F443781

General Info

Members Datasets Scaffolds Average Seq Length
437 207 874 124

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10049468|Ga0207695_100494682
Length 148
Sequence MRDTSVPSKEIFTRRRGSKASAIEWDVMRYLVTARLKHGCEQSLADAIADGTLGEGSIAGDEYMRNMDAARQLPDGRVQWVEVCYCSAPLAEEREYWEEYFDLVKIQDAHARSRCRDLNGTEPWACGDCDCSARLEARLATKGEKFLP

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.12
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 27.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10049468 3300025913 Bacteria 4430
2 JGI24746J21847_1040025 3300001977 Unclassified 651
3 Ga0065704_10124401 3300005289 Unclassified 1718
4 Ga0065712_10127962 3300005290 Bacteria 1581
5 Ga0065715_10056991 3300005293 Unclassified 801
6 Ga0065715_10284854 3300005293 Bacteria 1077
7 Ga0065707_10001538 3300005295 Bacteria 11650
8 Ga0065707_11075140 3300005295 Unclassified 521
9 Ga0070676_11000426 3300005328 Bacteria 628
10 Ga0070683_100106528 3300005329 Bacteria 2643
11 Ga0070670_100011148 3300005331 Bacteria 7681
12 Ga0070670_101646979 3300005331 Unclassified 590
13 Ga0070670_102194347 3300005331 Bacteria 509
14 Ga0068869_100369026 3300005334 Bacteria 1174
15 Ga0070666_10021205 3300005335 Bacteria 4209
16 Ga0070680_100824372 3300005336 Bacteria 800
17 Ga0068868_100158993 3300005338 Bacteria 1865
18 Ga0068868_100977775 3300005338 Bacteria 773
19 Ga0070660_100023242 3300005339 Bacteria 4592
20 Ga0070689_100010073 3300005340 Bacteria 6729
21 Ga0070689_100033650 3300005340 Bacteria 3906
22 Ga0070689_100038441 3300005340 Bacteria 3662
23 Ga0070687_100332882 3300005343 Bacteria 974
24 Ga0070668_100159570 3300005347 Bacteria 1829
25 Ga0070669_100003011 3300005353 Bacteria 12138
26 Ga0070669_100592696 3300005353 Unclassified 928
27 Ga0070675_100000085 3300005354 Bacteria 54561
28 Ga0070675_100000532 3300005354 Bacteria 26032
29 Ga0070675_100096251 3300005354 Bacteria 2487
30 Ga0070671_100010923 3300005355 Bacteria 7293
31 Ga0070671_100271312 3300005355 Bacteria 1442
32 Ga0070671_100697014 3300005355 Unclassified 881
33 Ga0070671_101320084 3300005355 Unclassified 636
34 Ga0070674_100796281 3300005356 Unclassified 816
35 Ga0070673_100023223 3300005364 Bacteria 4530
36 Ga0070673_100644478 3300005364 Bacteria 969
37 Ga0070673_101426180 3300005364 Unclassified 652
38 Ga0070688_100011343 3300005365 Bacteria 4950
39 Ga0070688_100091227 3300005365 Bacteria 1991
40 Ga0070688_101443886 3300005365 Unclassified 558
41 Ga0070659_100486165 3300005366 Bacteria 1051
42 Ga0070667_100005130 3300005367 Bacteria 10963
43 Ga0070667_100006517 3300005367 Bacteria 9703
44 Ga0070714_100004548 3300005435 Bacteria 10456
45 Ga0070701_10171045 3300005438 Unclassified 1265
46 Ga0070701_10504036 3300005438 Bacteria 786
47 Ga0070705_100185256 3300005440 Unclassified 1414
48 Ga0070694_100862923 3300005444 Bacteria 745
49 Ga0070708_100216344 3300005445 Unclassified 1796
50 Ga0070678_102282631 3300005456 Unclassified 513
51 Ga0070662_100088823 3300005457 Bacteria 2317
52 Ga0070681_10756018 3300005458 Unclassified 889
53 Ga0068867_101353364 3300005459 Unclassified 659
54 Ga0070685_10107497 3300005466 Bacteria 1713
55 Ga0070706_101140822 3300005467 Bacteria 717
56 Ga0070707_100138621 3300005468 Bacteria 2367
57 Ga0070707_100393484 3300005468 Unclassified 1346
58 Ga0070707_100936339 3300005468 Unclassified 831
59 Ga0070698_100163758 3300005471 Bacteria 2167
60 Ga0070699_100004325 3300005518 Bacteria 12559
61 Ga0070699_100763906 3300005518 Bacteria 884
62 Ga0070699_102178859 3300005518 Unclassified 506
63 Ga0070684_100982977 3300005535 Unclassified 792
64 Ga0070684_101225504 3300005535 Bacteria 706
65 Ga0070697_100624467 3300005536 Bacteria 948
66 Ga0070697_101258473 3300005536 Bacteria 660
67 Ga0070697_101405599 3300005536 Bacteria 623
68 Ga0070672_100004729 3300005543 Bacteria 8935
69 Ga0070672_100043023 3300005543 Bacteria 3480
70 Ga0070672_100183743 3300005543 Unclassified 1743
71 Ga0070686_100300175 3300005544 Bacteria 1191
72 Ga0070686_100312427 3300005544 Bacteria 1169
73 Ga0070686_100384150 3300005544 Unclassified 1064
74 Ga0070665_100006417 3300005548 Bacteria 11970
75 Ga0070665_100478305 3300005548 Bacteria 1256
76 Ga0070704_100226380 3300005549 Bacteria 1523
77 Ga0068855_100101813 3300005563 Bacteria 3306
78 Ga0070664_100059795 3300005564 Bacteria 3243
79 Ga0068852_101014112 3300005616 Unclassified 849
80 Ga0068859_100019013 3300005617 Bacteria 6899
81 Ga0068859_100462335 3300005617 Bacteria 1365
82 Ga0068859_100675948 3300005617 Bacteria 1124
83 Ga0068859_100941809 3300005617 Bacteria 947
84 Ga0068859_100968661 3300005617 Unclassified 933
85 Ga0068859_102078070 3300005617 Bacteria 627
86 Ga0068864_100007832 3300005618 Bacteria 8803
87 Ga0068864_100656266 3300005618 Bacteria 1022
88 Ga0068866_10789091 3300005718 Unclassified 659
89 Ga0068863_100000307 3300005841 Bacteria 50304
90 Ga0068863_100015963 3300005841 Bacteria 7202
91 Ga0068858_100135719 3300005842 Unclassified 2309
92 Ga0068858_100197520 3300005842 Bacteria 1901
93 Ga0068858_100513419 3300005842 Bacteria 1158
94 Ga0068858_100700847 3300005842 Unclassified 985
95 Ga0068858_102249179 3300005842 Unclassified 539
96 Ga0068860_100009812 3300005843 Bacteria 9505
97 Ga0068860_100890235 3300005843 Bacteria 906
98 Ga0068862_100012153 3300005844 Bacteria 7117
99 Ga0068862_100021102 3300005844 Bacteria 5445
100 Ga0068862_100776173 3300005844 Unclassified 934
101 Ga0081455_10119358 3300005937 Bacteria 2080
102 Ga0070715_10325297 3300006163 Unclassified 831
103 Ga0070716_100039940 3300006173 Bacteria 2607
104 Ga0070716_100088410 3300006173 Bacteria 1869
105 Ga0070712_100439770 3300006175 Unclassified 1084
106 Ga0097621_100000059 3300006237 Bacteria 57332
107 Ga0097621_100036636 3300006237 Unclassified 3925
108 Ga0097621_100357898 3300006237 Bacteria 1299
109 Ga0097621_100707514 3300006237 Bacteria 928
110 Ga0097621_100974618 3300006237 Unclassified 792
111 Ga0068871_100011607 3300006358 Bacteria 6467
112 Ga0068871_100029599 3300006358 Bacteria 4302
113 Ga0068871_100115254 3300006358 Bacteria 2265
114 Ga0068871_101334201 3300006358 Unclassified 675
115 Ga0075428_100000017 3300006844 Bacteria 147833
116 Ga0075428_100142024 3300006844 Bacteria 2610
117 Ga0075428_100147610 3300006844 Bacteria 2556
118 Ga0075428_100256700 3300006844 Bacteria 1883
119 Ga0075428_100386307 3300006844 Bacteria 1501
120 Ga0075428_100452947 3300006844 Bacteria 1374
121 Ga0075428_100773398 3300006844 Unclassified 1021
122 Ga0075428_100805648 3300006844 Bacteria 998
123 Ga0075428_101450266 3300006844 Bacteria 720
124 Ga0075428_101836708 3300006844 Unclassified 630
125 Ga0075430_100347598 3300006846 Bacteria 1225
126 Ga0075431_100280762 3300006847 Bacteria 1686
127 Ga0075431_101090992 3300006847 Unclassified 763
128 Ga0075433_10056791 3300006852 Bacteria 3421
129 Ga0075433_10106650 3300006852 Bacteria 2483
130 Ga0075433_10279768 3300006852 Bacteria 1478
131 Ga0075433_10340933 3300006852 Unclassified 1325
132 Ga0075433_10984218 3300006852 Unclassified 735
133 Ga0075433_11253207 3300006852 Unclassified 643
134 Ga0075434_100094558 3300006871 Bacteria 2993
135 Ga0075434_100395008 3300006871 Unclassified 1404
136 Ga0075434_100505766 3300006871 Bacteria 1229
137 Ga0075434_100702643 3300006871 Bacteria 1029
138 Ga0075434_100760244 3300006871 Bacteria 986
139 Ga0075434_100765465 3300006871 Unclassified 982
140 Ga0075434_101250453 3300006871 Bacteria 754
141 Ga0075434_101391703 3300006871 Bacteria 712
142 Ga0075434_101631601 3300006871 Bacteria 653
143 Ga0075429_100415735 3300006880 Bacteria 1178
144 Ga0075429_101294705 3300006880 Bacteria 636
145 Ga0068865_100273480 3300006881 Bacteria 1342
146 Ga0068865_100386351 3300006881 Bacteria 1143
147 Ga0068865_100398929 3300006881 Bacteria 1126
148 Ga0068865_100512009 3300006881 Bacteria 1002
149 Ga0075436_100003700 3300006914 Bacteria 10477
150 Ga0075436_100241397 3300006914 Bacteria 1285
151 Ga0097620_100019012 3300006931 Bacteria 6899
152 Ga0097620_100462359 3300006931 Bacteria 1365
153 Ga0097620_100676043 3300006931 Bacteria 1124
154 Ga0097620_100941721 3300006931 Bacteria 947
155 Ga0097620_100968678 3300006931 Unclassified 933
156 Ga0097620_102078366 3300006931 Bacteria 627
157 Ga0075435_100024243 3300007076 Bacteria 4705
158 Ga0075435_100025534 3300007076 Bacteria 4600
159 Ga0075435_100264942 3300007076 Bacteria 1465
160 Ga0075435_101287947 3300007076 Unclassified 640
161 Ga0105240_10035379 3300009093 Bacteria 6437
162 Ga0105240_10872143 3300009093 Unclassified 970
163 Ga0111539_10000002 3300009094 Bacteria 983359
164 Ga0111539_10005979 3300009094 Bacteria 15722
165 Ga0111539_10024149 3300009094 Bacteria 7465
166 Ga0111539_10035398 3300009094 Bacteria 6046
167 Ga0111539_10097040 3300009094 Bacteria 3462
168 Ga0111539_10911293 3300009094 Bacteria 1022
169 Ga0105245_10158466 3300009098 Bacteria 2146
170 Ga0105245_10452928 3300009098 Unclassified 1292
171 Ga0105245_10981999 3300009098 Bacteria 888
172 Ga0105245_12094354 3300009098 Unclassified 619
173 Ga0105247_10235688 3300009101 Unclassified 1245
174 Ga0114129_10000422 3300009147 Bacteria 50170
175 Ga0114129_10003694 3300009147 Bacteria 21552
176 Ga0114129_10122425 3300009147 Bacteria 3579
177 Ga0114129_10194845 3300009147 Bacteria 2748
178 Ga0114129_10385086 3300009147 Unclassified 1851
179 Ga0114129_11409416 3300009147 Bacteria 859
180 Ga0105243_10365075 3300009148 Unclassified 1330
181 Ga0105242_10027394 3300009176 Bacteria 4525
182 Ga0105242_10175445 3300009176 Bacteria 1887
183 Ga0105242_10343982 3300009176 Unclassified 1375
184 Ga0105242_10484343 3300009176 Unclassified 1173
185 Ga0105248_10000090 3300009177 Bacteria 101891
186 Ga0105248_10038339 3300009177 Bacteria 5362
187 Ga0105248_11140270 3300009177 Unclassified 881
188 Ga0105248_11254428 3300009177 Bacteria 838
189 Ga0105248_12242702 3300009177 Unclassified 621
190 Ga0105238_10729708 3300009551 Bacteria 1004
191 Ga0105249_10007386 3300009553 Bacteria 9587
192 Ga0105249_10272389 3300009553 Unclassified 1687
193 Ga0105249_11573980 3300009553 Bacteria 730
194 Ga0105239_10384607 3300010375 Bacteria 1587
195 Ga0105246_10999038 3300011119 Bacteria 757
196 Ga0105246_12034751 3300011119 Unclassified 555
197 Ga0157374_10056472 3300013296 Bacteria 3665
198 Ga0157374_10972002 3300013296 Bacteria 868
199 Ga0157378_10240410 3300013297 Bacteria 1729
200 Ga0157378_12644714 3300013297 Bacteria 554
201 Ga0163162_10011715 3300013306 Bacteria 8553
202 Ga0163162_10077873 3300013306 Bacteria 3380
203 Ga0163162_10557967 3300013306 Bacteria 1273
204 Ga0157375_10001258 3300013308 Bacteria 21945
205 Ga0163163_10003750 3300014325 Bacteria 12938
206 Ga0163163_10746089 3300014325 Unclassified 1042
207 Ga0163163_10925150 3300014325 Bacteria 935
208 Ga0163163_11620940 3300014325 Unclassified 708
209 Ga0157380_10144919 3300014326 Bacteria 2046
210 Ga0157380_11096835 3300014326 Unclassified 835
211 Ga0157380_11377588 3300014326 Unclassified 755
212 Ga0157377_10015349 3300014745 Bacteria 3917
213 Ga0157377_10410064 3300014745 Bacteria 925
214 Ga0157377_10451870 3300014745 Unclassified 887
215 Ga0157379_10001144 3300014968 Bacteria 21683
216 Ga0157379_10013254 3300014968 Bacteria 7220
217 Ga0157379_10390412 3300014968 Bacteria 1278
218 Ga0157376_10066059 3300014969 Unclassified 3056
219 Ga0157376_10098451 3300014969 Bacteria 2550
220 Ga0157376_10343457 3300014969 Bacteria 1426
221 Ga0157376_10914019 3300014969 Unclassified 896
222 Ga0157376_11074410 3300014969 Bacteria 830
223 Ga0207682_10051109 3300025893 Bacteria 1711
224 Ga0207642_10429388 3300025899 Unclassified 796
225 Ga0207710_10012611 3300025900 Bacteria 3556
226 Ga0207685_10214471 3300025905 Unclassified 912
227 Ga0207684_10871872 3300025910 Bacteria 758
228 Ga0207662_10459774 3300025918 Unclassified 871
229 Ga0207662_10485613 3300025918 Bacteria 849
230 Ga0207657_10009251 3300025919 Bacteria 9926
231 Ga0207646_10172360 3300025922 Unclassified 1954
232 Ga0207681_10008966 3300025923 Bacteria 6109
233 Ga0207681_11040059 3300025923 Bacteria 687
234 Ga0207650_10135183 3300025925 Unclassified 1933
235 Ga0207650_10961191 3300025925 Bacteria 726
236 Ga0207650_11330167 3300025925 Unclassified 611
237 Ga0207659_10000112 3300025926 Bacteria 47902
238 Ga0207659_10000666 3300025926 Bacteria 20319
239 Ga0207659_10073066 3300025926 Bacteria 2510
240 Ga0207659_10244580 3300025926 Unclassified 1453
241 Ga0207687_10162784 3300025927 Bacteria 1714
242 Ga0207687_10833791 3300025927 Unclassified 787
243 Ga0207687_11222324 3300025927 Unclassified 646
244 Ga0207700_11245983 3300025928 Unclassified 663
245 Ga0207644_10006755 3300025931 Bacteria 7478
246 Ga0207644_10296970 3300025931 Bacteria 1301
247 Ga0207690_10193134 3300025932 Bacteria 1541
248 Ga0207686_10026561 3300025934 Bacteria 3379
249 Ga0207686_10032927 3300025934 Bacteria 3089
250 Ga0207686_10452475 3300025934 Unclassified 988
251 Ga0207670_10016637 3300025936 Bacteria 4425
252 Ga0207670_10079643 3300025936 Unclassified 2288
253 Ga0207670_10259918 3300025936 Bacteria 1345
254 Ga0207669_10288724 3300025937 Unclassified 1241
255 Ga0207665_10100760 3300025939 Bacteria 2016
256 Ga0207691_10010563 3300025940 Bacteria 8858
257 Ga0207691_10024498 3300025940 Bacteria 5675
258 Ga0207711_10000215 3300025941 Bacteria 61923
259 Ga0207711_10015354 3300025941 Bacteria 6356
260 Ga0207711_10210926 3300025941 Bacteria 1774
261 Ga0207711_10366120 3300025941 Bacteria 1336
262 Ga0207711_11333202 3300025941 Unclassified 660
263 Ga0207689_10652872 3300025942 Bacteria 886
264 Ga0207689_10721574 3300025942 Bacteria 841
265 Ga0207679_10042685 3300025945 Bacteria 3261
266 Ga0207667_10071101 3300025949 Bacteria 3619
267 Ga0207651_10027857 3300025960 Bacteria 3556
268 Ga0207712_10295445 3300025961 Unclassified 1327
269 Ga0207712_10947924 3300025961 Bacteria 762
270 Ga0207668_12021633 3300025972 Bacteria 519
271 Ga0207658_10015421 3300025986 Bacteria 5242
272 Ga0207658_10030339 3300025986 Bacteria 3827
273 Ga0207677_10085039 3300026023 Bacteria 2282
274 Ga0207677_12133463 3300026023 Unclassified 521
275 Ga0207703_10252762 3300026035 Bacteria 1589
276 Ga0207703_10466466 3300026035 Unclassified 1182
277 Ga0207703_10918994 3300026035 Unclassified 838
278 Ga0207639_12071141 3300026041 Unclassified 530
279 Ga0207708_10368643 3300026075 Unclassified 1182
280 Ga0207641_10001830 3300026088 Bacteria 20469
281 Ga0207641_10011154 3300026088 Bacteria 7371
282 Ga0207641_10673056 3300026088 Bacteria 1018
283 Ga0207641_11312829 3300026088 Unclassified 724
284 Ga0207648_10564077 3300026089 Bacteria 1047
285 Ga0207676_10011452 3300026095 Bacteria 6339
286 Ga0207674_10380041 3300026116 Bacteria 1365
287 Ga0207675_100146032 3300026118 Bacteria 2249
288 Ga0207675_100147115 3300026118 Unclassified 2241
289 Ga0207675_100184940 3300026118 Bacteria 1997
290 Ga0207683_10593314 3300026121 Bacteria 1025
291 Ga0207698_10705102 3300026142 Bacteria 1005
292 Ga0207428_10000004 3300027907 Bacteria 727800
293 Ga0207428_10023911 3300027907 Bacteria 5132
294 Ga0207428_10134207 3300027907 Bacteria 1893
295 Ga0207428_10143090 3300027907 Bacteria 1824
296 Ga0268266_10119105 3300028379 Bacteria 2348
297 Ga0268265_10016453 3300028380 Bacteria 5081
298 Ga0268265_10802660 3300028380 Bacteria 917
299 Ga0268264_10872336 3300028381 Bacteria 902
300 Ga0268264_11536850 3300028381 Unclassified 676
301 Ga0307408_100165054 3300031548 Bacteria 1763
302 Ga0307408_100226864 3300031548 Unclassified 1527
303 Ga0307408_101387073 3300031548 Unclassified 661
304 Ga0307410_11417493 3300031852 Unclassified 610
305 Ga0307409_101698325 3300031995 Unclassified 660
306 Ga0307416_100512461 3300032002 Unclassified 1266
307 Ga0373934_0092656 3300035086 Bacteria 1219
308 Ga0373923_0267472 3300035111 Bacteria 803
309 Ga0373945_0013391 3300035116 Bacteria 2736
310 Ga0373954_0541305 3300035118 Unclassified 577
311 Ga0373956_0077908 3300035119 Bacteria 1518
312 Ga0373956_0424190 3300035119 Bacteria 635
313 Ga0373956_0566823 3300035119 Unclassified 542
314 Ga0373955_0388548 3300035172 Bacteria 847
315 Ga0373924_0343424 3300035410 Unclassified 665
316 Ga0373931_0154043 3300035691 Bacteria 1342
317 Ga0373931_0207993 3300035691 Bacteria 1172
318 Ga0373947_0674083 3300035725 Unclassified 705
319 Ga0373937_0015173 3300036401 Bacteria 6808
320 Ga0373937_0484027 3300036401 Unclassified 1175
321 Ga0373937_0746250 3300036401 Bacteria 926
322 Ga0373937_0922752 3300036401 Unclassified 822
323 Ga0373925_0348706 3300037068 Bacteria 1202
324 Ga0439439_0144644 3300041406 Bacteria 673
325 Ga0439435_0088895 3300042436 Unclassified 936
326 Ga0495592_0085126 3300046454 Bacteria 2280
327 Ga0495651_0228197 3300046462 Bacteria 1284
328 Ga0495580_0097963 3300046472 Bacteria 2040
329 Ga0495582_0023199 3300046473 Bacteria 3394
330 Ga0495582_0266215 3300046473 Unclassified 983
331 Ga0495582_0279436 3300046473 Bacteria 959
332 Ga0495639_0077015 3300046475 Bacteria 1548
333 Ga0495608_0001937 3300046511 Bacteria 14861
334 Ga0495628_0277406 3300046516 Bacteria 1245
335 Ga0495628_0315122 3300046516 Bacteria 1155
336 Ga0495630_0021160 3300046517 Bacteria 4802
337 Ga0495642_0068234 3300046528 Unclassified 1484
338 Ga0495652_0559387 3300046529 Unclassified 785
339 Ga0495586_0073373 3300046535 Bacteria 1872
340 Ga0495587_0550452 3300046536 Bacteria 637
341 Ga0495645_0003425 3300046543 Bacteria 10753
342 Ga0495645_0013372 3300046543 Bacteria 5800
343 Ga0495667_0069667 3300046559 Bacteria 2295
344 Ga0495634_0121407 3300046642 Bacteria 1673
345 Ga0495634_0384380 3300046642 Bacteria 836
346 Ga0495635_0103453 3300046663 Bacteria 1946
347 Ga0495659_0321336 3300046664 Unclassified 657
348 Ga0495647_0119898 3300046681 Bacteria 1106
349 Ga0495658_0010230 3300046683 Bacteria 4690
350 Ga0495658_0031561 3300046683 Bacteria 2887
351 Ga0495658_0211046 3300046683 Bacteria 1213
352 Ga0495658_0211323 3300046683 Bacteria 1212
353 Ga0495613_0002482 3300046689 Bacteria 13918
354 Ga0495613_0084937 3300046689 Bacteria 2298
355 Ga0495613_0402250 3300046689 Bacteria 934
356 Ga0495600_0105193 3300046809 Bacteria 1839
357 Ga0495604_0022207 3300047317 Bacteria 5065
358 Ga0495674_0039990 3300047319 Bacteria 4198
359 Ga0495674_0180727 3300047319 Bacteria 1757
360 Ga0495674_0359158 3300047319 Bacteria 1181
361 Ga0495672_0368647 3300047320 Unclassified 663
362 Ga0495680_0093843 3300047322 Bacteria 2246
363 Ga0495684_0000089 3300047471 Bacteria 64693
364 Ga0495684_0195745 3300047471 Bacteria 1492
365 Ga0496100_0904500 3300048903 Bacteria 693
366 Ga0496101_0035649 3300048904 Bacteria 3520
367 Ga0496102_0640394 3300048905 Bacteria 986
368 Ga0496102_1310665 3300048905 Bacteria 643
369 Ga0496104_0162029 3300048907 Bacteria 2145
370 Ga0496104_0348865 3300048907 Bacteria 1393
371 Ga0496104_1857774 3300048907 Unclassified 504
372 Ga0496105_0056581 3300048908 Bacteria 3237
373 Ga0496105_0528256 3300048908 Bacteria 923
374 Ga0496106_0500420 3300048909 Bacteria 976
375 Ga0496107_0378360 3300048910 Bacteria 1053
376 Ga0496108_0905402 3300048911 Unclassified 757
377 Ga0496109_0118588 3300048912 Bacteria 2464
378 Ga0496110_1490990 3300048913 Unclassified 586
379 Ga0496112_0032153 3300048915 Bacteria 5094
380 Ga0496112_0509297 3300048915 Bacteria 1139
381 Ga0496114_0009122 3300048917 Bacteria 7864
382 Ga0496115_0765155 3300048918 Bacteria 754
383 Ga0501046_0405692 3300049580 Unclassified 984
384 Ga0501083_0127486 3300049744 Bacteria 1668
385 nmdc:mga05p37_12480_c1 3300050507 Bacteria 10145
386 nmdc:mga05p37_157858_c1 3300050507 Bacteria 2771
387 nmdc:mga05p37_171961_c1 3300050507 Bacteria 2642
388 nmdc:mga05p37_33450_c1 3300050507 Bacteria 6296
389 nmdc:mga05p37_423460_c1 3300050507 Bacteria 1549
390 nmdc:mga09592_1476319_c1 3300050508 Unclassified 554
391 nmdc:mga09592_338774_c1 3300050508 Bacteria 1302
392 nmdc:mga09592_344393_c1 3300050508 Bacteria 1290
393 nmdc:mga09592_832406_c1 3300050508 Bacteria 779
394 nmdc:mga06r32_187030_c1 3300050510 Bacteria 2058
395 nmdc:mga06r32_641018_c1 3300050510 Unclassified 1031
396 nmdc:mga08y16_202961_c1 3300050511 Unclassified 2054
397 nmdc:mga08y16_211477_c1 3300050511 Unclassified 2009
398 nmdc:mga08y16_29230_c1 3300050511 Bacteria 5809
399 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
400 nmdc:mga08y16_330206_c1 3300050511 Bacteria 1569
401 nmdc:mga08y16_68356_c1 3300050511 Unclassified 3704
402 nmdc:mga08y16_76165_c1 3300050511 Unclassified 3497
403 nmdc:mga0n895_1044702_c1 3300050512 Bacteria 796
404 nmdc:mga0n895_1077603_c1 3300050512 Bacteria 782
405 nmdc:mga0n895_1309151_c1 3300050512 Bacteria 695
406 nmdc:mga0n895_285429_c1 3300050512 Unclassified 1674
407 nmdc:mga0n895_313554_c1 3300050512 Bacteria 1589
408 nmdc:mga0n895_40062_c1 3300050512 Bacteria 4550
409 nmdc:mga0n895_412550_c1 3300050512 Unclassified 1365
410 nmdc:mga0n895_633600_c1 3300050512 Bacteria 1069
411 nmdc:mga0n895_672972_c1 3300050512 Unclassified 1032
412 nmdc:mga0rr50_1050816_c1 3300050513 Bacteria 693
413 nmdc:mga0rr50_1489000_c1 3300050513 Unclassified 572
414 nmdc:mga0rr50_3659_c1 3300050513 Bacteria 8898
415 nmdc:mga0rr50_7856_c1 3300050513 Bacteria 6615
416 nmdc:mga0rr50_838417_c1 3300050513 Bacteria 784
417 nmdc:mga08x19_16010_c1 3300050514 Bacteria 4569
418 nmdc:mga08x19_223957_c1 3300050514 Bacteria 1293
419 nmdc:mga08x19_446323_c1 3300050514 Bacteria 910
420 nmdc:mga08x19_491173_c1 3300050514 Bacteria 866
421 nmdc:mga08x19_618021_c1 3300050514 Bacteria 768
422 nmdc:mga08x19_62811_c1 3300050514 Bacteria 2409
423 nmdc:mga08x19_693613_c1 3300050514 Unclassified 723
424 nmdc:mga0a205_1164584_c1 3300050515 Bacteria 619
425 nmdc:mga0a205_17782_c1 3300050515 Bacteria 6670
426 nmdc:mga0a205_538389_c1 3300050515 Bacteria 1023
427 nmdc:mga0a205_586716_c1 3300050515 Unclassified 968
428 Ga0495601_0017282 3300053077 Bacteria 4377
429 Ga0495601_0092727 3300053077 Bacteria 1945
430 Ga0495595_0047200 3300053084 Bacteria 1986
431 Ga0495619_0008405 3300053085 Bacteria 6529
432 Ga0495619_0064329 3300053085 Bacteria 2445
433 Ga0495619_0128271 3300053085 Bacteria 1742
434 Ga0495619_0276398 3300053085 Bacteria 1164
435 Ga0587073_0082565 3300059492 Bacteria 801
436 Ga0587088_087524 3300059508 Bacteria 677
437 Ga0501082_1373950 3300060353 Bacteria 617
438 Ga0207695_10049468
439 JGI24746J21847_1040025
440 Ga0065704_10124401
441 Ga0065712_10127962
442 Ga0065715_10056991
443 Ga0065715_10284854
444 Ga0065707_10001538
445 Ga0065707_11075140
446 Ga0070676_11000426
447 Ga0070683_100106528
448 Ga0070670_100011148
449 Ga0070670_101646979
450 Ga0070670_102194347
451 Ga0068869_100369026
452 Ga0070666_10021205
453 Ga0070680_100824372
454 Ga0068868_100158993
455 Ga0068868_100977775
456 Ga0070660_100023242
457 Ga0070689_100010073
458 Ga0070689_100033650
459 Ga0070689_100038441
460 Ga0070687_100332882
461 Ga0070668_100159570
462 Ga0070669_100003011
463 Ga0070669_100592696
464 Ga0070675_100000085
465 Ga0070675_100000532
466 Ga0070675_100096251
467 Ga0070671_100010923
468 Ga0070671_100271312
469 Ga0070671_100697014
470 Ga0070671_101320084
471 Ga0070674_100796281
472 Ga0070673_100023223
473 Ga0070673_100644478
474 Ga0070673_101426180
475 Ga0070688_100011343
476 Ga0070688_100091227
477 Ga0070688_101443886
478 Ga0070659_100486165
479 Ga0070667_100005130
480 Ga0070667_100006517
481 Ga0070714_100004548
482 Ga0070701_10171045
483 Ga0070701_10504036
484 Ga0070705_100185256
485 Ga0070694_100862923
486 Ga0070708_100216344
487 Ga0070678_102282631
488 Ga0070662_100088823
489 Ga0070681_10756018
490 Ga0068867_101353364
491 Ga0070685_10107497
492 Ga0070706_101140822
493 Ga0070707_100138621
494 Ga0070707_100393484
495 Ga0070707_100936339
496 Ga0070698_100163758
497 Ga0070699_100004325
498 Ga0070699_100763906
499 Ga0070699_102178859
500 Ga0070684_100982977
501 Ga0070684_101225504
502 Ga0070697_100624467
503 Ga0070697_101258473
504 Ga0070697_101405599
505 Ga0070672_100004729
506 Ga0070672_100043023
507 Ga0070672_100183743
508 Ga0070686_100300175
509 Ga0070686_100312427
510 Ga0070686_100384150
511 Ga0070665_100006417
512 Ga0070665_100478305
513 Ga0070704_100226380
514 Ga0068855_100101813
515 Ga0070664_100059795
516 Ga0068852_101014112
517 Ga0068859_100019013
518 Ga0068859_100462335
519 Ga0068859_100675948
520 Ga0068859_100941809
521 Ga0068859_100968661
522 Ga0068859_102078070
523 Ga0068864_100007832
524 Ga0068864_100656266
525 Ga0068866_10789091
526 Ga0068863_100000307
527 Ga0068863_100015963
528 Ga0068858_100135719
529 Ga0068858_100197520
530 Ga0068858_100513419
531 Ga0068858_100700847
532 Ga0068858_102249179
533 Ga0068860_100009812
534 Ga0068860_100890235
535 Ga0068862_100012153
536 Ga0068862_100021102
537 Ga0068862_100776173
538 Ga0081455_10119358
539 Ga0070715_10325297
540 Ga0070716_100039940
541 Ga0070716_100088410
542 Ga0070712_100439770
543 Ga0097621_100000059
544 Ga0097621_100036636
545 Ga0097621_100357898
546 Ga0097621_100707514
547 Ga0097621_100974618
548 Ga0068871_100011607
549 Ga0068871_100029599
550 Ga0068871_100115254
551 Ga0068871_101334201
552 Ga0075428_100000017
553 Ga0075428_100142024
554 Ga0075428_100147610
555 Ga0075428_100256700
556 Ga0075428_100386307
557 Ga0075428_100452947
558 Ga0075428_100773398
559 Ga0075428_100805648
560 Ga0075428_101450266
561 Ga0075428_101836708
562 Ga0075430_100347598
563 Ga0075431_100280762
564 Ga0075431_101090992
565 Ga0075433_10056791
566 Ga0075433_10106650
567 Ga0075433_10279768
568 Ga0075433_10340933
569 Ga0075433_10984218
570 Ga0075433_11253207
571 Ga0075434_100094558
572 Ga0075434_100395008
573 Ga0075434_100505766
574 Ga0075434_100702643
575 Ga0075434_100760244
576 Ga0075434_100765465
577 Ga0075434_101250453
578 Ga0075434_101391703
579 Ga0075434_101631601
580 Ga0075429_100415735
581 Ga0075429_101294705
582 Ga0068865_100273480
583 Ga0068865_100386351
584 Ga0068865_100398929
585 Ga0068865_100512009
586 Ga0075436_100003700
587 Ga0075436_100241397
588 Ga0097620_100019012
589 Ga0097620_100462359
590 Ga0097620_100676043
591 Ga0097620_100941721
592 Ga0097620_100968678
593 Ga0097620_102078366
594 Ga0075435_100024243
595 Ga0075435_100025534
596 Ga0075435_100264942
597 Ga0075435_101287947
598 Ga0105240_10035379
599 Ga0105240_10872143
600 Ga0111539_10000002
601 Ga0111539_10005979
602 Ga0111539_10024149
603 Ga0111539_10035398
604 Ga0111539_10097040
605 Ga0111539_10911293
606 Ga0105245_10158466
607 Ga0105245_10452928
608 Ga0105245_10981999
609 Ga0105245_12094354
610 Ga0105247_10235688
611 Ga0114129_10000422
612 Ga0114129_10003694
613 Ga0114129_10122425
614 Ga0114129_10194845
615 Ga0114129_10385086
616 Ga0114129_11409416
617 Ga0105243_10365075
618 Ga0105242_10027394
619 Ga0105242_10175445
620 Ga0105242_10343982
621 Ga0105242_10484343
622 Ga0105248_10000090
623 Ga0105248_10038339
624 Ga0105248_11140270
625 Ga0105248_11254428
626 Ga0105248_12242702
627 Ga0105238_10729708
628 Ga0105249_10007386
629 Ga0105249_10272389
630 Ga0105249_11573980
631 Ga0105239_10384607
632 Ga0105246_10999038
633 Ga0105246_12034751
634 Ga0157374_10056472
635 Ga0157374_10972002
636 Ga0157378_10240410
637 Ga0157378_12644714
638 Ga0163162_10011715
639 Ga0163162_10077873
640 Ga0163162_10557967
641 Ga0157375_10001258
642 Ga0163163_10003750
643 Ga0163163_10746089
644 Ga0163163_10925150
645 Ga0163163_11620940
646 Ga0157380_10144919
647 Ga0157380_11096835
648 Ga0157380_11377588
649 Ga0157377_10015349
650 Ga0157377_10410064
651 Ga0157377_10451870
652 Ga0157379_10001144
653 Ga0157379_10013254
654 Ga0157379_10390412
655 Ga0157376_10066059
656 Ga0157376_10098451
657 Ga0157376_10343457
658 Ga0157376_10914019
659 Ga0157376_11074410
660 Ga0207682_10051109
661 Ga0207642_10429388
662 Ga0207710_10012611
663 Ga0207685_10214471
664 Ga0207684_10871872
665 Ga0207662_10459774
666 Ga0207662_10485613
667 Ga0207657_10009251
668 Ga0207646_10172360
669 Ga0207681_10008966
670 Ga0207681_11040059
671 Ga0207650_10135183
672 Ga0207650_10961191
673 Ga0207650_11330167
674 Ga0207659_10000112
675 Ga0207659_10000666
676 Ga0207659_10073066
677 Ga0207659_10244580
678 Ga0207687_10162784
679 Ga0207687_10833791
680 Ga0207687_11222324
681 Ga0207700_11245983
682 Ga0207644_10006755
683 Ga0207644_10296970
684 Ga0207690_10193134
685 Ga0207686_10026561
686 Ga0207686_10032927
687 Ga0207686_10452475
688 Ga0207670_10016637
689 Ga0207670_10079643
690 Ga0207670_10259918
691 Ga0207669_10288724
692 Ga0207665_10100760
693 Ga0207691_10010563
694 Ga0207691_10024498
695 Ga0207711_10000215
696 Ga0207711_10015354
697 Ga0207711_10210926
698 Ga0207711_10366120
699 Ga0207711_11333202
700 Ga0207689_10652872
701 Ga0207689_10721574
702 Ga0207679_10042685
703 Ga0207667_10071101
704 Ga0207651_10027857
705 Ga0207712_10295445
706 Ga0207712_10947924
707 Ga0207668_12021633
708 Ga0207658_10015421
709 Ga0207658_10030339
710 Ga0207677_10085039
711 Ga0207677_12133463
712 Ga0207703_10252762
713 Ga0207703_10466466
714 Ga0207703_10918994
715 Ga0207639_12071141
716 Ga0207708_10368643
717 Ga0207641_10001830
718 Ga0207641_10011154
719 Ga0207641_10673056
720 Ga0207641_11312829
721 Ga0207648_10564077
722 Ga0207676_10011452
723 Ga0207674_10380041
724 Ga0207675_100146032
725 Ga0207675_100147115
726 Ga0207675_100184940
727 Ga0207683_10593314
728 Ga0207698_10705102
729 Ga0207428_10000004
730 Ga0207428_10023911
731 Ga0207428_10134207
732 Ga0207428_10143090
733 Ga0268266_10119105
734 Ga0268265_10016453
735 Ga0268265_10802660
736 Ga0268264_10872336
737 Ga0268264_11536850
738 Ga0307408_100165054
739 Ga0307408_100226864
740 Ga0307408_101387073
741 Ga0307410_11417493
742 Ga0307409_101698325
743 Ga0307416_100512461
744 Ga0373934_0092656
745 Ga0373923_0267472
746 Ga0373945_0013391
747 Ga0373954_0541305
748 Ga0373956_0077908
749 Ga0373956_0424190
750 Ga0373956_0566823
751 Ga0373955_0388548
752 Ga0373924_0343424
753 Ga0373931_0154043
754 Ga0373931_0207993
755 Ga0373947_0674083
756 Ga0373937_0015173
757 Ga0373937_0484027
758 Ga0373937_0746250
759 Ga0373937_0922752
760 Ga0373925_0348706
761 Ga0439439_0144644
762 Ga0439435_0088895
763 Ga0495592_0085126
764 Ga0495651_0228197
765 Ga0495580_0097963
766 Ga0495582_0023199
767 Ga0495582_0266215
768 Ga0495582_0279436
769 Ga0495639_0077015
770 Ga0495608_0001937
771 Ga0495628_0277406
772 Ga0495628_0315122
773 Ga0495630_0021160
774 Ga0495642_0068234
775 Ga0495652_0559387
776 Ga0495586_0073373
777 Ga0495587_0550452
778 Ga0495645_0003425
779 Ga0495645_0013372
780 Ga0495667_0069667
781 Ga0495634_0121407
782 Ga0495634_0384380
783 Ga0495635_0103453
784 Ga0495659_0321336
785 Ga0495647_0119898
786 Ga0495658_0010230
787 Ga0495658_0031561
788 Ga0495658_0211046
789 Ga0495658_0211323
790 Ga0495613_0002482
791 Ga0495613_0084937
792 Ga0495613_0402250
793 Ga0495600_0105193
794 Ga0495604_0022207
795 Ga0495674_0039990
796 Ga0495674_0180727
797 Ga0495674_0359158
798 Ga0495672_0368647
799 Ga0495680_0093843
800 Ga0495684_0000089
801 Ga0495684_0195745
802 Ga0496100_0904500
803 Ga0496101_0035649
804 Ga0496102_0640394
805 Ga0496102_1310665
806 Ga0496104_0162029
807 Ga0496104_0348865
808 Ga0496104_1857774
809 Ga0496105_0056581
810 Ga0496105_0528256
811 Ga0496106_0500420
812 Ga0496107_0378360
813 Ga0496108_0905402
814 Ga0496109_0118588
815 Ga0496110_1490990
816 Ga0496112_0032153
817 Ga0496112_0509297
818 Ga0496114_0009122
819 Ga0496115_0765155
820 Ga0501046_0405692
821 Ga0501083_0127486
822 nmdc:mga05p37_12480_c1
823 nmdc:mga05p37_157858_c1
824 nmdc:mga05p37_171961_c1
825 nmdc:mga05p37_33450_c1
826 nmdc:mga05p37_423460_c1
827 nmdc:mga09592_1476319_c1
828 nmdc:mga09592_338774_c1
829 nmdc:mga09592_344393_c1
830 nmdc:mga09592_832406_c1
831 nmdc:mga06r32_187030_c1
832 nmdc:mga06r32_641018_c1
833 nmdc:mga08y16_202961_c1
834 nmdc:mga08y16_211477_c1
835 nmdc:mga08y16_29230_c1
836 nmdc:mga08y16_2_c1
837 nmdc:mga08y16_330206_c1
838 nmdc:mga08y16_68356_c1
839 nmdc:mga08y16_76165_c1
840 nmdc:mga0n895_1044702_c1
841 nmdc:mga0n895_1077603_c1
842 nmdc:mga0n895_1309151_c1
843 nmdc:mga0n895_285429_c1
844 nmdc:mga0n895_313554_c1
845 nmdc:mga0n895_40062_c1
846 nmdc:mga0n895_412550_c1
847 nmdc:mga0n895_633600_c1
848 nmdc:mga0n895_672972_c1
849 nmdc:mga0rr50_1050816_c1
850 nmdc:mga0rr50_1489000_c1
851 nmdc:mga0rr50_3659_c1
852 nmdc:mga0rr50_7856_c1
853 nmdc:mga0rr50_838417_c1
854 nmdc:mga08x19_16010_c1
855 nmdc:mga08x19_223957_c1
856 nmdc:mga08x19_446323_c1
857 nmdc:mga08x19_491173_c1
858 nmdc:mga08x19_618021_c1
859 nmdc:mga08x19_62811_c1
860 nmdc:mga08x19_693613_c1
861 nmdc:mga0a205_1164584_c1
862 nmdc:mga0a205_17782_c1
863 nmdc:mga0a205_538389_c1
864 nmdc:mga0a205_586716_c1
865 Ga0495601_0017282
866 Ga0495601_0092727
867 Ga0495595_0047200
868 Ga0495619_0008405
869 Ga0495619_0064329
870 Ga0495619_0128271
871 Ga0495619_0276398
872 Ga0587073_0082565
873 Ga0587088_087524
874 Ga0501082_1373950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.669 1 80
4njc-assembly6.cif.gz_F rna polymerase interacting protein ykzg from geobacillus stearothermophilus 0.5924 43 81
3mah-assembly1.cif.gz_A-2 a putative c-terminal regulatory domain of aspartate kinase from porphyromonas gingivalis w83. 0.5921 2 80
6vz8-assembly1.cif.gz_R arabidopsis thaliana acetohydroxyacid synthase complex with valine bound 0.5517 2 79
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.5487 1 81
ID Description Score Start End Superfamily
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7172 1 80 3.30.70.920
af_Q2FZG8_1_59_3.10.20.730 Alpha Beta;Roll;Ubiquitin-like (UB roll);RNAP, epsilon subunit-like 0.5885 2 80 3.10.20.730
3mahA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5707 3 81 3.30.70.260
3mahA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5599 3 81 3.30.70.260
2cfxA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.5587 1 80 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A838R4X8-F1-model_v4 Uncharacterized protein 0.9945 1 85
AF-A0A2V5QN83-F1-model_v4 Uncharacterized protein 0.9859 1 78
AF-A0A838R4X8-F1-model_v4 Uncharacterized protein 0.983 1 85
AF-A0A2V7XBP1-F1-model_v4 Uncharacterized protein 0.9173 1 119
AF-A0A2V5J9B4-F1-model_v4 Uncharacterized protein 0.9167 2 119

Map