F443553

General Info

Members Datasets Scaffolds Average Seq Length
436 226 433 221

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10000147|Ga0163163_1000014716
Length 249
Sequence VLEAAISSYAAGDDRCFFLLSPLWRANSSPMKKYVAEALGTFALVFVGTGAIVINEVSGGVITHPGIALTFGLIVLAMIYTVGDISGAHLNPAVTIGFWTARRLPGSQVGSYILSQVVGAIIASGLLKLLFPHSKLLGATLPAGSELQSFVLELVLTFLLMLTILNVSTGAKEKGITAGIAVGAVIALEAMFAGPICGASMNPARSFAPALISSHLEHLWLYLIAPPLGAAAAMFACRCIREPNCCGKS

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
3 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
170 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.23
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 3.44
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1000398 3300002126 Bacteria 4083
2 JGI25151J46595_10026839 3300003187 Bacteria 2317
3 rootH2_10001201 3300003320 Bacteria 26611
4 rootH2_10010808 3300003320 Bacteria 73638
5 rootH2_10106787 3300003320 Bacteria 9047
6 rootH2_10311952 3300003320 Unclassified 1486
7 rootH1_10020455 3300003316 Bacteria 7263
8 rootH1_10020455 3300003323 Bacteria 13860
9 rootH1_10191129 3300003323 Bacteria 8180
10 Ga0065704_10168857 3300005289 Bacteria 1304
11 Ga0065704_10231544 3300005289 Unclassified 1041
12 Ga0065712_10071040 3300005290 Bacteria 5522
13 Ga0065715_10090742 3300005293 Bacteria 6527
14 Ga0070658_10000638 3300005327 Bacteria 30268
15 Ga0070658_10402382 3300005327 Bacteria 1176
16 Ga0070658_10425122 3300005327 Unclassified 1143
17 Ga0070676_10109758 3300005328 Unclassified 1716
18 Ga0070683_100024861 3300005329 Bacteria 5371
19 Ga0070683_100439817 3300005329 Unclassified 1244
20 Ga0070670_100049990 3300005331 Bacteria 3593
21 Ga0070670_100219823 3300005331 Unclassified 1652
22 Ga0070670_100243352 3300005331 Unclassified 1566
23 Ga0070670_100249975 3300005331 Unclassified 1545
24 Ga0068869_100082668 3300005334 Bacteria 2400
25 Ga0068869_100189394 3300005334 Bacteria 1617
26 Ga0068868_100024770 3300005338 Unclassified 4555
27 Ga0068868_100036049 3300005338 Bacteria 3826
28 Ga0070660_100095622 3300005339 Unclassified 2348
29 Ga0070660_100391477 3300005339 Bacteria 1148
30 Ga0070689_100014132 3300005340 Bacteria 5793
31 Ga0070689_100016487 3300005340 Bacteria 5407
32 Ga0070689_100122656 3300005340 Bacteria 2076
33 Ga0070689_100207276 3300005340 Bacteria 1603
34 Ga0070687_100001234 3300005343 Bacteria 8875
35 Ga0070675_100023517 3300005354 Unclassified 4929
36 Ga0070675_100069337 3300005354 Bacteria 2921
37 Ga0070671_100014386 3300005355 Bacteria 6393
38 Ga0070671_100544309 3300005355 Bacteria 1001
39 Ga0070674_100197163 3300005356 Bacteria 1552
40 Ga0070673_100000522 3300005364 Bacteria 20614
41 Ga0070673_100003661 3300005364 Bacteria 9619
42 Ga0070673_100013678 3300005364 Bacteria 5624
43 Ga0070688_100004708 3300005365 Bacteria 7126
44 Ga0070688_100064086 3300005365 Unclassified 2331
45 Ga0070659_100004328 3300005366 Bacteria 10138
46 Ga0070659_100015210 3300005366 Bacteria 5758
47 Ga0070659_100386613 3300005366 Bacteria 1179
48 Ga0070667_100138289 3300005367 Unclassified 2131
49 Ga0070667_100419067 3300005367 Bacteria 1220
50 Ga0070714_100101261 3300005435 Unclassified 2538
51 Ga0070713_100927830 3300005436 Bacteria 838
52 Ga0070701_10082223 3300005438 Unclassified 1746
53 Ga0070705_100033585 3300005440 Unclassified 2861
54 Ga0070694_100014482 3300005444 Bacteria 4937
55 Ga0070708_100699554 3300005445 Unclassified 954
56 Ga0070663_100148378 3300005455 Bacteria 1796
57 Ga0070678_100001380 3300005456 Bacteria 12941
58 Ga0070678_100004497 3300005456 Bacteria 7914
59 Ga0070662_100066917 3300005457 Bacteria 2637
60 Ga0068867_100001584 3300005459 Bacteria 15824
61 Ga0070685_10037249 3300005466 Unclassified 2754
62 Ga0070685_10042231 3300005466 Bacteria 2601
63 Ga0070706_100001327 3300005467 Bacteria 26298
64 Ga0070706_100057064 3300005467 Bacteria 3602
65 Ga0070707_100270750 3300005468 Bacteria 1651
66 Ga0070707_100305952 3300005468 Bacteria 1545
67 Ga0070699_100129167 3300005518 Bacteria 2227
68 Ga0070679_100000364 3300005530 Bacteria 38564
69 Ga0070679_100540075 3300005530 Unclassified 1109
70 Ga0070684_100000223 3300005535 Bacteria 39444
71 Ga0068853_100000051 3300005539 Bacteria 86702
72 Ga0068853_100001879 3300005539 Bacteria 15464
73 Ga0068853_100034101 3300005539 Bacteria 4319
74 Ga0068853_100120837 3300005539 Bacteria 2336
75 Ga0070672_100241688 3300005543 Bacteria 1519
76 Ga0070672_100835765 3300005543 Unclassified 811
77 Ga0070665_100000034 3300005548 Bacteria 324289
78 Ga0070665_100013014 3300005548 Bacteria 8379
79 Ga0070665_100204403 3300005548 Unclassified 1975
80 Ga0070704_100360229 3300005549 Unclassified 1230
81 Ga0070704_100482024 3300005549 Bacteria 1073
82 Ga0068855_100000226 3300005563 Bacteria 72130
83 Ga0068855_100018699 3300005563 Bacteria 8332
84 Ga0070664_100065678 3300005564 Bacteria 3097
85 Ga0068857_100084226 3300005577 Bacteria 2841
86 Ga0068857_100553393 3300005577 Bacteria 1084
87 Ga0070702_100133818 3300005615 Bacteria 1570
88 Ga0068852_100000630 3300005616 Bacteria 23035
89 Ga0068852_100398113 3300005616 Bacteria 1354
90 Ga0068859_100024859 3300005617 Bacteria 6012
91 Ga0068859_100316368 3300005617 Bacteria 1655
92 Ga0068859_100378600 3300005617 Bacteria 1511
93 Ga0068866_10046605 3300005718 Bacteria 2181
94 Ga0068861_100088418 3300005719 Unclassified 2440
95 Ga0068870_10095189 3300005840 Bacteria 1672
96 Ga0068858_100121441 3300005842 Unclassified 2443
97 Ga0068860_100044707 3300005843 Unclassified 4221
98 Ga0068860_100051825 3300005843 Bacteria 3904
99 Ga0068860_100113262 3300005843 Unclassified 2594
100 Ga0068860_100253188 3300005843 Unclassified 1715
101 Ga0068860_100434699 3300005843 Bacteria 1303
102 Ga0068860_100698292 3300005843 Bacteria 1024
103 Ga0068862_100122788 3300005844 Bacteria 2291
104 Ga0075366_10259904 3300006195 Unclassified 1060
105 Ga0097621_100000343 3300006237 Bacteria 31907
106 Ga0097621_100120151 3300006237 Bacteria 2228
107 Ga0097621_100719773 3300006237 Unclassified 920
108 Ga0097621_100867155 3300006237 Unclassified 839
109 Ga0068871_100000284 3300006358 Bacteria 35264
110 Ga0068871_100167243 3300006358 Unclassified 1883
111 Ga0068871_100265367 3300006358 Bacteria 1499
112 Ga0075434_100374231 3300006871 Unclassified 1445
113 Ga0068865_100000029 3300006881 Bacteria 91199
114 Ga0068865_100042365 3300006881 Bacteria 3104
115 Ga0097620_100024859 3300006931 Bacteria 6012
116 Ga0097620_100316366 3300006931 Bacteria 1655
117 Ga0097620_100378561 3300006931 Bacteria 1511
118 Ga0105240_10000124 3300009093 Bacteria 160617
119 Ga0105240_10000833 3300009093 Bacteria 55556
120 Ga0105240_10002040 3300009093 Bacteria 33263
121 Ga0111539_10071199 3300009094 Bacteria 4103
122 Ga0111539_10241787 3300009094 Bacteria 2102
123 Ga0111539_10583417 3300009094 Bacteria 1302
124 Ga0105241_10003988 3300009174 Bacteria 10911
125 Ga0105241_10075270 3300009174 Unclassified 2631
126 Ga0105242_10029644 3300009176 Bacteria 4364
127 Ga0105242_10298377 3300009176 Unclassified 1470
128 Ga0105242_10309635 3300009176 Unclassified 1444
129 Ga0105242_10943251 3300009176 Bacteria 866
130 Ga0105248_10438155 3300009177 Bacteria 1472
131 Ga0105248_11086724 3300009177 Unclassified 904
132 Ga0105237_10001073 3300009545 Bacteria 36751
133 Ga0105237_10002503 3300009545 Bacteria 22768
134 Ga0105237_10026390 3300009545 Bacteria 5937
135 Ga0105237_10219385 3300009545 Bacteria 1902
136 Ga0105237_10589995 3300009545 Bacteria 1118
137 Ga0105237_10795373 3300009545 Bacteria 953
138 Ga0105237_10931203 3300009545 Unclassified 876
139 Ga0105238_10000370 3300009551 Bacteria 48257
140 Ga0105238_10004453 3300009551 Bacteria 13887
141 Ga0105238_10036985 3300009551 Bacteria 4963
142 Ga0105238_10551337 3300009551 Bacteria 1157
143 Ga0105249_10001429 3300009553 Bacteria 20930
144 Ga0105249_10004437 3300009553 Bacteria 12144
145 Ga0105249_10069678 3300009553 Bacteria 3246
146 Ga0105249_10250547 3300009553 Unclassified 1756
147 Ga0105249_10389937 3300009553 Bacteria 1421
148 Ga0099796_10000695 3300010159 Bacteria 5936
149 Ga0105239_10000267 3300010375 Bacteria 77181
150 Ga0105239_10059026 3300010375 Bacteria 4211
151 Ga0105239_10086116 3300010375 Bacteria 3463
152 Ga0105239_10131433 3300010375 Bacteria 2785
153 Ga0105239_10138156 3300010375 Bacteria 2714
154 Ga0105239_10217394 3300010375 Bacteria 2143
155 Ga0105239_10347224 3300010375 Bacteria 1675
156 Ga0105239_11747898 3300010375 Unclassified 720
157 Ga0105246_10006214 3300011119 Bacteria 7291
158 Ga0105246_10324362 3300011119 Bacteria 1253
159 Ga0157371_10412693 3300013102 Unclassified 989
160 Ga0157374_10000003 3300013296 Bacteria 854471
161 Ga0157374_10000857 3300013296 Bacteria 26620
162 Ga0157374_10010119 3300013296 Bacteria 8101
163 Ga0157374_10060241 3300013296 Bacteria 3552
164 Ga0157374_10063199 3300013296 Bacteria 3472
165 Ga0157374_10065370 3300013296 Bacteria 3415
166 Ga0157374_10084384 3300013296 Bacteria 3019
167 Ga0157374_10145831 3300013296 Bacteria 2299
168 Ga0157374_10254637 3300013296 Unclassified 1728
169 Ga0157374_10914580 3300013296 Bacteria 895
170 Ga0157378_10015320 3300013297 Bacteria 6715
171 Ga0157378_10039669 3300013297 Unclassified 4177
172 Ga0157378_10057339 3300013297 Bacteria 3471
173 Ga0157378_10092032 3300013297 Bacteria 2758
174 Ga0157378_10210192 3300013297 Bacteria 1845
175 Ga0157378_10798415 3300013297 Unclassified 969
176 Ga0163162_10000018 3300013306 Bacteria 226257
177 Ga0163162_10003165 3300013306 Bacteria 15731
178 Ga0163162_10023979 3300013306 Bacteria 6020
179 Ga0163162_10041824 3300013306 Bacteria 4585
180 Ga0163162_10077903 3300013306 Bacteria 3379
181 Ga0163162_10153692 3300013306 Bacteria 2420
182 Ga0163162_11143744 3300013306 Bacteria 883
183 Ga0157372_10114845 3300013307 Unclassified 3087
184 Ga0157372_10185070 3300013307 Unclassified 2412
185 Ga0157372_10206811 3300013307 Bacteria 2274
186 Ga0157372_10675921 3300013307 Bacteria 1202
187 Ga0157375_10016838 3300013308 Bacteria 6580
188 Ga0157375_10019874 3300013308 Bacteria 6122
189 Ga0157375_10059791 3300013308 Bacteria 3777
190 Ga0157375_10084628 3300013308 Bacteria 3221
191 Ga0157375_10092883 3300013308 Bacteria 3082
192 Ga0157375_10104445 3300013308 Bacteria 2922
193 Ga0157375_10668970 3300013308 Bacteria 1193
194 Ga0163163_10000147 3300014325 Bacteria 73154
195 Ga0163163_10045101 3300014325 Unclassified 4327
196 Ga0163163_10082788 3300014325 Bacteria 3213
197 Ga0163163_10086611 3300014325 Bacteria 3142
198 Ga0163163_10133480 3300014325 Bacteria 2523
199 Ga0163163_11079925 3300014325 Bacteria 866
200 Ga0157377_10008054 3300014745 Bacteria 5125
201 Ga0157377_10108724 3300014745 Bacteria 1664
202 Ga0157379_10223741 3300014968 Unclassified 1705
203 Ga0157379_10536679 3300014968 Bacteria 1087
204 Ga0157376_10000580 3300014969 Bacteria 23607
205 Ga0157376_10025087 3300014969 Bacteria 4692
206 Ga0213872_10044258 3300021361 Bacteria 2026
207 Ga0207666_1000215 3300025271 Bacteria 8575
208 Ga0207666_1006832 3300025271 Bacteria 1488
209 Ga0207673_1000151 3300025290 Bacteria 6812
210 Ga0207673_1000243 3300025290 Bacteria 5554
211 Ga0209025_1004106 3300025294 Bacteria 12960
212 Ga0207697_10000377 3300025315 Bacteria 24951
213 Ga0207697_10000729 3300025315 Bacteria 18691
214 Ga0207697_10001324 3300025315 Bacteria 13631
215 Ga0207682_10038307 3300025893 Unclassified 1945
216 Ga0207688_10030184 3300025901 Bacteria 2989
217 Ga0207688_10175056 3300025901 Bacteria 1277
218 Ga0207647_10030443 3300025904 Bacteria 3481
219 Ga0207645_10000666 3300025907 Bacteria 28512
220 Ga0207645_10000723 3300025907 Bacteria 27486
221 Ga0207645_10005267 3300025907 Bacteria 9416
222 Ga0207645_10051938 3300025907 Unclassified 2619
223 Ga0207645_10086785 3300025907 Bacteria 2010
224 Ga0207643_10005470 3300025908 Bacteria 6792
225 Ga0207705_10005178 3300025909 Bacteria 9777
226 Ga0207684_10001353 3300025910 Bacteria 26848
227 Ga0207654_10108546 3300025911 Bacteria 1722
228 Ga0207695_10000022 3300025913 Bacteria 659090
229 Ga0207695_10000184 3300025913 Bacteria 181201
230 Ga0207695_10003830 3300025913 Bacteria 20850
231 Ga0207671_10001942 3300025914 Bacteria 22821
232 Ga0207671_10255067 3300025914 Bacteria 1379
233 Ga0207671_10272649 3300025914 Unclassified 1333
234 Ga0207693_10150398 3300025915 Bacteria 1831
235 Ga0207663_10185616 3300025916 Unclassified 1489
236 Ga0207662_10000497 3300025918 Bacteria 17604
237 Ga0207657_10116212 3300025919 Bacteria 2205
238 Ga0207652_10000027 3300025921 Bacteria 151000
239 Ga0207652_10488726 3300025921 Unclassified 1109
240 Ga0207646_10115872 3300025922 Unclassified 2407
241 Ga0207646_10235888 3300025922 Bacteria 1653
242 Ga0207681_10001007 3300025923 Bacteria 18378
243 Ga0207681_10018475 3300025923 Bacteria 4392
244 Ga0207694_10008521 3300025924 Bacteria 7743
245 Ga0207694_10011709 3300025924 Bacteria 6617
246 Ga0207650_10303769 3300025925 Unclassified 1304
247 Ga0207659_10013188 3300025926 Bacteria 5287
248 Ga0207659_10024863 3300025926 Bacteria 4020
249 Ga0207659_10117252 3300025926 Bacteria 2034
250 Ga0207659_10261988 3300025926 Bacteria 1407
251 Ga0207644_10010864 3300025931 Bacteria 6011
252 Ga0207690_10006875 3300025932 Bacteria 6749
253 Ga0207690_10043886 3300025932 Unclassified 2945
254 Ga0207706_10330159 3300025933 Unclassified 1327
255 Ga0207686_10015819 3300025934 Bacteria 4227
256 Ga0207686_10044334 3300025934 Bacteria 2730
257 Ga0207670_10004434 3300025936 Bacteria 7561
258 Ga0207670_10005486 3300025936 Bacteria 6968
259 Ga0207670_10019379 3300025936 Bacteria 4155
260 Ga0207670_10085030 3300025936 Bacteria 2222
261 Ga0207669_10050178 3300025937 Bacteria 2492
262 Ga0207704_10000035 3300025938 Bacteria 96154
263 Ga0207704_10030316 3300025938 Bacteria 3031
264 Ga0207691_10073276 3300025940 Unclassified 3088
265 Ga0207691_10237868 3300025940 Bacteria 1575
266 Ga0207711_10652958 3300025941 Unclassified 981
267 Ga0207689_10002983 3300025942 Bacteria 15619
268 Ga0207689_10317207 3300025942 Unclassified 1293
269 Ga0207661_10430108 3300025944 Unclassified 1200
270 Ga0207661_10955274 3300025944 Unclassified 789
271 Ga0207679_10060132 3300025945 Bacteria 2822
272 Ga0207667_10000039 3300025949 Bacteria 278843
273 Ga0207667_10257620 3300025949 Unclassified 1784
274 Ga0207651_10020332 3300025960 Bacteria 4005
275 Ga0207712_10005716 3300025961 Bacteria 7838
276 Ga0207712_10052693 3300025961 Bacteria 2851
277 Ga0207712_10176033 3300025961 Unclassified 1676
278 Ga0207668_10018086 3300025972 Bacteria 4428
279 Ga0207640_10247870 3300025981 Bacteria 1380
280 Ga0207658_10020987 3300025986 Bacteria 4528
281 Ga0207658_10081257 3300025986 Unclassified 2485
282 Ga0207658_10816509 3300025986 Unclassified 847
283 Ga0207677_10028067 3300026023 Unclassified 3555
284 Ga0207677_10042281 3300026023 Bacteria 3021
285 Ga0207677_10087257 3300026023 Bacteria 2258
286 Ga0207703_10007514 3300026035 Bacteria 8650
287 Ga0207703_10063339 3300026035 Bacteria 3032
288 Ga0207639_10000077 3300026041 Bacteria 86758
289 Ga0207639_10011515 3300026041 Bacteria 6144
290 Ga0207639_10032372 3300026041 Bacteria 3849
291 Ga0207639_10218361 3300026041 Bacteria 1645
292 Ga0207639_10942331 3300026041 Bacteria 808
293 Ga0207678_10717357 3300026067 Unclassified 881
294 Ga0207648_10000733 3300026089 Bacteria 36780
295 Ga0207648_10001434 3300026089 Bacteria 26245
296 Ga0207676_10063168 3300026095 Bacteria 2940
297 Ga0207674_10126499 3300026116 Bacteria 2521
298 Ga0207675_100016560 3300026118 Bacteria 6884
299 Ga0207683_10001858 3300026121 Bacteria 18672
300 Ga0207683_10010048 3300026121 Bacteria 8076
301 Ga0207698_10027876 3300026142 Bacteria 4018
302 Ga0207698_10282831 3300026142 Bacteria 1535
303 Ga0268266_10000119 3300028379 Bacteria 162424
304 Ga0268266_10016251 3300028379 Bacteria 6362
305 Ga0268266_10113276 3300028379 Unclassified 2405
306 Ga0268265_10059158 3300028380 Unclassified 2930
307 Ga0268264_10026582 3300028381 Bacteria 4730
308 Ga0268264_10031864 3300028381 Bacteria 4324
309 Ga0268264_10034453 3300028381 Bacteria 4165
310 Ga0268264_10063985 3300028381 Unclassified 3095
311 Ga0268264_10602231 3300028381 Bacteria 1083
312 Ga0307517_10013164 3300028786 Bacteria 11264
313 Ga0265338_10019102 3300028800 Bacteria 7294
314 Ga0265338_10028357 3300028800 Bacteria 5586
315 Ga0265338_10204645 3300028800 Bacteria 1486
316 Ga0265332_10023254 3300031238 Unclassified 2733
317 Ga0265320_10005032 3300031240 Bacteria 8561
318 Ga0265325_10000429 3300031241 Bacteria 30125
319 Ga0265339_10000805 3300031249 Bacteria 24215
320 Ga0265331_10000286 3300031250 Bacteria 56012
321 Ga0265331_10088469 3300031250 Bacteria 1433
322 Ga0265327_10002101 3300031251 Bacteria 22168
323 Ga0265327_10011076 3300031251 Bacteria 6258
324 Ga0307408_100000031 3300031548 Bacteria 214210
325 Ga0265313_10000845 3300031595 Bacteria 30854
326 Ga0265314_10000082 3300031711 Bacteria 143717
327 Ga0265314_10037840 3300031711 Bacteria 3492
328 Ga0265314_10071867 3300031711 Bacteria 2313
329 Ga0265342_10004421 3300031712 Bacteria 11084
330 Ga0265342_10104906 3300031712 Bacteria 1606
331 Ga0307407_10008359 3300031903 Unclassified 4744
332 Ga0307415_100853546 3300032126 Bacteria 836
333 Ga0307510_10005630 3300033180 Bacteria 14934
334 Ga0373943_0352518 3300035170 Unclassified 844
335 Ga0373955_0229501 3300035172 Bacteria 1110
336 Ga0373935_0620543 3300035692 Unclassified 792
337 Ga0373937_0205846 3300036401 Bacteria 1850
338 Ga0395899_0000751 3300037312 Bacteria 32145
339 Ga0395899_0017894 3300037312 Bacteria 5394
340 Ga0395899_0165851 3300037312 Bacteria 1558
341 Ga0395900_0000153 3300037418 Bacteria 115432
342 Ga0395900_0004510 3300037418 Bacteria 14733
343 Ga0395900_0188274 3300037418 Bacteria 2094
344 Ga0395898_0239758 3300037466 Bacteria 1729
345 Ga0395905_0000752 3300037471 Bacteria 42735
346 Ga0395905_0003545 3300037471 Bacteria 16635
347 Ga0395905_0043163 3300037471 Bacteria 4231
348 Ga0395905_0110457 3300037471 Bacteria 2582
349 Ga0395905_0261763 3300037471 Bacteria 1615
350 Ga0395905_0581768 3300037471 Bacteria 1021
351 Ga0436364_0768674 3300037853 Bacteria 1126
352 Ga0395901_0000330 3300038443 Bacteria 58380
353 Ga0395901_0014493 3300038443 Bacteria 8019
354 Ga0395901_0124460 3300038443 Bacteria 2709
355 Ga0395901_0178249 3300038443 Bacteria 2229
356 Ga0395901_0269895 3300038443 Unclassified 1770
357 Ga0436361_0672383 3300039447 Bacteria 9246
358 Ga0439431_0015152 3300041997 Bacteria 1793
359 Ga0450891_002469 3300042129 Bacteria 1863
360 Ga0450893_0006815 3300042532 Bacteria 1849
361 Ga0451576_0148197 3300045051 Bacteria 2447
362 Ga0451576_0151039 3300045051 Bacteria 2423
363 Ga0451576_0511594 3300045051 Bacteria 1261
364 Ga0451576_0570339 3300045051 Unclassified 1189
365 Ga0495592_0000054 3300046454 Bacteria 107373
366 Ga0495580_0349935 3300046472 Bacteria 1001
367 Ga0495639_0022662 3300046475 Bacteria 2756
368 Ga0495639_0139942 3300046475 Bacteria 1163
369 Ga0495662_0031675 3300046476 Bacteria 2554
370 Ga0495664_0008267 3300046477 Bacteria 5800
371 Ga0495608_0205540 3300046511 Bacteria 1239
372 Ga0495618_0045213 3300046514 Bacteria 2777
373 Ga0495628_0000241 3300046516 Bacteria 48162
374 Ga0495630_0002703 3300046517 Bacteria 12302
375 Ga0495630_0097238 3300046517 Bacteria 2227
376 Ga0495630_0132026 3300046517 Bacteria 1897
377 Ga0495643_0000149 3300046522 Bacteria 113849
378 Ga0495643_0000997 3300046522 Bacteria 28895
379 Ga0495644_0030585 3300046523 Bacteria 2033
380 Ga0495666_0045542 3300046526 Bacteria 2116
381 Ga0495652_0374738 3300046529 Bacteria 1014
382 Ga0495665_0016027 3300046531 Bacteria 4038
383 Ga0495586_0000670 3300046535 Bacteria 19540
384 Ga0495587_0148404 3300046536 Unclassified 1336
385 Ga0495645_0001139 3300046543 Bacteria 18013
386 Ga0495645_0116700 3300046543 Bacteria 1884
387 Ga0495645_0162067 3300046543 Bacteria 1546
388 Ga0495633_0262066 3300046558 Bacteria 788
389 Ga0495668_0072504 3300046616 Bacteria 1892
390 Ga0495634_0232583 3300046642 Unclassified 1133
391 Ga0495635_0055532 3300046663 Bacteria 2728
392 Ga0495599_0281321 3300046678 Bacteria 1008
393 Ga0495658_0009605 3300046683 Bacteria 4824
394 Ga0495658_0022505 3300046683 Bacteria 3334
395 Ga0495624_0012458 3300046690 Bacteria 5810
396 Ga0495674_0005248 3300047319 Bacteria 12433
397 Ga0495674_0010378 3300047319 Bacteria 8818
398 Ga0495683_0024829 3300047323 Bacteria 3074
399 Ga0495684_0014746 3300047471 Bacteria 6018
400 Ga0496100_0201694 3300048903 Bacteria 1450
401 Ga0496102_0089564 3300048905 Unclassified 2847
402 Ga0496103_0292748 3300048906 Unclassified 1047
403 Ga0496104_0041973 3300048907 Bacteria 4290
404 Ga0496107_0151765 3300048910 Unclassified 1714
405 Ga0496107_0261863 3300048910 Bacteria 1287
406 Ga0496108_0051400 3300048911 Unclassified 3453
407 Ga0496110_0076182 3300048913 Plasmid 2982
408 Ga0496111_0092515 3300048914 Bacteria 2217
409 Ga0496112_0068315 3300048915 Bacteria 3509
410 Ga0496113_0249536 3300048916 Bacteria 1417
411 Ga0496113_0317985 3300048916 Unclassified 1247
412 Ga0496113_0560549 3300048916 Bacteria 916
413 Ga0496114_0051111 3300048917 Bacteria 3441
414 Ga0496115_0011823 3300048918 Bacteria 6557
415 Ga0501309_017625 3300049129 Unclassified 982
416 Ga0501032_0446100 3300049569 Bacteria 829
417 Ga0501034_0002093 3300049571 Bacteria 24922
418 Ga0501037_0044882 3300049573 Bacteria 3245
419 Ga0501038_0495040 3300049574 Bacteria 935
420 Ga0501046_0402395 3300049580 Bacteria 989
421 Ga0501047_0332002 3300049581 Bacteria 1359
422 Ga0501080_0094125 3300049742 Bacteria 2782
423 Ga0501083_0069322 3300049744 Bacteria 2346
424 Ga0501035_0327025 3300049822 Bacteria 1287
425 Ga0501044_0020929 3300049823 Bacteria 6985
426 Ga0501044_0145532 3300049823 Bacteria 2356
427 Ga0501044_0168526 3300049823 Unclassified 2163
428 Ga0501044_0387798 3300049823 Bacteria 1311
429 nmdc:mga0k408_114715_c1 3300050493 Unclassified 1593
430 Ga0500608_058732 3300053122 Bacteria 1841
431 Ga0500568_0004121 3300053139 Bacteria 7870
432 Ga0500616_0019154 3300053153 Bacteria 3859
433 Ga0501084_0002478 3300054114 Bacteria 14869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10071199 Ga0111539_100711993 176
2 3300014325 Ga0163163_10133480 Ga0163163_101334803 184
3 3300048916 Ga0496113_0317985 Ga0496113_0317985_534_1220 184
4 3300038443 Ga0395901_0124460 Ga0395901_0124460_348_1082 186
5 3300005539 Ga0068853_100034101 Ga0068853_1000341013 189
6 3300026041 Ga0207639_10032372 Ga0207639_100323725 189
7 3300005327 Ga0070658_10402382 Ga0070658_104023822 191
8 3300005331 Ga0070670_100219823 Ga0070670_1002198232 191
9 3300025986 Ga0207658_10816509 Ga0207658_108165092 194
10 3300025915 Ga0207693_10150398 Ga0207693_101503983 195
11 3300003320 rootH2_10001201 rootH2_100012017 196
12 3300003323 rootH1_10020455 rootH1_1002045510 198
13 3300005549 Ga0070704_100482024 Ga0070704_1004820241 198
14 3300049129 Ga0501309_017625 Ga0501309_017625_317_967 198
15 3300033180 Ga0307510_10005630 Ga0307510_100056308 200
16 3300047323 Ga0495683_0024829 Ga0495683_0024829_1697_2338 200
17 3300003320 rootH2_10311952 rootH2_103119522 201
18 3300005543 Ga0070672_100835765 Ga0070672_1008357651 201
19 3300013306 Ga0163162_10153692 Ga0163162_101536924 201
20 3300005539 Ga0068853_100000051 Ga0068853_10000005127 202
21 3300025934 Ga0207686_10044334 Ga0207686_100443342 202
22 3300026041 Ga0207639_10000077 Ga0207639_1000007724 202
23 3300037312 Ga0395899_0017894 Ga0395899_0017894_1321_1962 202
24 3300037418 Ga0395900_0004510 Ga0395900_0004510_8256_8897 202
25 3300037471 Ga0395905_0000752 Ga0395905_0000752_2448_3089 202
26 3300037471 Ga0395905_0261763 Ga0395905_0261763_639_1298 202
27 3300038443 Ga0395901_0014493 Ga0395901_0014493_2168_2809 202
28 3300046523 Ga0495644_0030585 Ga0495644_0030585_530_1171 202
29 3300005327 Ga0070658_10425122 Ga0070658_104251222 203
30 3300005339 Ga0070660_100391477 Ga0070660_1003914772 203
31 3300005539 Ga0068853_100120837 Ga0068853_1001208372 203
32 3300005548 Ga0070665_100000034 Ga0070665_10000003479 203
33 3300013306 Ga0163162_10000018 Ga0163162_1000001855 203
34 3300014325 Ga0163163_10045101 Ga0163163_100451015 203
35 3300026041 Ga0207639_10011515 Ga0207639_100115156 203
36 3300028379 Ga0268266_10000119 Ga0268266_1000011995 203
37 3300028786 Ga0307517_10013164 Ga0307517_1001316413 203
38 3300031250 Ga0265331_10088469 Ga0265331_100884691 203
39 3300031251 Ga0265327_10002101 Ga0265327_1000210111 203
40 3300053122 Ga0500608_058732 Ga0500608_058732_348_986 204
41 3300009093 Ga0105240_10002040 Ga0105240_1000204035 205
42 3300025913 Ga0207695_10003830 Ga0207695_1000383017 205
43 3300005467 Ga0070706_100001327 Ga0070706_10000132711 206
44 3300013297 Ga0157378_10057339 Ga0157378_100573392 206
45 3300013308 Ga0157375_10019874 Ga0157375_100198743 206
46 3300025910 Ga0207684_10001353 Ga0207684_1000135312 206
47 3300005530 Ga0070679_100000364 Ga0070679_10000036422 208
48 3300005577 Ga0068857_100084226 Ga0068857_1000842262 208
49 3300009551 Ga0105238_10036985 Ga0105238_100369859 208
50 3300013308 Ga0157375_10668970 Ga0157375_106689702 208
51 3300025921 Ga0207652_10000027 Ga0207652_1000002721 208
52 3300037312 Ga0395899_0000751 Ga0395899_0000751_8177_8836 208
53 3300037312 Ga0395899_0165851 Ga0395899_0165851_760_1443 208
54 3300037418 Ga0395900_0000153 Ga0395900_0000153_29923_30582 208
55 3300037418 Ga0395900_0188274 Ga0395900_0188274_260_943 208
56 3300037466 Ga0395898_0239758 Ga0395898_0239758_56_715 208
57 3300037471 Ga0395905_0003545 Ga0395905_0003545_8812_9471 208
58 3300038443 Ga0395901_0000330 Ga0395901_0000330_33390_34049 208
59 3300003320 rootH2_10010808 rootH2_1001080833 209
60 3300005338 Ga0068868_100036049 Ga0068868_1000360493 209
61 3300005364 Ga0070673_100000522 Ga0070673_1000005222 209
62 3300005455 Ga0070663_100148378 Ga0070663_1001483783 209
63 3300005456 Ga0070678_100004497 Ga0070678_1000044979 209
64 3300005459 Ga0068867_100001584 Ga0068867_1000015848 209
65 3300005539 Ga0068853_100001879 Ga0068853_1000018793 209
66 3300005616 Ga0068852_100000630 Ga0068852_1000006302 209
67 3300005718 Ga0068866_10046605 Ga0068866_100466054 209
68 3300005843 Ga0068860_100698292 Ga0068860_1006982922 209
69 3300006237 Ga0097621_100000343 Ga0097621_1000003439 209
70 3300006358 Ga0068871_100000284 Ga0068871_10000028434 209
71 3300006881 Ga0068865_100000029 Ga0068865_10000002918 209
72 3300009174 Ga0105241_10003988 Ga0105241_1000398811 209
73 3300009176 Ga0105242_10298377 Ga0105242_102983772 209
74 3300009545 Ga0105237_10001073 Ga0105237_1000107320 209
75 3300009551 Ga0105238_10004453 Ga0105238_100044537 209
76 3300013296 Ga0157374_10000857 Ga0157374_1000085726 209
77 3300013296 Ga0157374_10060241 Ga0157374_100602412 209
78 3300013297 Ga0157378_10210192 Ga0157378_102101922 209
79 3300013308 Ga0157375_10059791 Ga0157375_100597916 209
80 3300025907 Ga0207645_10005267 Ga0207645_100052673 209
81 3300025911 Ga0207654_10108546 Ga0207654_101085463 209
82 3300025924 Ga0207694_10011709 Ga0207694_100117097 209
83 3300025934 Ga0207686_10015819 Ga0207686_100158191 209
84 3300025938 Ga0207704_10000035 Ga0207704_1000003563 209
85 3300025960 Ga0207651_10020332 Ga0207651_100203322 209
86 3300026023 Ga0207677_10042281 Ga0207677_100422813 209
87 3300026041 Ga0207639_10218361 Ga0207639_102183611 209
88 3300026067 Ga0207678_10717357 Ga0207678_107173571 209
89 3300026089 Ga0207648_10000733 Ga0207648_1000073318 209
90 3300026121 Ga0207683_10010048 Ga0207683_100100489 209
91 3300026142 Ga0207698_10027876 Ga0207698_100278763 209
92 3300028381 Ga0268264_10602231 Ga0268264_106022312 209
93 3300046529 Ga0495652_0374738 Ga0495652_0374738_87_797 209
94 3300046543 Ga0495645_0162067 Ga0495645_0162067_24_695 209
95 3300046683 Ga0495658_0022505 Ga0495658_0022505_789_1499 209
96 3300038443 Ga0395901_0269895 Ga0395901_0269895_597_1265 210
97 3300053153 Ga0500616_0019154 Ga0500616_0019154_2553_3227 210
98 3300032126 Ga0307415_100853546 Ga0307415_1008535461 211
99 3300035172 Ga0373955_0229501 Ga0373955_0229501_260_928 211
100 3300036401 Ga0373937_0205846 Ga0373937_0205846_384_1052 211
101 3300046517 Ga0495630_0097238 Ga0495630_0097238_720_1388 211
102 3300046536 Ga0495587_0148404 Ga0495587_0148404_43_711 211
103 3300046642 Ga0495634_0232583 Ga0495634_0232583_62_730 211
104 3300046678 Ga0495599_0281321 Ga0495599_0281321_260_928 211
105 3300037471 Ga0395905_0581768 Ga0395905_0581768_253_942 212
106 3300003187 JGI25151J46595_10026839 JGI25151J46595_100268392 213
107 3300005329 Ga0070683_100439817 Ga0070683_1004398172 213
108 3300009176 Ga0105242_10943251 Ga0105242_109432511 213
109 3300011119 Ga0105246_10324362 Ga0105246_103243621 213
110 3300025271 Ga0207666_1000215 Ga0207666_10002154 213
111 3300025294 Ga0209025_1004106 Ga0209025_100410613 213
112 3300025944 Ga0207661_10430108 Ga0207661_104301082 213
113 3300037471 Ga0395905_0110457 Ga0395905_0110457_1251_1898 213
114 3300048903 Ga0496100_0201694 Ga0496100_0201694_674_1315 213
115 3300048916 Ga0496113_0560549 Ga0496113_0560549_140_781 213
116 3300005331 Ga0070670_100249975 Ga0070670_1002499752 214
117 3300005616 Ga0068852_100398113 Ga0068852_1003981132 214
118 3300005843 Ga0068860_100051825 Ga0068860_1000518255 214
119 3300006237 Ga0097621_100867155 Ga0097621_1008671551 214
120 3300009551 Ga0105238_10000370 Ga0105238_1000037033 214
121 3300025924 Ga0207694_10008521 Ga0207694_100085216 214
122 3300026142 Ga0207698_10282831 Ga0207698_102828313 214
123 3300028381 Ga0268264_10063985 Ga0268264_100639853 214
124 3300031711 Ga0265314_10071867 Ga0265314_100718672 214
125 3300038443 Ga0395901_0178249 Ga0395901_0178249_1217_1942 214
126 3300048917 Ga0496114_0051111 Ga0496114_0051111_1915_2589 214
127 3300005327 Ga0070658_10000638 Ga0070658_100006383 215
128 3300006358 Ga0068871_100265367 Ga0068871_1002653673 215
129 3300009093 Ga0105240_10000833 Ga0105240_1000083335 215
130 3300009545 Ga0105237_10002503 Ga0105237_1000250316 215
131 3300009545 Ga0105237_10026390 Ga0105237_100263906 215
132 3300009545 Ga0105237_10219385 Ga0105237_102193851 215
133 3300010375 Ga0105239_10000267 Ga0105239_1000026728 215
134 3300010375 Ga0105239_11747898 Ga0105239_117478981 215
135 3300013296 Ga0157374_10000003 Ga0157374_10000003322 215
136 3300014969 Ga0157376_10000580 Ga0157376_100005806 215
137 3300025909 Ga0207705_10005178 Ga0207705_100051782 215
138 3300025913 Ga0207695_10000184 Ga0207695_1000018463 215
139 3300025914 Ga0207671_10001942 Ga0207671_1000194216 215
140 3300025914 Ga0207671_10255067 Ga0207671_102550671 215
141 3300025914 Ga0207671_10272649 Ga0207671_102726492 215
142 3300048915 Ga0496112_0068315 Ga0496112_0068315_1286_1933 215
143 iso_pu_bacteria 2671180531 2673162762 215
144 3300021361 Ga0213872_10044258 Ga0213872_100442583 216
145 3300039447 Ga0436361_0672383 Ga0436361_0672383_3608_4258 216
146 3300046558 Ga0495633_0262066 Ga0495633_0262066_119_769 216
147 3300049744 Ga0501083_0069322 Ga0501083_0069322_453_1160 216
148 3300054114 Ga0501084_0002478 Ga0501084_0002478_10010_10717 216
149 iso_pu_bacteria 2687453341 2688394126 216
150 3300003323 rootH1_10191129 rootH1_101911296 217
151 3300005331 Ga0070670_100049990 Ga0070670_1000499904 217
152 3300005334 Ga0068869_100082668 Ga0068869_1000826684 217
153 3300005334 Ga0068869_100189394 Ga0068869_1001893942 217
154 3300005356 Ga0070674_100197163 Ga0070674_1001971632 217
155 3300005364 Ga0070673_100013678 Ga0070673_1000136787 217
156 3300005456 Ga0070678_100001380 Ga0070678_1000013806 217
157 3300005548 Ga0070665_100204403 Ga0070665_1002044032 217
158 3300005563 Ga0068855_100000226 Ga0068855_10000022653 217
159 3300005577 Ga0068857_100553393 Ga0068857_1005533931 217
160 3300005617 Ga0068859_100378600 Ga0068859_1003786002 217
161 3300005840 Ga0068870_10095189 Ga0068870_100951892 217
162 3300005843 Ga0068860_100113262 Ga0068860_1001132623 217
163 3300006237 Ga0097621_100120151 Ga0097621_1001201513 217
164 3300006881 Ga0068865_100042365 Ga0068865_1000423652 217
165 3300006931 Ga0097620_100378561 Ga0097620_1003785612 217
166 3300009174 Ga0105241_10075270 Ga0105241_100752703 217
167 3300009176 Ga0105242_10029644 Ga0105242_100296446 217
168 3300009177 Ga0105248_10438155 Ga0105248_104381552 217
169 3300009553 Ga0105249_10069678 Ga0105249_100696782 217
170 3300009553 Ga0105249_10250547 Ga0105249_102505472 217
171 3300009553 Ga0105249_10389937 Ga0105249_103899372 217
172 3300011119 Ga0105246_10006214 Ga0105246_100062145 217
173 3300013296 Ga0157374_10084384 Ga0157374_100843844 217
174 3300013306 Ga0163162_11143744 Ga0163162_111437441 217
175 3300013308 Ga0157375_10084628 Ga0157375_100846283 217
176 3300025893 Ga0207682_10038307 Ga0207682_100383072 217
177 3300025901 Ga0207688_10175056 Ga0207688_101750562 217
178 3300025907 Ga0207645_10000723 Ga0207645_1000072316 217
179 3300025908 Ga0207643_10005470 Ga0207643_100054704 217
180 3300025923 Ga0207681_10018475 Ga0207681_100184756 217
181 3300025937 Ga0207669_10050178 Ga0207669_100501782 217
182 3300025938 Ga0207704_10030316 Ga0207704_100303165 217
183 3300025940 Ga0207691_10073276 Ga0207691_100732764 217
184 3300025942 Ga0207689_10002983 Ga0207689_100029835 217
185 3300025949 Ga0207667_10000039 Ga0207667_10000039115 217
186 3300025961 Ga0207712_10052693 Ga0207712_100526932 217
187 3300025961 Ga0207712_10176033 Ga0207712_101760332 217
188 3300025981 Ga0207640_10247870 Ga0207640_102478702 217
189 3300025986 Ga0207658_10081257 Ga0207658_100812573 217
190 3300026089 Ga0207648_10001434 Ga0207648_100014347 217
191 3300026116 Ga0207674_10126499 Ga0207674_101264992 217
192 3300026121 Ga0207683_10001858 Ga0207683_100018589 217
193 3300028379 Ga0268266_10113276 Ga0268266_101132763 217
194 3300028381 Ga0268264_10034453 Ga0268264_100344533 217
195 3300028800 Ga0265338_10204645 Ga0265338_102046451 217
196 3300046522 Ga0495643_0000149 Ga0495643_0000149_66693_67373 217
197 3300048907 Ga0496104_0041973 Ga0496104_0041973_928_1611 217
198 3300048911 Ga0496108_0051400 Ga0496108_0051400_749_1432 217
199 3300049573 Ga0501037_0044882 Ga0501037_0044882_315_971 217
200 3300049580 Ga0501046_0402395 Ga0501046_0402395_49_705 217
201 3300049581 Ga0501047_0332002 Ga0501047_0332002_354_1010 217
202 3300049823 Ga0501044_0020929 Ga0501044_0020929_1511_2167 217
203 iso_pu_bacteria 2920107658 2920112789 217
204 3300013306 Ga0163162_10041824 Ga0163162_100418244 218
205 3300013308 Ga0157375_10104445 Ga0157375_101044455 218
206 3300014325 Ga0163163_10086611 Ga0163163_100866113 218
207 3300014968 Ga0157379_10536679 Ga0157379_105366792 218
208 3300041997 Ga0439431_0015152 Ga0439431_0015152_169_825 218
209 3300046616 Ga0495668_0072504 Ga0495668_0072504_708_1364 218
210 3300005355 Ga0070671_100544309 Ga0070671_1005443092 219
211 3300005435 Ga0070714_100101261 Ga0070714_1001012614 219
212 3300005436 Ga0070713_100927830 Ga0070713_1009278301 219
213 3300005530 Ga0070679_100540075 Ga0070679_1005400752 219
214 3300005843 Ga0068860_100434699 Ga0068860_1004346992 219
215 3300013296 Ga0157374_10065370 Ga0157374_100653701 219
216 3300013307 Ga0157372_10185070 Ga0157372_101850703 219
217 3300025921 Ga0207652_10488726 Ga0207652_104887262 219
218 3300028800 Ga0265338_10019102 Ga0265338_100191023 219
219 3300031238 Ga0265332_10023254 Ga0265332_100232543 219
220 3300031241 Ga0265325_10000429 Ga0265325_1000042914 219
221 3300031249 Ga0265339_10000805 Ga0265339_100008058 219
222 3300031250 Ga0265331_10000286 Ga0265331_1000028638 219
223 3300031548 Ga0307408_100000031 Ga0307408_100000031158 219
224 3300031595 Ga0265313_10000845 Ga0265313_1000084522 219
225 3300031711 Ga0265314_10000082 Ga0265314_1000008295 219
226 3300031712 Ga0265342_10004421 Ga0265342_100044214 219
227 3300037471 Ga0395905_0043163 Ga0395905_0043163_164_832 219
228 3300049569 Ga0501032_0446100 Ga0501032_0446100_138_803 219
229 3300049574 Ga0501038_0495040 Ga0501038_0495040_238_909 219
230 3300049823 Ga0501044_0145532 Ga0501044_0145532_82_744 219
231 3300049823 Ga0501044_0387798 Ga0501044_0387798_536_1243 219
232 3300050493 nmdc:mga0k408_114715_c1 nmdc:mga0k408_114715_c1_867_1532 219
233 3300005366 Ga0070659_100386613 Ga0070659_1003866131 220
234 3300013297 Ga0157378_10798415 Ga0157378_107984152 220
235 3300014325 Ga0163163_10000147 Ga0163163_1000014716 220
236 3300031903 Ga0307407_10008359 Ga0307407_100083595 220
237 3300035170 Ga0373943_0352518 Ga0373943_0352518_121_807 220
238 3300046472 Ga0495580_0349935 Ga0495580_0349935_59_796 220
239 3300046475 Ga0495639_0022662 Ga0495639_0022662_697_1434 220
240 3300046511 Ga0495608_0205540 Ga0495608_0205540_46_783 220
241 3300046517 Ga0495630_0002703 Ga0495630_0002703_3257_3994 220
242 3300046531 Ga0495665_0016027 Ga0495665_0016027_1412_2149 220
243 3300046663 Ga0495635_0055532 Ga0495635_0055532_220_957 220
244 3300046690 Ga0495624_0012458 Ga0495624_0012458_1879_2616 220
245 3300047319 Ga0495674_0005248 Ga0495674_0005248_3269_4006 220
246 3300047471 Ga0495684_0014746 Ga0495684_0014746_3233_3970 220
247 3300013307 Ga0157372_10206811 Ga0157372_102068111 221
248 3300042129 Ga0450891_002469 Ga0450891_002469_277_954 221
249 3300042532 Ga0450893_0006815 Ga0450893_0006815_999_1676 221
250 3300045051 Ga0451576_0151039 Ga0451576_0151039_724_1392 221
251 3300046522 Ga0495643_0000997 Ga0495643_0000997_17943_18626 221
252 3300049571 Ga0501034_0002093 Ga0501034_0002093_21898_22566 221
253 iso_pu_bacteria 2671180531 2673168732 221
254 3300005331 Ga0070670_100243352 Ga0070670_1002433522 222
255 3300025925 Ga0207650_10303769 Ga0207650_103037692 222
256 3300013296 Ga0157374_10254637 Ga0157374_102546372 223
257 3300031711 Ga0265314_10037840 Ga0265314_100378403 223
258 3300031712 Ga0265342_10104906 Ga0265342_101049062 223
259 3300003320 rootH2_10106787 rootH2_101067877 224
260 3300005468 Ga0070707_100270750 Ga0070707_1002707503 224
261 3300005518 Ga0070699_100129167 Ga0070699_1001291672 224
262 3300005563 Ga0068855_100018699 Ga0068855_1000186993 224
263 3300006195 Ga0075366_10259904 Ga0075366_102599042 224
264 3300009551 Ga0105238_10551337 Ga0105238_105513372 224
265 3300014325 Ga0163163_11079925 Ga0163163_110799251 224
266 3300025922 Ga0207646_10235888 Ga0207646_102358882 224
267 3300025926 Ga0207659_10261988 Ga0207659_102619882 224
268 3300025949 Ga0207667_10257620 Ga0207667_102576202 224
269 3300028800 Ga0265338_10028357 Ga0265338_100283573 224
270 3300031240 Ga0265320_10005032 Ga0265320_100050325 224
271 3300035692 Ga0373935_0620543 Ga0373935_0620543_57_731 224
272 3300045051 Ga0451576_0148197 Ga0451576_0148197_124_801 224
273 3300046517 Ga0495630_0132026 Ga0495630_0132026_316_990 224
274 3300046543 Ga0495645_0116700 Ga0495645_0116700_1045_1725 224
275 3300046683 Ga0495658_0009605 Ga0495658_0009605_2585_3262 224
276 3300049742 Ga0501080_0094125 Ga0501080_0094125_1311_1985 224
277 3300049822 Ga0501035_0327025 Ga0501035_0327025_129_803 224
278 3300049823 Ga0501044_0168526 Ga0501044_0168526_173_847 224
279 3300053139 Ga0500568_0004121 Ga0500568_0004121_2217_2894 224
280 3300005340 Ga0070689_100122656 Ga0070689_1001226563 225
281 3300005617 Ga0068859_100316368 Ga0068859_1003163682 225
282 3300006931 Ga0097620_100316366 Ga0097620_1003163662 225
283 3300009545 Ga0105237_10795373 Ga0105237_107953731 225
284 3300010375 Ga0105239_10217394 Ga0105239_102173943 225
285 3300025936 Ga0207670_10004434 Ga0207670_100044344 225
286 3300025936 Ga0207670_10085030 Ga0207670_100850302 225
287 3300025940 Ga0207691_10237868 Ga0207691_102378682 225
288 3300026041 Ga0207639_10942331 Ga0207639_109423312 225
289 3300031251 Ga0265327_10011076 Ga0265327_100110764 225
290 3300037853 Ga0436364_0768674 Ga0436364_0768674_407_1093 225
291 3300048918 Ga0496115_0011823 Ga0496115_0011823_2136_2813 225
292 3300005445 Ga0070708_100699554 Ga0070708_1006995542 226
293 3300005467 Ga0070706_100057064 Ga0070706_1000570644 226
294 3300006871 Ga0075434_100374231 Ga0075434_1003742312 226
295 3300009094 Ga0111539_10583417 Ga0111539_105834172 226
296 3300046454 Ga0495592_0000054 Ga0495592_0000054_60811_61503 226
297 3300046475 Ga0495639_0139942 Ga0495639_0139942_139_831 226
298 3300046476 Ga0495662_0031675 Ga0495662_0031675_1842_2534 226
299 3300046477 Ga0495664_0008267 Ga0495664_0008267_2366_3058 226
300 3300046514 Ga0495618_0045213 Ga0495618_0045213_629_1321 226
301 3300046516 Ga0495628_0000241 Ga0495628_0000241_4865_5557 226
302 3300046526 Ga0495666_0045542 Ga0495666_0045542_78_770 226
303 3300046535 Ga0495586_0000670 Ga0495586_0000670_8185_8877 226
304 3300046543 Ga0495645_0001139 Ga0495645_0001139_7691_8383 226
305 3300047319 Ga0495674_0010378 Ga0495674_0010378_2203_2895 226
306 3300005328 Ga0070676_10109758 Ga0070676_101097582 227
307 3300005338 Ga0068868_100024770 Ga0068868_1000247702 227
308 3300005340 Ga0070689_100207276 Ga0070689_1002072762 227
309 3300005343 Ga0070687_100001234 Ga0070687_1000012342 227
310 3300005354 Ga0070675_100023517 Ga0070675_1000235175 227
311 3300005366 Ga0070659_100015210 Ga0070659_1000152109 227
312 3300005367 Ga0070667_100419067 Ga0070667_1004190672 227
313 3300005457 Ga0070662_100066917 Ga0070662_1000669174 227
314 3300005468 Ga0070707_100305952 Ga0070707_1003059522 227
315 3300005549 Ga0070704_100360229 Ga0070704_1003602292 227
316 3300005842 Ga0068858_100121441 Ga0068858_1001214414 227
317 3300005843 Ga0068860_100044707 Ga0068860_1000447074 227
318 3300005844 Ga0068862_100122788 Ga0068862_1001227882 227
319 3300009545 Ga0105237_10589995 Ga0105237_105899952 227
320 3300009553 Ga0105249_10001429 Ga0105249_1000142924 227
321 3300010375 Ga0105239_10131433 Ga0105239_101314332 227
322 3300013296 Ga0157374_10145831 Ga0157374_101458313 227
323 3300013297 Ga0157378_10039669 Ga0157378_100396693 227
324 3300013306 Ga0163162_10003165 Ga0163162_100031652 227
325 3300013307 Ga0157372_10114845 Ga0157372_101148452 227
326 3300014968 Ga0157379_10223741 Ga0157379_102237412 227
327 3300025315 Ga0207697_10000377 Ga0207697_1000037727 227
328 3300025901 Ga0207688_10030184 Ga0207688_100301842 227
329 3300025907 Ga0207645_10000666 Ga0207645_100006662 227
330 3300025918 Ga0207662_10000497 Ga0207662_1000049717 227
331 3300025922 Ga0207646_10115872 Ga0207646_101158722 227
332 3300025923 Ga0207681_10001007 Ga0207681_100010078 227
333 3300025926 Ga0207659_10013188 Ga0207659_100131886 227
334 3300025932 Ga0207690_10043886 Ga0207690_100438862 227
335 3300025942 Ga0207689_10317207 Ga0207689_103172072 227
336 3300025961 Ga0207712_10005716 Ga0207712_100057167 227
337 3300025972 Ga0207668_10018086 Ga0207668_100180863 227
338 3300025986 Ga0207658_10020987 Ga0207658_100209877 227
339 3300026023 Ga0207677_10028067 Ga0207677_100280675 227
340 3300026035 Ga0207703_10063339 Ga0207703_100633392 227
341 3300028380 Ga0268265_10059158 Ga0268265_100591582 227
342 3300028381 Ga0268264_10031864 Ga0268264_100318642 227
343 3300045051 Ga0451576_0511594 Ga0451576_0511594_337_1023 227
344 3300045051 Ga0451576_0570339 Ga0451576_0570339_335_1027 227
345 3300002126 JGI24035J26624_1000398 JGI24035J26624_10003985 228
346 3300005289 Ga0065704_10168857 Ga0065704_101688572 228
347 3300005289 Ga0065704_10231544 Ga0065704_102315441 228
348 3300005290 Ga0065712_10071040 Ga0065712_100710405 228
349 3300005293 Ga0065715_10090742 Ga0065715_100907423 228
350 3300005329 Ga0070683_100024861 Ga0070683_1000248616 228
351 3300005339 Ga0070660_100095622 Ga0070660_1000956222 228
352 3300005340 Ga0070689_100014132 Ga0070689_1000141323 228
353 3300005340 Ga0070689_100016487 Ga0070689_1000164874 228
354 3300005354 Ga0070675_100069337 Ga0070675_1000693374 228
355 3300005355 Ga0070671_100014386 Ga0070671_1000143865 228
356 3300005364 Ga0070673_100003661 Ga0070673_10000366110 228
357 3300005365 Ga0070688_100004708 Ga0070688_1000047084 228
358 3300005365 Ga0070688_100064086 Ga0070688_1000640863 228
359 3300005366 Ga0070659_100004328 Ga0070659_1000043285 228
360 3300005367 Ga0070667_100138289 Ga0070667_1001382893 228
361 3300005438 Ga0070701_10082223 Ga0070701_100822232 228
362 3300005440 Ga0070705_100033585 Ga0070705_1000335854 228
363 3300005444 Ga0070694_100014482 Ga0070694_1000144823 228
364 3300005466 Ga0070685_10037249 Ga0070685_100372493 228
365 3300005466 Ga0070685_10042231 Ga0070685_100422312 228
366 3300005535 Ga0070684_100000223 Ga0070684_10000022338 228
367 3300005543 Ga0070672_100241688 Ga0070672_1002416882 228
368 3300005548 Ga0070665_100013014 Ga0070665_1000130144 228
369 3300005564 Ga0070664_100065678 Ga0070664_1000656783 228
370 3300005615 Ga0070702_100133818 Ga0070702_1001338183 228
371 3300005617 Ga0068859_100024859 Ga0068859_1000248591 228
372 3300005719 Ga0068861_100088418 Ga0068861_1000884183 228
373 3300005843 Ga0068860_100253188 Ga0068860_1002531883 228
374 3300006237 Ga0097621_100719773 Ga0097621_1007197732 228
375 3300006358 Ga0068871_100167243 Ga0068871_1001672433 228
376 3300006931 Ga0097620_100024859 Ga0097620_1000248591 228
377 3300009093 Ga0105240_10000124 Ga0105240_1000012497 228
378 3300009094 Ga0111539_10241787 Ga0111539_102417873 228
379 3300009176 Ga0105242_10309635 Ga0105242_103096352 228
380 3300009177 Ga0105248_11086724 Ga0105248_110867241 228
381 3300009545 Ga0105237_10931203 Ga0105237_109312032 228
382 3300009553 Ga0105249_10004437 Ga0105249_100044375 228
383 3300010159 Ga0099796_10000695 Ga0099796_100006957 228
384 3300010375 Ga0105239_10059026 Ga0105239_100590265 228
385 3300010375 Ga0105239_10086116 Ga0105239_100861162 228
386 3300010375 Ga0105239_10138156 Ga0105239_101381562 228
387 3300010375 Ga0105239_10347224 Ga0105239_103472242 228
388 3300013102 Ga0157371_10412693 Ga0157371_104126931 228
389 3300013296 Ga0157374_10010119 Ga0157374_100101198 228
390 3300013296 Ga0157374_10063199 Ga0157374_100631994 228
391 3300013296 Ga0157374_10914580 Ga0157374_109145801 228
392 3300013297 Ga0157378_10015320 Ga0157378_100153204 228
393 3300013297 Ga0157378_10092032 Ga0157378_100920322 228
394 3300013306 Ga0163162_10023979 Ga0163162_100239792 228
395 3300013306 Ga0163162_10077903 Ga0163162_100779033 228
396 3300013307 Ga0157372_10675921 Ga0157372_106759212 228
397 3300013308 Ga0157375_10016838 Ga0157375_100168385 228
398 3300013308 Ga0157375_10092883 Ga0157375_100928834 228
399 3300014325 Ga0163163_10082788 Ga0163163_100827884 228
400 3300014745 Ga0157377_10008054 Ga0157377_100080543 228
401 3300014745 Ga0157377_10108724 Ga0157377_101087243 228
402 3300014969 Ga0157376_10025087 Ga0157376_100250872 228
403 3300025271 Ga0207666_1006832 Ga0207666_10068323 228
404 3300025290 Ga0207673_1000151 Ga0207673_10001515 228
405 3300025290 Ga0207673_1000243 Ga0207673_10002434 228
406 3300025315 Ga0207697_10000729 Ga0207697_1000072917 228
407 3300025315 Ga0207697_10001324 Ga0207697_100013247 228
408 3300025904 Ga0207647_10030443 Ga0207647_100304434 228
409 3300025907 Ga0207645_10051938 Ga0207645_100519383 228
410 3300025907 Ga0207645_10086785 Ga0207645_100867853 228
411 3300025913 Ga0207695_10000022 Ga0207695_1000002292 228
412 3300025916 Ga0207663_10185616 Ga0207663_101856162 228
413 3300025919 Ga0207657_10116212 Ga0207657_101162123 228
414 3300025926 Ga0207659_10024863 Ga0207659_100248634 228
415 3300025926 Ga0207659_10117252 Ga0207659_101172522 228
416 3300025931 Ga0207644_10010864 Ga0207644_100108644 228
417 3300025932 Ga0207690_10006875 Ga0207690_100068758 228
418 3300025933 Ga0207706_10330159 Ga0207706_103301592 228
419 3300025936 Ga0207670_10005486 Ga0207670_100054866 228
420 3300025936 Ga0207670_10019379 Ga0207670_100193792 228
421 3300025941 Ga0207711_10652958 Ga0207711_106529582 228
422 3300025944 Ga0207661_10955274 Ga0207661_109552741 228
423 3300025945 Ga0207679_10060132 Ga0207679_100601322 228
424 3300026023 Ga0207677_10087257 Ga0207677_100872573 228
425 3300026035 Ga0207703_10007514 Ga0207703_100075145 228
426 3300026095 Ga0207676_10063168 Ga0207676_100631683 228
427 3300026118 Ga0207675_100016560 Ga0207675_1000165606 228
428 3300028379 Ga0268266_10016251 Ga0268266_100162515 228
429 3300028381 Ga0268264_10026582 Ga0268264_100265826 228
430 3300048905 Ga0496102_0089564 Ga0496102_0089564_1088_1834 228
431 3300048906 Ga0496103_0292748 Ga0496103_0292748_62_748 228
432 3300048910 Ga0496107_0151765 Ga0496107_0151765_275_961 228
433 3300048910 Ga0496107_0261863 Ga0496107_0261863_278_964 228
434 3300048913 Ga0496110_0076182 Ga0496110_0076182_2052_2738 228
435 3300048914 Ga0496111_0092515 Ga0496111_0092515_1093_1779 228
436 3300048916 Ga0496113_0249536 Ga0496113_0249536_489_1235 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

24

237

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9579 3 212
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9362 3 212
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9354 1 214
7nl4-assembly1.cif.gz_B osnip2;1 silicon transporter from rice 0.9354 3 212
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.9326 1 211
ID Description Score Start End Superfamily
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9794 2 100 1.20.1080.10
af_K7KZ85_1_217_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.967 17 212 1.20.1080.10
af_Q8W036_4_264_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9659 2 212 1.20.1080.10
af_Q9ATN2_41_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9643 2 212 1.20.1080.10
af_A0A1D6J0S8_31_279_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9561 2 212 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A4Q3L3Y8-F1-model_v4 deleted 0.9883 2 207
AF-A0A518GQG0-F1-model_v4 Aquaporin Z 0.9877 1 213 GO:0015267
GO:0016020
AF-A0A225DR87-F1-model_v4 Aquaporin Z 0.9854 3 189 GO:0015267
GO:0016020
AF-A0A3C1YCT3-F1-model_v4 Aquaporin 0.9853 3 206 GO:0015267
GO:0016020
AF-A0A2D0N743-F1-model_v4 Aquaporin 0.9851 3 211 GO:0015267
GO:0016020

Feature Viewer

pLDDT pTM Quality
90.92 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map