 5932
179 Ga0496122_0040014 3300048925 Bacteria 3732
180 Ga0496122_0056292 3300048925 Bacteria 2932
181 Ga0496122_0064090 3300048925 Bacteria 2676
182 Ga0496123_0004823 3300048926 Bacteria 13917
183 Ga0496123_0035722 3300048926 Bacteria 3536
184 Ga0496123_0042189 3300048926 Bacteria 3153
185 Ga0496123_0044627 3300048926 Bacteria 3029
186 Ga0496123_0070544 3300048926 Bacteria 2186
187 Ga0496124_0013026 3300048927 Bacteria 8149
188 Ga0496124_0014897 3300048927 Bacteria 7491
189 Ga0496124_0043463 3300048927 Bacteria 3863
190 Ga0496124_0059776 3300048927 Bacteria 3200
191 Ga0496124_0066405 3300048927 Bacteria 3004
192 Ga0496124_0072470 3300048927 Bacteria 2852
193 Ga0496125_0002093 3300048928 Bacteria 26849
194 Ga0496125_0037411 3300048928 Bacteria 4220
195 Ga0496126_0050368 3300048929 Bacteria 3796
196 Ga0496126_0065112 3300048929 Bacteria 3262
197 Ga0496126_0225310 3300048929 Bacteria 1573
198 Ga0495682_0049127 3300049460 Bacteria 1537
199 Ga0501031_0133276 3300049568 Bacteria 1623
200 Ga0501033_0007454 3300049570 Bacteria 8522
201 Ga0501033_0127004 3300049570 Bacteria 1849
202 Ga0501038_0173778 3300049574 Bacteria 1742
203 Ga0501040_0056767 3300049576 Bacteria 2687
204 Ga0501042_0074776 3300049578 Bacteria 2424
205 Ga0501046_0063077 3300049580 Bacteria 2894
206 Ga0501046_0098355 3300049580 Bacteria 2247
207 Ga0501047_0115034 3300049581 Bacteria 2572
208 Ga0501048_0119476 3300049582 Bacteria 1862
209 Ga0501073_0178879 3300049589 Bacteria 1468
210 Ga0501075_0050317 3300049591 Bacteria 3132
211 Ga0501076_0207007 3300049592 Bacteria 1602
212 Ga0501079_0038193 3300049741 Bacteria 3703
213 Ga0501044_0027039 3300049823 Bacteria 6069
214 nmdc:mga03n38_32690_c1 3300050490 Bacteria 2206
215 nmdc:mga0yw44_35339_c1 3300050492 Bacteria 2936
216 nmdc:mga0k408_10280_c1 3300050493 Bacteria 5058
217 nmdc:mga06z11_16604_c1 3300050494 Bacteria 3320
218 nmdc:mga07m45_21583_c1 3300050496 Bacteria 3508
219 Ga0500566_0000409 3300053094 Bacteria 23847
220 Ga0500569_007414 3300053109 Bacteria 2459
221 Ga0500658_0009920 3300053134 Bacteria 3511
222 Ga0500568_0001169 3300053139 Bacteria 17543
223 Ga0500568_0006185 3300053139 Bacteria 6052
224 Ga0500606_038505 3300053152 Bacteria 1569
225 Ga0500616_0009183 3300053153 Bacteria 6035
226 Ga0500622_0009636 3300053156 Bacteria 5337
227 Ga0500633_0008137 3300053160 Bacteria 2686
228 Ga0501084_0057603 3300054114 Bacteria 3251
229 Ga0501082_0051375 3300060353 Bacteria 3553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0057603 Ga0501084_0057603_2071_3231 340
2 3300048919 Ga0496116_0140040 Ga0496116_0140040_11_1135 374
3 3300046519 Ga0495632_0012650 Ga0495632_0012650_267_1511 391
4 3300048924 Ga0496121_0091778 Ga0496121_0091778_986_2311 391
5 3300003354 JGI25160J50197_1017276 JGI25160J50197_10172762 392
6 3300003775 Ga0055524_1013670 Ga0055524_10136702 392
7 3300005347 Ga0070668_100026912 Ga0070668_1000269122 392
8 3300005455 Ga0070663_100114893 Ga0070663_1001148932 392
9 3300009011 Ga0105251_10009825 Ga0105251_100098253 392
10 3300025258 Ga0209129_1004783 Ga0209129_10047833 392
11 3300025295 Ga0209564_1006365 Ga0209564_10063653 392
12 3300025299 Ga0209256_1006448 Ga0209256_10064485 392
13 3300025302 Ga0207426_1002097 Ga0207426_10020973 392
14 3300026067 Ga0207678_10121399 Ga0207678_101213992 392
15 3300048905 Ga0496102_0147046 Ga0496102_0147046_380_1705 392
16 3300048907 Ga0496104_0117240 Ga0496104_0117240_854_2179 392
17 3300048909 Ga0496106_0229412 Ga0496106_0229412_54_1379 392
18 3300048922 Ga0496119_0076515 Ga0496119_0076515_180_1505 392
19 3300048925 Ga0496122_0056292 Ga0496122_0056292_110_1435 392
20 3300048929 Ga0496126_0065112 Ga0496126_0065112_219_1544 392
21 3300009766 Ga0123342_1010090 Ga0123342_10100909 396
22 3300002773 JGI25152J39213_1000869 JGI25152J39213_100086913 398
23 3300002774 JGI25150J39212_1000266 JGI25150J39212_10002667 398
24 3300003187 JGI25151J46595_10000355 JGI25151J46595_100003556 398
25 3300003215 JGI25153J46596_10007137 JGI25153J46596_100071376 398
26 3300025245 Ga0207425_1000052 Ga0207425_1000052137 398
27 3300025258 Ga0209129_1000141 Ga0209129_100014167 398
28 3300025294 Ga0209025_1000144 Ga0209025_100014459 398
29 3300025297 Ga0209758_1000229 Ga0209758_100022959 398
30 3300048919 Ga0496116_0052521 Ga0496116_0052521_582_1889 398
31 3300048920 Ga0496117_0007245 Ga0496117_0007245_5941_7248 398
32 3300048921 Ga0496118_0015080 Ga0496118_0015080_4673_5980 398
33 3300048924 Ga0496121_0009474 Ga0496121_0009474_811_2118 398
34 3300048925 Ga0496122_0020668 Ga0496122_0020668_582_1889 398
35 3300048926 Ga0496123_0044627 Ga0496123_0044627_735_2042 398
36 3300048927 Ga0496124_0072470 Ga0496124_0072470_735_2042 398
37 3300048928 Ga0496125_0002093 Ga0496125_0002093_21614_22921 398
38 3300048929 Ga0496126_0050368 Ga0496126_0050368_161_1468 398
39 3300049568 Ga0501031_0133276 Ga0501031_0133276_69_1484 402
40 3300049570 Ga0501033_0127004 Ga0501033_0127004_46_1461 402
41 3300049576 Ga0501040_0056767 Ga0501040_0056767_342_1757 402
42 3300049578 Ga0501042_0074776 Ga0501042_0074776_762_2177 402
43 3300049580 Ga0501046_0063077 Ga0501046_0063077_153_1568 402
44 3300049582 Ga0501048_0119476 Ga0501048_0119476_287_1702 402
45 3300049591 Ga0501075_0050317 Ga0501075_0050317_95_1510 402
46 3300049592 Ga0501076_0207007 Ga0501076_0207007_173_1588 402
47 3300049741 Ga0501079_0038193 Ga0501079_0038193_1285_2700 402
48 3300046810 Ga0495660_0110720 Ga0495660_0110720_167_1378 403
49 3300047443 Ga0495687_031472 Ga0495687_031472_14_1225 403
50 3300048924 Ga0496121_0105532 Ga0496121_0105532_443_1750 403
51 3300048929 Ga0496126_0225310 Ga0496126_0225310_71_1378 403
52 3300048924 Ga0496121_0009970 Ga0496121_0009970_1171_2481 405
53 3300048927 Ga0496124_0043463 Ga0496124_0043463_2445_3755 405
54 3300021388 Ga0213875_10000343 Ga0213875_1000034324 406
55 3300037853 Ga0436364_0699238 Ga0436364_0699238_36516_37814 406
56 3300048914 Ga0496111_0017994 Ga0496111_0017994_2449_3759 406
57 3300048926 Ga0496123_0004823 Ga0496123_0004823_4711_6021 406
58 3300048927 Ga0496124_0066405 Ga0496124_0066405_535_1845 406
59 3300006038 Ga0075365_10004347 Ga0075365_100043471 411
60 3300021384 Ga0213876_10030813 Ga0213876_100308132 414
61 3300003187 JGI25151J46595_10007774 JGI25151J46595_100077746 415
62 3300003187 JGI25151J46595_10010521 JGI25151J46595_100105214 415
63 3300025258 Ga0209129_1000066 Ga0209129_1000066161 415
64 3300025294 Ga0209025_1000275 Ga0209025_100027564 415
65 3300028794 Ga0307515_10000283 Ga0307515_10000283108 419
66 3300048919 Ga0496116_0035568 Ga0496116_0035568_582_1889 420
67 3300002773 JGI25152J39213_1009804 JGI25152J39213_10098042 421
68 3300003215 JGI25153J46596_10023535 JGI25153J46596_100235352 421
69 3300003792 Ga0055540_1001653 Ga0055540_10016537 421
70 3300025258 Ga0209129_1001848 Ga0209129_10018488 421
71 3300025273 Ga0209673_1002137 Ga0209673_10021378 421
72 3300025294 Ga0209025_1015100 Ga0209025_10151002 421
73 3300025297 Ga0209758_1003684 Ga0209758_10036848 421
74 3300025298 Ga0209050_1006063 Ga0209050_10060637 421
75 3300025303 Ga0209051_1000170 Ga0209051_100017088 421
76 3300025304 Ga0209257_1007148 Ga0209257_10071485 421
77 3300049570 Ga0501033_0007454 Ga0501033_0007454_722_1996 421
78 3300049823 Ga0501044_0027039 Ga0501044_0027039_214_1488 421
79 3300053094 Ga0500566_0000409 Ga0500566_0000409_15686_16963 421
80 3300025294 Ga0209025_1013390 Ga0209025_10133905 422
81 3300003790 Ga0055528_1001190 Ga0055528_10011906 423
82 3300009766 Ga0123342_1021055 Ga0123342_10210553 423
83 3300025273 Ga0209673_1000911 Ga0209673_100091132 423
84 3300025295 Ga0209564_1000486 Ga0209564_100048614 423
85 3300025299 Ga0209256_1000715 Ga0209256_10007152 423
86 3300025923 Ga0207681_10071983 Ga0207681_100719833 423
87 3300028577 Ga0265318_10033630 Ga0265318_100336302 423
88 3300048921 Ga0496118_0017956 Ga0496118_0017956_4124_5431 423
89 3300049574 Ga0501038_0173778 Ga0501038_0173778_353_1660 423
90 3300049580 Ga0501046_0098355 Ga0501046_0098355_898_2205 423
91 3300049581 Ga0501047_0115034 Ga0501047_0115034_184_1491 423
92 3300049589 Ga0501073_0178879 Ga0501073_0178879_101_1408 423
93 3300060353 Ga0501082_0051375 Ga0501082_0051375_1305_2612 423
94 3300025294 Ga0209025_1008610 Ga0209025_10086107 424
95 3300028794 Ga0307515_10000448 Ga0307515_1000044850 424
96 3300046474 Ga0495605_0009235 Ga0495605_0009235_88_1395 424
97 3300049460 Ga0495682_0049127 Ga0495682_0049127_43_1350 424
98 3300048924 Ga0496121_0056726 Ga0496121_0056726_1700_3007 425
99 3300003354 JGI25160J50197_1003769 JGI25160J50197_10037693 426
100 3300003374 JGI25161J50226_1006787 JGI25161J50226_10067872 426
101 3300004625 Ga0055543_1002126 Ga0055543_10021266 426
102 3300006038 Ga0075365_10017265 Ga0075365_100172655 426
103 3300006195 Ga0075366_10005204 Ga0075366_100052046 426
104 3300006353 Ga0075370_10000842 Ga0075370_1000084210 426
105 3300025302 Ga0207426_1000142 Ga0207426_1000142109 426
106 3300046810 Ga0495660_0040102 Ga0495660_0040102_581_1888 426
107 3300050490 nmdc:mga03n38_32690_c1 nmdc:mga03n38_32690_c1_226_1533 426
108 3300050492 nmdc:mga0yw44_35339_c1 nmdc:mga0yw44_35339_c1_1280_2587 426
109 3300050493 nmdc:mga0k408_10280_c1 nmdc:mga0k408_10280_c1_983_2290 426
110 3300050494 nmdc:mga06z11_16604_c1 nmdc:mga06z11_16604_c1_1233_2540 426
111 3300050496 nmdc:mga07m45_21583_c1 nmdc:mga07m45_21583_c1_1037_2344 426
112 3300006178 Ga0075367_10004267 Ga0075367_100042673 427
113 iso_pu_bacteria 2579778521 2579853658 428
114 iso_pu_bacteria 2619618881 2619854226 428
115 iso_pu_bacteria 2619619003 2620349945 428
116 iso_pu_bacteria 2626541554 2626636046 428
117 iso_pu_bacteria 8054913762 8054917108 428
118 iso_pu_bacteria 2509276021 2509388992 431
119 iso_pu_bacteria 2509276033 2509444582 431
120 iso_pu_bacteria 2510065019 2510135671 431
121 iso_pu_bacteria 2510461076 2510897144 431
122 iso_pu_bacteria 2513237084 2513570832 431
123 iso_pu_bacteria 2513237085 2513574953 431
124 iso_pu_bacteria 2513237088 2513595615 431
125 iso_pu_bacteria 2513237103 2513707584 431
126 iso_pu_bacteria 2513237138 2513865360 431
127 iso_pu_bacteria 2513237162 2514023682 431
128 iso_pu_bacteria 2515075009 2515114835 431
129 iso_pu_bacteria 2515154113 2515635808 431
130 iso_pu_bacteria 2515154114 2515641422 431
131 iso_pu_bacteria 2515154116 2515659311 431
132 iso_pu_bacteria 2515154134 2515741180 431
133 iso_pu_bacteria 2516653077 2517038453 431
134 iso_pu_bacteria 2516653085 2517078729 431
135 iso_pu_bacteria 2517093000 2517097471 431
136 iso_pu_bacteria 2517287029 2517408927 431
137 iso_pu_bacteria 2519899620 2520379179 431
138 iso_pu_bacteria 2524023209 2524461869 431
139 iso_pu_bacteria 2529292951 2530648342 431
140 iso_pu_bacteria 2534681796 2535514572 431
141 iso_pu_bacteria 2582581294 2585201283 431
142 iso_pu_bacteria 2582581298 2585223261 431
143 iso_pu_bacteria 2582581299 2585230951 431
144 iso_pu_bacteria 2582581306 2585264742 431
145 iso_pu_bacteria 2582581865 2585386189 431
146 iso_pu_bacteria 2582581866 2585394801 431
147 iso_pu_bacteria 2582581867 2585399102 431
148 iso_pu_bacteria 2585427526 2585523956 431
149 iso_pu_bacteria 2585427528 2585542100 431
150 iso_pu_bacteria 2585427529 2585546143 431
151 iso_pu_bacteria 2585427590 2585818748 431
152 iso_pu_bacteria 2585427593 2585840690 431
153 iso_pu_bacteria 2585427594 2585843692 431
154 iso_pu_bacteria 2585427608 2585900318 431
155 iso_pu_bacteria 2585427633 2585998433 431
156 iso_pu_bacteria 2585427634 2586002996 431
157 iso_pu_bacteria 2599185156 2599332428 431
158 iso_pu_bacteria 2615840624 2616293959 431
159 iso_pu_bacteria 2643221599 2644004415 431
160 iso_pu_bacteria 2643221634 2644191213 431
161 iso_pu_bacteria 2643221643 2644237667 431
162 iso_pu_bacteria 2643221688 2644495438 431
163 iso_pu_bacteria 2718217927 2719388094 431
164 iso_pu_bacteria 2718217997 2719667717 431
165 iso_pu_bacteria 2718218009 2719734051 431
166 iso_pu_bacteria 2718218199 2720494137 431
167 iso_pu_bacteria 2718218232 2720615600 431
168 iso_pu_bacteria 2718218233 2720622383 431
169 iso_pu_bacteria 2718218235 2720633737 431
170 iso_pu_bacteria 2718218269 2720777437 431
171 iso_pu_bacteria 2718218363 2721149446 431
172 iso_pu_bacteria 2718218365 2721160849 431
173 iso_pu_bacteria 2718218366 2721166283 431
174 iso_pu_bacteria 2718218423 2721401727 431
175 iso_pu_bacteria 2721755514 2722842453 431
176 iso_pu_bacteria 2721755556 2723029034 431
177 iso_pu_bacteria 2721755684 2723562651 431
178 iso_pu_bacteria 2721755685 2723569344 431
179 iso_pu_bacteria 2721755809 2724040541 431
180 iso_pu_bacteria 2721755810 2724046807 431
181 iso_pu_bacteria 2721755819 2724092044 431
182 iso_pu_bacteria 2721755822 2724106609 431
183 iso_pu_bacteria 2721755823 2724112417 431
184 iso_pu_bacteria 2724679232 2725949665 431
185 iso_pu_bacteria 2728369352 2730109970 431
186 iso_pu_bacteria 2728369365 2730166569 431
187 iso_pu_bacteria 2728369397 2730300481 431
188 iso_pu_bacteria 2738541293 2738800767 431
189 iso_pu_bacteria 2738541333 2739037349 431
190 iso_pu_bacteria 2791355256 2793298462 431
191 iso_pu_bacteria 2791355259 2793315698 431
192 iso_pu_bacteria 2791355261 2793327573 431
193 iso_pu_bacteria 2791355262 2793335644 431
194 iso_pu_bacteria 2791355263 2793341038 431
195 iso_pu_bacteria 2791355264 2793350285 431
196 iso_pu_bacteria 2791355265 2793354774 431
197 iso_pu_bacteria 2791355266 2793358529 431
198 iso_pu_bacteria 2791355267 2793368981 431
199 iso_pu_bacteria 2802429605 2805928905 431
200 iso_pu_bacteria 2802429606 2805934526 431
201 iso_pu_bacteria 2802429633 2806047076 431
202 iso_pu_bacteria 2802429634 2806054925 431
203 iso_pu_bacteria 2802429635 2806061847 431
204 iso_pu_bacteria 2802429636 2806069630 431
205 iso_pu_bacteria 2802429637 2806075999 431
206 iso_pu_bacteria 2821123053 2821123233 431
207 iso_pu_bacteria 2838016132 2838020944 431
208 iso_pu_bacteria 2838042994 2838044854 431
209 iso_pu_bacteria 2838048938 2838052907 431
210 iso_pu_bacteria 2838061910 2838064700 431
211 iso_pu_bacteria 2838068647 2838070523 431
212 iso_pu_bacteria 2838668709 2838672529 431
213 iso_pu_bacteria 2838680041 2838685586 431
214 iso_pu_bacteria 2838686498 2838689838 431
215 iso_pu_bacteria 2838694306 2838695958 431
216 iso_pu_bacteria 2838701080 2838705148 431
217 iso_pu_bacteria 2838707686 2838713357 431
218 iso_pu_bacteria 2838729681 2838731466 431
219 iso_pu_bacteria 2838736955 2838739744 431
220 iso_pu_bacteria 2838742623 2838744407 431
221 iso_pu_bacteria 2841840854 2841844132 431
222 iso_pu_bacteria 2841851746 2841852947 431
223 iso_pu_bacteria 2841864319 2841869121 431
224 iso_pu_bacteria 2842077413 2842082591 431
225 iso_pu_bacteria 2842118031 2842123850 431
226 iso_pu_bacteria 2842140634 2842143853 431
227 iso_pu_bacteria 2842146304 2842150142 431
228 iso_pu_bacteria 2842156927 2842160274 431
229 iso_pu_bacteria 2842163707 2842165748 431
230 iso_pu_bacteria 2842180545 2842184060 431
231 iso_pu_bacteria 2842192696 2842196362 431
232 iso_pu_bacteria 2842205361 2842208912 431
233 iso_pu_bacteria 2842217011 2842219424 431
234 iso_pu_bacteria 2842229732 2842231642 431
235 iso_pu_bacteria 2842237096 2842242905 431
236 iso_pu_bacteria 2842243621 2842245889 431
237 iso_pu_bacteria 2842250916 2842254828 431
238 iso_pu_bacteria 2842257432 2842260267 431
239 iso_pu_bacteria 2842264693 2842267155 431
240 iso_pu_bacteria 2842271015 2842273678 431
241 iso_pu_bacteria 2842278818 2842282398 431
242 iso_pu_bacteria 2842285085 2842290062 431
243 iso_pu_bacteria 2842291075 2842296978 431
244 iso_pu_bacteria 2842298080 2842299935 431
245 iso_pu_bacteria 2842304105 2842308470 431
246 iso_pu_bacteria 2842311132 2842312226 431
247 iso_pu_bacteria 2842317721 2842321820 431
248 iso_pu_bacteria 2842341865 2842344654 431
249 iso_pu_bacteria 2842357229 2842359543 431
250 iso_pu_bacteria 2842363717 2842367771 431
251 iso_pu_bacteria 2842370503 2842376028 431
252 iso_pu_bacteria 2842377471 2842383238 431
253 iso_pu_bacteria 2842384541 2842390371 431
254 iso_pu_bacteria 2842395702 2842397839 431
255 iso_pu_bacteria 2842402390 2842407672 431
256 iso_pu_bacteria 2842409023 2842414303 431
257 iso_pu_bacteria 2842415677 2842420837 431
258 iso_pu_bacteria 2842422224 2842424137 431
259 iso_pu_bacteria 2842428310 2842431149 431
260 iso_pu_bacteria 2842434925 2842437484 431
261 iso_pu_bacteria 2842441272 2842444299 431
262 iso_pu_bacteria 2842447887 2842451274 431
263 iso_pu_bacteria 2842462802 2842465292 431
264 iso_pu_bacteria 2842469257 2842472239 431
265 iso_pu_bacteria 2842489311 2842494110 431
266 iso_pu_bacteria 2842495871 2842501245 431
267 iso_pu_bacteria 2842922631 2842922696 431
268 iso_pu_bacteria 2844454524 2844456586 431
269 iso_pu_bacteria 2857531043 2857533815 431
270 iso_pu_bacteria 2919100787 2919101860 431
271 iso_pu_bacteria 2923556063 2923556179 431
272 iso_pu_bacteria 2933570622 2933574919 431
273 iso_pu_bacteria 2933599457 2933601328 431
274 iso_pu_bacteria 2935894831 2935899976 431
275 iso_pu_bacteria 2935901341 2935902327 431
276 iso_pu_bacteria 2936367885 2936369539 431
277 iso_pu_bacteria 2936375103 2936380280 431
278 iso_pu_bacteria 2936381700 2936385263 431
279 iso_pu_bacteria 2989349275 2989351971 431
280 iso_pu_bacteria 2989771324 2989774546 431
281 iso_pu_bacteria 2995392953 2995395231 431
282 iso_pu_bacteria 2996887358 2996887966 431
283 iso_pu_bacteria 2996893221 2996897601 431
284 iso_pu_bacteria 3003930520 3003931340 431
285 iso_pu_bacteria 3005409236 3005410637 431
286 iso_pu_bacteria 3005445848 3005450098 431
287 iso_pu_bacteria 3005452660 3005456330 431
288 iso_pu_bacteria 639633055 639646070 431
289 iso_pu_bacteria 8005258706 8005261468 431
290 iso_pu_bacteria 8005275841 8005278296 431
291 iso_pu_bacteria 8005282627 8005282670 431
292 iso_pu_bacteria 8005289223 8005291646 431
293 iso_pu_bacteria 8005301065 8005305481 431
294 iso_pu_bacteria 8005307578 8005310257 431
295 iso_pu_bacteria 8005321885 8005322493 431
296 iso_pu_bacteria 8005376324 8005378096 431
297 iso_pu_bacteria 8005382845 8005384106 431
298 iso_pu_bacteria 8005395548 8005399616 431
299 iso_pu_bacteria 8005430974 8005433791 431
300 iso_pu_bacteria 8005460587 8005465531 431
301 iso_pu_bacteria 8005497431 8005498114 431
302 iso_pu_bacteria 8005542996 8005543232 431
303 iso_pu_bacteria 8005556819 8005559981 431
304 iso_pu_bacteria 8005563573 8005564525 431
305 iso_pu_bacteria 8005570704 8005571211 431
306 iso_pu_bacteria 8005619151 8005619323 431
307 iso_pu_bacteria 8005626139 8005627888 431
308 iso_pu_bacteria 8005668836 8005669522 431
309 iso_pu_bacteria 8005688590 8005692767 431
310 iso_pu_bacteria 8005695170 8005701455 431
311 iso_pu_bacteria 8018127388 8018132539 431
312 iso_pu_bacteria 8018163183 8018167601 431
313 iso_pu_bacteria 8018176218 8018176614 431
314 iso_pu_bacteria 8023680758 8023681266 431
315 iso_pu_bacteria 8024479707 8024481903 431
316 iso_pu_bacteria 8024501048 8024506339 431
317 iso_pu_bacteria 8056375014 8056381184 431
318 iso_pu_bacteria 8056382006 8056382677 431
319 iso_pu_bacteria 8057874678 8057878695 431
320 3300002704 JGI25155J39150_1000110 JGI25155J39150_100011032 435
321 3300002705 JGI25156J39149_1000192 JGI25156J39149_100019233 435
322 3300002738 JGI25154J39366_1000196 JGI25154J39366_100019612 435
323 3300002741 JGI25157J39369_1000228 JGI25157J39369_100022812 435
324 3300003187 JGI25151J46595_10000660 JGI25151J46595_100006606 435
325 3300003214 JGI25165J46597_1001741 JGI25165J46597_10017415 435
326 3300003215 JGI25153J46596_10003933 JGI25153J46596_100039332 435
327 3300003215 JGI25153J46596_10007015 JGI25153J46596_100070155 435
328 3300003215 JGI25153J46596_10007533 JGI25153J46596_100075332 435
329 3300003215 JGI25153J46596_10023537 JGI25153J46596_100235372 435
330 3300003320 rootH2_10079948 rootH2_100799482 435
331 3300003374 JGI25161J50226_1000078 JGI25161J50226_100007839 435
332 3300003771 Ga0055526_1012978 Ga0055526_10129782 435
333 3300003771 Ga0055526_1013813 Ga0055526_10138134 435
334 3300003775 Ga0055524_1004262 Ga0055524_10042626 435
335 3300003790 Ga0055528_1000113 Ga0055528_100011350 435
336 3300003790 Ga0055528_1005448 Ga0055528_10054483 435
337 3300003790 Ga0055528_1015743 Ga0055528_10157432 435
338 3300003792 Ga0055540_1007715 Ga0055540_10077152 435
339 3300004625 Ga0055543_1000069 Ga0055543_100006985 435
340 3300005458 Ga0070681_10001193 Ga0070681_100011935 435
341 3300006048 Ga0075363_100074448 Ga0075363_1000744481 435
342 3300006177 Ga0075362_10001958 Ga0075362_100019587 435
343 3300009765 Ga0123341_1000642 Ga0123341_10006427 435
344 3300025206 Ga0209435_100087 Ga0209435_10008712 435
345 3300025208 Ga0209436_100022 Ga0209436_100022101 435
346 3300025233 Ga0209437_100205 Ga0209437_10020582 435
347 3300025245 Ga0207425_1001736 Ga0207425_10017366 435
348 3300025245 Ga0207425_1010493 Ga0207425_10104932 435
349 3300025246 Ga0209646_1000285 Ga0209646_100028512 435
350 3300025250 Ga0209026_1000347 Ga0209026_100034712 435
351 3300025256 Ga0209759_1000482 Ga0209759_100048212 435
352 3300025258 Ga0209129_1001039 Ga0209129_100103917 435
353 3300025258 Ga0209129_1001099 Ga0209129_100109911 435
354 3300025258 Ga0209129_1002246 Ga0209129_10022464 435
355 3300025261 Ga0209233_1000187 Ga0209233_1000187102 435
356 3300025273 Ga0209673_1000024 Ga0209673_1000024103 435
357 3300025273 Ga0209673_1002283 Ga0209673_10022838 435
358 3300025284 Ga0209130_1000002 Ga0209130_1000002584 435
359 3300025291 Ga0209675_1012333 Ga0209675_10123332 435
360 3300025294 Ga0209025_1000274 Ga0209025_100027431 435
361 3300025294 Ga0209025_1021176 Ga0209025_10211763 435
362 3300025295 Ga0209564_1000474 Ga0209564_100047457 435
363 3300025295 Ga0209564_1010276 Ga0209564_10102764 435
364 3300025295 Ga0209564_1010422 Ga0209564_10104223 435
365 3300025297 Ga0209758_1000466 Ga0209758_10004668 435
366 3300025297 Ga0209758_1000971 Ga0209758_10009718 435
367 3300025297 Ga0209758_1001494 Ga0209758_10014942 435
368 3300025297 Ga0209758_1009079 Ga0209758_10090795 435
369 3300025299 Ga0209256_1000868 Ga0209256_100086818 435
370 3300025299 Ga0209256_1003327 Ga0209256_10033275 435
371 3300025302 Ga0207426_1000013 Ga0207426_1000013584 435
372 3300025303 Ga0209051_1002082 Ga0209051_10020826 435
373 3300025303 Ga0209051_1006497 Ga0209051_10064975 435
374 3300025303 Ga0209051_1007516 Ga0209051_10075166 435
375 3300025912 Ga0207707_10007003 Ga0207707_100070035 435
376 3300027111 Ga0209281_1000043 Ga0209281_100004394 435
377 3300027312 Ga0209371_1002100 Ga0209371_10021009 435
378 3300028794 Ga0307515_10070922 Ga0307515_100709222 435
379 3300030500 Ga0268256_1003765 Ga0268256_10037655 435
380 3300031456 Ga0307513_10028778 Ga0307513_100287783 435
381 3300031731 Ga0307405_10001661 Ga0307405_1000166111 435
382 3300031901 Ga0307406_10008771 Ga0307406_100087712 435
383 3300031911 Ga0307412_10053361 Ga0307412_100533612 435
384 3300041491 Ga0451833_0024651 Ga0451833_0024651_1245_2552 435
385 3300041494 Ga0451837_0590853 Ga0451837_0590853_414_1721 435
386 3300041498 Ga0451841_0110248 Ga0451841_0110248_1228_2535 435
387 3300041501 Ga0451845_0170958 Ga0451845_0170958_513_1820 435
388 3300041503 Ga0451847_0340308 Ga0451847_0340308_874_2181 435
389 3300041503 Ga0451847_0567321 Ga0451847_0567321_884_2191 435
390 3300041507 Ga0451851_0121898 Ga0451851_0121898_181_1488 435
391 3300041507 Ga0451851_0315093 Ga0451851_0315093_106_1413 435
392 3300046460 Ga0495638_0016085 Ga0495638_0016085_163_1473 435
393 3300046460 Ga0495638_0072799 Ga0495638_0072799_201_1508 435
394 3300046471 Ga0495650_0036928 Ga0495650_0036928_349_1656 435
395 3300046501 Ga0495607_0113634 Ga0495607_0113634_75_1382 435
396 3300046506 Ga0495583_0003929 Ga0495583_0003929_1754_3061 435
397 3300046507 Ga0495606_0005067 Ga0495606_0005067_6124_7431 435
398 3300046519 Ga0495632_0003799 Ga0495632_0003799_4041_5348 435
399 3300046524 Ga0495648_0037906 Ga0495648_0037906_1210_2517 435
400 3300046615 Ga0495656_0007518 Ga0495656_0007518_514_1821 435
401 3300046616 Ga0495668_0032955 Ga0495668_0032955_257_1564 435
402 3300046660 Ga0495625_0070882 Ga0495625_0070882_124_1434 435
403 3300046660 Ga0495625_0074394 Ga0495625_0074394_596_1903 435
404 3300046660 Ga0495625_0133306 Ga0495625_0133306_324_1631 435
405 3300046665 Ga0495661_0014352 Ga0495661_0014352_1782_3089 435
406 3300047472 Ga0495686_0002334 Ga0495686_0002334_11673_12980 435
407 3300048904 Ga0496101_0054938 Ga0496101_0054938_941_2248 435
408 3300048909 Ga0496106_0006761 Ga0496106_0006761_4310_5617 435
409 3300048919 Ga0496116_0029105 Ga0496116_0029105_2094_3401 435
410 3300048919 Ga0496116_0047629 Ga0496116_0047629_892_2199 435
411 3300048919 Ga0496116_0057026 Ga0496116_0057026_439_1746 435
412 3300048920 Ga0496117_0021071 Ga0496117_0021071_51_1358 435
413 3300048920 Ga0496117_0065313 Ga0496117_0065313_810_2117 435
414 3300048921 Ga0496118_0020837 Ga0496118_0020837_603_1910 435
415 3300048924 Ga0496121_0023381 Ga0496121_0023381_495_1802 435
416 3300048924 Ga0496121_0044238 Ga0496121_0044238_652_1959 435
417 3300048924 Ga0496121_0056828 Ga0496121_0056828_1021_2328 435
418 3300048924 Ga0496121_0075196 Ga0496121_0075196_582_1889 435
419 3300048924 Ga0496121_0141492 Ga0496121_0141492_113_1420 435
420 3300048925 Ga0496122_0040014 Ga0496122_0040014_2092_3399 435
421 3300048925 Ga0496122_0064090 Ga0496122_0064090_582_1889 435
422 3300048926 Ga0496123_0035722 Ga0496123_0035722_1854_3161 435
423 3300048926 Ga0496123_0042189 Ga0496123_0042189_1015_2322 435
424 3300048926 Ga0496123_0070544 Ga0496123_0070544_69_1376 435
425 3300048927 Ga0496124_0013026 Ga0496124_0013026_908_2215 435
426 3300048927 Ga0496124_0014897 Ga0496124_0014897_5598_6905 435
427 3300048927 Ga0496124_0059776 Ga0496124_0059776_549_1856 435
428 3300048928 Ga0496125_0037411 Ga0496125_0037411_2082_3389 435
429 3300053109 Ga0500569_007414 Ga0500569_007414_395_1702 435
430 3300053134 Ga0500658_0009920 Ga0500658_0009920_40_1347 435
431 3300053139 Ga0500568_0001169 Ga0500568_0001169_12330_13637 435
432 3300053139 Ga0500568_0006185 Ga0500568_0006185_642_1949 435
433 3300053152 Ga0500606_038505 Ga0500606_038505_242_1549 435
434 3300053153 Ga0500616_0009183 Ga0500616_0009183_4065_5372 435
435 3300053156 Ga0500622_0009636 Ga0500622_0009636_72_1379 435
436 3300053160 Ga0500633_0008137 Ga0500633_0008137_12_1319 435
437 iso_pu_bacteria 2510917028 2511185324 435

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02885

Glycos_trans_3N

Glycosyl transferase family, helical bundle domain

21

83

0.98

PF07831

PYNP_C

Pyrimidine nucleoside phosphorylase C-terminal domain

364

438

0.98

PF00591

Glycos_transf_3

Glycosyl transferase family, a/b domain

92

324

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ey3-assembly1.cif.gz_B x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate 0.9782 1 435
5ey3-assembly1.cif.gz_B x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate 0.976 1 435
1azy-assembly1.cif.gz_A structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase 0.969 1 435
1azy-assembly1.cif.gz_A structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase 0.9668 1 435
2dsj-assembly1.cif.gz_B crystal structure of project id tt0128 from thermus thermophilus hb8 0.9494 1 435
ID Description Score Start End Superfamily
2j0fB01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9954 1 67 1.20.970.10
2wk6B01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9901 3 67 1.20.970.10
2wk5A01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9889 1 67 1.20.970.10
af_P9WFS1_8_72_1.20.970.10 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9867 4 66 1.20.970.10
2wk5C01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9865 1 67 1.20.970.10
ID Description Score Start End GO Terms
AF-A0A1C9HY35-F1-model_v4 thymidine phosphorylase (EC 2.4.2.4) 0.9975 198 435 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032
AF-N6UUZ2-F1-model_v4 thymidine phosphorylase (EC 2.4.2.4) 0.9951 108 435 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032
AF-A0A4V1TKU7-F1-model_v4 deleted 0.9927 300 433
AF-N6UUZ2-F1-model_v4 thymidine phosphorylase (EC 2.4.2.4) 0.992 108 435 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032
AF-A0A529UCI9-F1-model_v4 deleted 0.9914 1 313

Feature Viewer

pLDDT pTM Quality
94.02 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map