F443531

General Info

Members Datasets Scaffolds Average Seq Length
436 207 872 190

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10206381|Ga0114129_102063812
Length 227
Sequence LTRARYFKSTLVRHWKFLVPLLSDSVGETTPKRQKSHSMEPLPSHELVGARVVGDMPSADLVDLWGKISSGIVKYGFVIEYRDLEPPRTGIFDGVRIVIDPDVGFEMQCFLLLHLFGHSVQWVAPSLAHTIEELQSTADRARFLQVLHDYEFEAARFGMQLMHERGVAHLDQWYSDFVETDWRYVEGFYRTDRIPVWVDCVVSGCPLIHPAPIPALTHRQVDVRFAF

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0
Rhizoplane 5.73
Rhizosphere 90.14
Stem 0
Stem Tuber 0
Unclassified 28.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10206381 3300009147 Bacteria 2658
2 MRS1b_contig_1236823 2162886011 Bacteria 991
3 Ga0065712_10003096 3300005290 Bacteria 7776
4 Ga0065715_10007490 3300005293 Unclassified 3073
5 Ga0065715_10093723 3300005293 Unclassified 4586
6 Ga0065715_10196144 3300005293 Bacteria 1386
7 Ga0065715_10262087 3300005293 Unclassified 1135
8 Ga0065715_10279031 3300005293 Bacteria 1085
9 Ga0065715_10458915 3300005293 Unclassified 818
10 Ga0065707_10087276 3300005295 Bacteria 5093
11 Ga0065707_10123262 3300005295 Bacteria 2069
12 Ga0065707_10358223 3300005295 Unclassified 908
13 Ga0070676_10199874 3300005328 Unclassified 1310
14 Ga0070683_100003040 3300005329 Bacteria 13483
15 Ga0070670_100003981 3300005331 Bacteria 12338
16 Ga0070670_100321990 3300005331 Unclassified 1355
17 Ga0070670_100763510 3300005331 Bacteria 872
18 Ga0070666_10270987 3300005335 Bacteria 1205
19 Ga0070666_10372699 3300005335 Bacteria 1024
20 Ga0070682_100472733 3300005337 Bacteria 965
21 Ga0068868_100352039 3300005338 Bacteria 1261
22 Ga0070689_100143072 3300005340 Bacteria 1924
23 Ga0070689_100216156 3300005340 Bacteria 1571
24 Ga0070689_100246672 3300005340 Archaea 1472
25 Ga0070661_100240384 3300005344 Bacteria 1394
26 Ga0070661_100646807 3300005344 Bacteria 858
27 Ga0070692_10543479 3300005345 Archaea 760
28 Ga0070668_100093225 3300005347 Bacteria 2376
29 Ga0070668_101117065 3300005347 Unclassified 712
30 Ga0070669_100016394 3300005353 Bacteria 5286
31 Ga0070669_100181439 3300005353 Bacteria 1647
32 Ga0070675_100018035 3300005354 Bacteria 5618
33 Ga0070675_100215115 3300005354 Bacteria 1672
34 Ga0070671_100843055 3300005355 Bacteria 799
35 Ga0070674_100003279 3300005356 Bacteria 9052
36 Ga0070674_100208833 3300005356 Bacteria 1512
37 Ga0070674_100506630 3300005356 Unclassified 1006
38 Ga0070673_100075785 3300005364 Bacteria 2714
39 Ga0070673_100203395 3300005364 Bacteria 1706
40 Ga0070659_100061645 3300005366 Unclassified 2964
41 Ga0070659_100135932 3300005366 Bacteria 1999
42 Ga0070667_100020252 3300005367 Bacteria 5523
43 Ga0070705_100161954 3300005440 Bacteria 1497
44 Ga0070705_100196175 3300005440 Bacteria 1380
45 Ga0070700_100463125 3300005441 Unclassified 967
46 Ga0070700_100542634 3300005441 Bacteria 902
47 Ga0070694_100015768 3300005444 Bacteria 4753
48 Ga0070694_100453223 3300005444 Unclassified 1013
49 Ga0070694_100831351 3300005444 Bacteria 759
50 Ga0070708_100565041 3300005445 Unclassified 1073
51 Ga0070663_100859669 3300005455 Bacteria 781
52 Ga0070663_101090619 3300005455 Archaea 698
53 Ga0070678_100119111 3300005456 Bacteria 2079
54 Ga0070678_100139526 3300005456 Bacteria 1938
55 Ga0070678_100276627 3300005456 Bacteria 1418
56 Ga0070678_100295385 3300005456 Bacteria 1375
57 Ga0070678_100564917 3300005456 Bacteria 1011
58 Ga0070662_100526001 3300005457 Bacteria 989
59 Ga0068867_100295846 3300005459 Unclassified 1333
60 Ga0070685_10441266 3300005466 Archaea 910
61 Ga0070707_100836007 3300005468 Bacteria 885
62 Ga0070699_100272581 3300005518 Unclassified 1515
63 Ga0070699_100278594 3300005518 Bacteria 1498
64 Ga0070699_100844016 3300005518 Unclassified 839
65 Ga0070679_100109828 3300005530 Unclassified 2744
66 Ga0070684_100000221 3300005535 Bacteria 39898
67 Ga0070697_100474558 3300005536 Bacteria 1092
68 Ga0070697_100518685 3300005536 Bacteria 1043
69 Ga0070672_100062875 3300005543 Bacteria 2931
70 Ga0070672_100164929 3300005543 Bacteria 1840
71 Ga0070672_100285159 3300005543 Unclassified 1397
72 Ga0070672_101132626 3300005543 Unclassified 696
73 Ga0070686_100485919 3300005544 Bacteria 956
74 Ga0070695_100229296 3300005545 Unclassified 1342
75 Ga0070695_100236756 3300005545 Bacteria 1322
76 Ga0070696_100064707 3300005546 Bacteria 2562
77 Ga0070696_100122017 3300005546 Bacteria 1887
78 Ga0070693_100050306 3300005547 Unclassified 2381
79 Ga0070665_100060984 3300005548 Bacteria 3781
80 Ga0070665_100374389 3300005548 Bacteria 1431
81 Ga0070704_100102483 3300005549 Bacteria 2160
82 Ga0070704_100311776 3300005549 Unclassified 1315
83 Ga0070704_100349345 3300005549 Bacteria 1248
84 Ga0070704_100436371 3300005549 Bacteria 1125
85 Ga0070704_100614145 3300005549 Unclassified 957
86 Ga0070664_100000594 3300005564 Bacteria 27619
87 Ga0070664_100383547 3300005564 Bacteria 1283
88 Ga0070664_100460650 3300005564 Bacteria 1168
89 Ga0070664_100683634 3300005564 Unclassified 955
90 Ga0068857_100343840 3300005577 Unclassified 1380
91 Ga0070702_100513251 3300005615 Unclassified 882
92 Ga0068859_100128576 3300005617 Bacteria 2604
93 Ga0068859_100284714 3300005617 Bacteria 1746
94 Ga0068864_100561784 3300005618 Bacteria 1104
95 Ga0068866_10029631 3300005718 Bacteria 2619
96 Ga0068866_10071020 3300005718 Bacteria 1840
97 Ga0068861_100056894 3300005719 Bacteria 2986
98 Ga0068861_100149639 3300005719 Bacteria 1914
99 Ga0068863_100019214 3300005841 Bacteria 6539
100 Ga0068863_100127933 3300005841 Bacteria 2424
101 Ga0068863_100205795 3300005841 Bacteria 1894
102 Ga0068863_100592221 3300005841 Unclassified 1097
103 Ga0068858_100081555 3300005842 Bacteria 3006
104 Ga0068860_100128287 3300005843 Bacteria 2432
105 Ga0068862_100087320 3300005844 Bacteria 2713
106 Ga0068862_100169745 3300005844 Bacteria 1952
107 Ga0068862_100327271 3300005844 Unclassified 1416
108 Ga0081539_10002472 3300005985 Bacteria 26008
109 Ga0075364_10028182 3300006051 Bacteria 3594
110 Ga0075364_10332201 3300006051 Unclassified 1035
111 Ga0075362_10011958 3300006177 Bacteria 3432
112 Ga0075367_10005507 3300006178 Bacteria 6300
113 Ga0075367_10006038 3300006178 Bacteria 6084
114 Ga0075367_10133376 3300006178 Bacteria 1536
115 Ga0075366_10025822 3300006195 Bacteria 3435
116 Ga0097621_100002229 3300006237 Bacteria 13273
117 Ga0097621_100079490 3300006237 Bacteria 2726
118 Ga0097621_100170422 3300006237 Unclassified 1876
119 Ga0097621_100456342 3300006237 Bacteria 1152
120 Ga0075370_10467726 3300006353 Unclassified 759
121 Ga0068871_100001180 3300006358 Bacteria 17510
122 Ga0068871_100019315 3300006358 Bacteria 5202
123 Ga0075428_100056176 3300006844 Bacteria 4313
124 Ga0075428_100076491 3300006844 Unclassified 3654
125 Ga0075428_100108764 3300006844 Bacteria 3021
126 Ga0075428_100360481 3300006844 Bacteria 1559
127 Ga0075428_100615748 3300006844 Bacteria 1159
128 Ga0075428_101540054 3300006844 Unclassified 696
129 Ga0075430_100021913 3300006846 Bacteria 5429
130 Ga0075430_100065151 3300006846 Bacteria 3061
131 Ga0075430_100087611 3300006846 Bacteria 2605
132 Ga0075431_100041256 3300006847 Bacteria 4757
133 Ga0075431_100067948 3300006847 Bacteria 3679
134 Ga0075431_100588555 3300006847 Bacteria 1097
135 Ga0075434_100096093 3300006871 Bacteria 2968
136 Ga0075434_100131362 3300006871 Unclassified 2523
137 Ga0075429_100034455 3300006880 Bacteria 4400
138 Ga0075429_100101287 3300006880 Unclassified 2514
139 Ga0068865_100001691 3300006881 Bacteria 12921
140 Ga0068865_100353973 3300006881 Bacteria 1190
141 Ga0068865_100508351 3300006881 Unclassified 1006
142 Ga0075436_100010431 3300006914 Bacteria 6368
143 Ga0075436_100380634 3300006914 Unclassified 1020
144 Ga0075436_100439414 3300006914 Bacteria 949
145 Ga0075436_100446352 3300006914 Unclassified 941
146 Ga0097620_100128572 3300006931 Bacteria 2604
147 Ga0097620_100284684 3300006931 Bacteria 1746
148 Ga0097620_101477596 3300006931 Unclassified 750
149 Ga0075435_100109001 3300007076 Bacteria 2301
150 Ga0075435_100144733 3300007076 Unclassified 1996
151 Ga0075435_100430724 3300007076 Unclassified 1136
152 Ga0111539_10049557 3300009094 Bacteria 5007
153 Ga0111539_10059738 3300009094 Bacteria 4520
154 Ga0111539_10060848 3300009094 Bacteria 4474
155 Ga0111539_10124543 3300009094 Bacteria 3020
156 Ga0111539_10205821 3300009094 Unclassified 2294
157 Ga0111539_10325781 3300009094 Bacteria 1788
158 Ga0111539_10429457 3300009094 Unclassified 1538
159 Ga0111539_10713774 3300009094 Bacteria 1167
160 Ga0111539_11178357 3300009094 Unclassified 890
161 Ga0111539_11494309 3300009094 Unclassified 783
162 Ga0105245_10041244 3300009098 Bacteria 4114
163 Ga0105245_10103936 3300009098 Bacteria 2633
164 Ga0105245_10183508 3300009098 Bacteria 2000
165 Ga0105245_10559211 3300009098 Unclassified 1166
166 Ga0105247_10035986 3300009101 Unclassified 3019
167 Ga0105247_10078277 3300009101 Unclassified 2079
168 Ga0105247_10209028 3300009101 Bacteria 1315
169 Ga0114129_10003799 3300009147 Bacteria 21294
170 Ga0114129_10014474 3300009147 Bacteria 11241
171 Ga0114129_10023198 3300009147 Bacteria 8801
172 Ga0114129_10043958 3300009147 Bacteria 6285
173 Ga0114129_10172675 3300009147 Unclassified 2946
174 Ga0114129_10250884 3300009147 Bacteria 2376
175 Ga0114129_10290200 3300009147 Unclassified 2183
176 Ga0114129_10338955 3300009147 Bacteria 1995
177 Ga0114129_10625250 3300009147 Bacteria 1392
178 Ga0114129_10680942 3300009147 Bacteria 1324
179 Ga0114129_11149453 3300009147 Bacteria 969
180 Ga0114129_11222183 3300009147 Bacteria 935
181 Ga0114129_11504504 3300009147 Unclassified 827
182 Ga0105243_10320108 3300009148 Bacteria 1413
183 Ga0105243_10657290 3300009148 Unclassified 1016
184 Ga0105243_11094339 3300009148 Unclassified 805
185 Ga0105242_10053508 3300009176 Bacteria 3297
186 Ga0105242_10078254 3300009176 Bacteria 2760
187 Ga0105242_10145015 3300009176 Bacteria 2064
188 Ga0105242_10165710 3300009176 Unclassified 1939
189 Ga0105248_10186863 3300009177 Bacteria 2335
190 Ga0105248_10195614 3300009177 Bacteria 2278
191 Ga0105248_10226845 3300009177 Unclassified 2103
192 Ga0105248_10922068 3300009177 Unclassified 986
193 Ga0105237_11153310 3300009545 Unclassified 782
194 Ga0105238_11427559 3300009551 Unclassified 720
195 Ga0105249_10055596 3300009553 Bacteria 3621
196 Ga0105249_10065852 3300009553 Bacteria 3334
197 Ga0105249_10985520 3300009553 Unclassified 911
198 Ga0105239_10294110 3300010375 Bacteria 1829
199 Ga0105239_10515368 3300010375 Bacteria 1360
200 Ga0105246_10093915 3300011119 Bacteria 2168
201 Ga0105246_10782990 3300011119 Unclassified 844
202 Ga0157374_10096931 3300013296 Bacteria 2821
203 Ga0157378_10622761 3300013297 Bacteria 1092
204 Ga0157378_11567692 3300013297 Bacteria 704
205 Ga0163162_10242876 3300013306 Bacteria 1932
206 Ga0163162_10381863 3300013306 Bacteria 1542
207 Ga0157375_10187878 3300013308 Unclassified 2220
208 Ga0157375_10322903 3300013308 Unclassified 1708
209 Ga0157375_10603352 3300013308 Bacteria 1257
210 Ga0157375_11174777 3300013308 Unclassified 900
211 Ga0157375_11174870 3300013308 Unclassified 900
212 Ga0163163_10077149 3300014325 Bacteria 3328
213 Ga0163163_10231004 3300014325 Unclassified 1899
214 Ga0163163_10272604 3300014325 Bacteria 1743
215 Ga0163163_10616706 3300014325 Archaea 1148
216 Ga0163163_11467075 3300014325 Bacteria 744
217 Ga0157380_10094365 3300014326 Bacteria 2476
218 Ga0157380_10188474 3300014326 Unclassified 1819
219 Ga0157380_10481693 3300014326 Bacteria 1200
220 Ga0157380_10499300 3300014326 Bacteria 1181
221 Ga0157380_11308044 3300014326 Unclassified 772
222 Ga0157377_10008387 3300014745 Bacteria 5038
223 Ga0157377_10054064 3300014745 Unclassified 2272
224 Ga0157377_10529352 3300014745 Unclassified 829
225 Ga0157379_10027008 3300014968 Bacteria 5109
226 Ga0157376_10001432 3300014969 Bacteria 15677
227 Ga0207697_10047508 3300025315 Bacteria 1769
228 Ga0207653_10123311 3300025885 Unclassified 935
229 Ga0207642_10091597 3300025899 Bacteria 1503
230 Ga0207710_10039758 3300025900 Bacteria 2082
231 Ga0207680_10027995 3300025903 Bacteria 3147
232 Ga0207680_10334091 3300025903 Bacteria 1062
233 Ga0207643_10025574 3300025908 Unclassified 3264
234 Ga0207660_10024149 3300025917 Bacteria 4112
235 Ga0207649_10203735 3300025920 Bacteria 1399
236 Ga0207649_10511304 3300025920 Bacteria 915
237 Ga0207646_10257705 3300025922 Unclassified 1576
238 Ga0207681_10021901 3300025923 Unclassified 4069
239 Ga0207681_10097942 3300025923 Unclassified 2109
240 Ga0207681_10223597 3300025923 Bacteria 1458
241 Ga0207650_10004516 3300025925 Bacteria 9516
242 Ga0207650_10276170 3300025925 Unclassified 1367
243 Ga0207659_10148534 3300025926 Unclassified 1828
244 Ga0207687_10064779 3300025927 Bacteria 2593
245 Ga0207644_10140554 3300025931 Bacteria 1859
246 Ga0207644_10964850 3300025931 Viruses 715
247 Ga0207690_10153176 3300025932 Bacteria 1711
248 Ga0207690_10914578 3300025932 Bacteria 728
249 Ga0207706_10153109 3300025933 Bacteria 2028
250 Ga0207709_10204389 3300025935 Bacteria 1413
251 Ga0207670_10012476 3300025936 Bacteria 4976
252 Ga0207669_10020932 3300025937 Bacteria 3441
253 Ga0207669_10058345 3300025937 Archaea 2354
254 Ga0207669_10769310 3300025937 Unclassified 796
255 Ga0207704_10004253 3300025938 Bacteria 6540
256 Ga0207704_10004909 3300025938 Bacteria 6143
257 Ga0207704_10213058 3300025938 Bacteria 1423
258 Ga0207691_10041344 3300025940 Bacteria 4257
259 Ga0207691_10286196 3300025940 Unclassified 1418
260 Ga0207711_10034066 3300025941 Bacteria 4312
261 Ga0207689_10068429 3300025942 Bacteria 2918
262 Ga0207689_10133633 3300025942 Bacteria 2042
263 Ga0207689_10256418 3300025942 Bacteria 1447
264 Ga0207689_10455741 3300025942 Bacteria 1069
265 Ga0207661_10004451 3300025944 Bacteria 9842
266 Ga0207679_10004360 3300025945 Bacteria 8807
267 Ga0207651_10046969 3300025960 Unclassified 2908
268 Ga0207651_10060043 3300025960 Bacteria 2637
269 Ga0207651_10152913 3300025960 Unclassified 1799
270 Ga0207651_10935268 3300025960 Bacteria 773
271 Ga0207712_10694361 3300025961 Bacteria 888
272 Ga0207640_10033953 3300025981 Bacteria 3180
273 Ga0207677_10294954 3300026023 Bacteria 1337
274 Ga0207678_10367061 3300026067 Archaea 1243
275 Ga0207678_10438640 3300026067 Bacteria 1134
276 Ga0207708_10370470 3300026075 Unclassified 1179
277 Ga0207708_10448346 3300026075 Bacteria 1074
278 Ga0207708_10575049 3300026075 Unclassified 952
279 Ga0207702_11122941 3300026078 Bacteria 780
280 Ga0207641_10108824 3300026088 Unclassified 2454
281 Ga0207641_10911537 3300026088 Unclassified 873
282 Ga0207648_10069796 3300026089 Bacteria 3062
283 Ga0207648_10120128 3300026089 Bacteria 2310
284 Ga0207648_10274238 3300026089 Bacteria 1507
285 Ga0207648_10357798 3300026089 Bacteria 1317
286 Ga0207648_11410756 3300026089 Unclassified 655
287 Ga0207676_10110926 3300026095 Bacteria 2295
288 Ga0207676_10847191 3300026095 Bacteria 894
289 Ga0207676_10955204 3300026095 Bacteria 843
290 Ga0207674_10206043 3300026116 Unclassified 1916
291 Ga0207675_100070930 3300026118 Unclassified 3257
292 Ga0207683_10235397 3300026121 Bacteria 1670
293 Ga0207683_10810771 3300026121 Bacteria 869
294 Ga0207698_10330986 3300026142 Bacteria 1431
295 Ga0207428_10000974 3300027907 Bacteria 31750
296 Ga0207428_10012342 3300027907 Bacteria 7510
297 Ga0207428_10064890 3300027907 Unclassified 2882
298 Ga0207428_10121137 3300027907 Bacteria 2006
299 Ga0207428_10342494 3300027907 Unclassified 1101
300 Ga0207428_10803756 3300027907 Unclassified 668
301 Ga0268266_10002071 3300028379 Bacteria 22211
302 Ga0268266_10108769 3300028379 Bacteria 2454
303 Ga0268266_10291659 3300028379 Bacteria 1519
304 Ga0268266_10297425 3300028379 Bacteria 1505
305 Ga0268265_10132926 3300028380 Unclassified 2071
306 Ga0268265_10293222 3300028380 Bacteria 1461
307 Ga0268265_11426346 3300028380 Unclassified 695
308 Ga0268264_10214444 3300028381 Unclassified 1769
309 Ga0268264_10748262 3300028381 Unclassified 974
310 Ga0307517_10342478 3300028786 Bacteria 816
311 Ga0265338_10006440 3300028800 Bacteria 14967
312 Ga0265325_10000873 3300031241 Bacteria 21740
313 Ga0265339_10018673 3300031249 Bacteria 4084
314 Ga0265331_10000111 3300031250 Bacteria 108277
315 Ga0265313_10002691 3300031595 Bacteria 15050
316 Ga0265314_10000082 3300031711 Bacteria 143717
317 Ga0265342_10038970 3300031712 Bacteria 2890
318 Ga0307410_10252202 3300031852 Bacteria 1372
319 Ga0307409_100146188 3300031995 Bacteria 2045
320 Ga0307416_100112887 3300032002 Bacteria 2399
321 Ga0307415_100262838 3300032126 Bacteria 1409
322 Ga0373940_0138913 3300035088 Unclassified 767
323 Ga0373947_0276062 3300035725 Unclassified 1116
324 Ga0373937_0070645 3300036401 Bacteria 3221
325 Ga0373937_0722968 3300036401 Bacteria 943
326 Ga0451853_2102406 3300041512 Bacteria 849
327 Ga0439460_0234273 3300042461 Bacteria 632
328 Ga0451577_0680130 3300042876 Unclassified 933
329 Ga0453683_0001666 3300044673 Bacteria 18595
330 Ga0451576_0918105 3300045051 Unclassified 918
331 Ga0495662_0114913 3300046476 Bacteria 1320
332 Ga0495640_0593749 3300046533 Unclassified 669
333 Ga0495586_0429930 3300046535 Unclassified 761
334 Ga0495587_0335452 3300046536 Bacteria 844
335 Ga0495621_0012065 3300046539 Unclassified 2689
336 Ga0495645_0009381 3300046543 Bacteria 6841
337 Ga0495656_0007876 3300046615 Bacteria 3786
338 Ga0495634_0236235 3300046642 Bacteria 1123
339 Ga0495599_0173000 3300046678 Bacteria 1332
340 Ga0495647_0074372 3300046681 Bacteria 1366
341 Ga0495669_0008995 3300046684 Bacteria 4209
342 Ga0495675_0383553 3300047444 Unclassified 822
343 Ga0495684_0325497 3300047471 Bacteria 1098
344 Ga0495602_0261385 3300048088 Bacteria 1284
345 Ga0496101_0191594 3300048904 Bacteria 1578
346 Ga0496102_0040537 3300048905 Bacteria 4212
347 Ga0496102_0539839 3300048905 Bacteria 1089
348 Ga0496103_0365799 3300048906 Bacteria 927
349 Ga0496104_0003957 3300048907 Bacteria 12830
350 Ga0496104_0205201 3300048907 Unclassified 1883
351 Ga0496105_0203152 3300048908 Bacteria 1617
352 Ga0496105_0338118 3300048908 Bacteria 1204
353 Ga0496107_0421701 3300048910 Unclassified 992
354 Ga0496108_0009376 3300048911 Bacteria 7924
355 Ga0496109_0007788 3300048912 Bacteria 9071
356 Ga0496109_0056102 3300048912 Unclassified 3595
357 Ga0496109_0182247 3300048912 Bacteria 1973
358 Ga0496110_0000770 3300048913 Bacteria 22239
359 Ga0496110_0237058 3300048913 Bacteria 1660
360 Ga0496110_0524187 3300048913 Archaea 1078
361 Ga0496111_0073475 3300048914 Bacteria 2490
362 Ga0496112_0001715 3300048915 Bacteria 17118
363 Ga0496112_0042883 3300048915 Bacteria 4428
364 Ga0496112_0117479 3300048915 Bacteria 2630
365 Ga0496113_0030265 3300048916 Bacteria 3918
366 Ga0496113_0345759 3300048916 Bacteria 1193
367 Ga0496114_0086635 3300048917 Bacteria 2655
368 Ga0496114_0197481 3300048917 Bacteria 1761
369 Ga0496114_0878899 3300048917 Bacteria 777
370 Ga0501040_0128564 3300049576 Unclassified 1780
371 Ga0501048_0029524 3300049582 Bacteria 3976
372 Ga0501075_0176945 3300049591 Bacteria 1628
373 Ga0501076_0033775 3300049592 Bacteria 3994
374 Ga0501076_0455798 3300049592 Unclassified 1053
375 Ga0501079_0028260 3300049741 Bacteria 4303
376 Ga0501080_0095478 3300049742 Bacteria 2761
377 Ga0501081_0030625 3300049743 Bacteria 3644
378 Ga0501044_0236063 3300049823 Bacteria 1774
379 nmdc:mga03683_12346_c1 3300050489 Bacteria 3117
380 nmdc:mga00v17_25564_c1 3300050491 Bacteria 3433
381 nmdc:mga00v17_289396_c1 3300050491 Unclassified 1064
382 nmdc:mga0yw44_134589_c1 3300050492 Bacteria 1602
383 nmdc:mga06z11_101598_c1 3300050494 Bacteria 1578
384 nmdc:mga06z11_11313_c1 3300050494 Bacteria 3844
385 nmdc:mga06z11_14531_c1 3300050494 Bacteria 3490
386 nmdc:mga05p37_112248_c1 3300050507 Bacteria 3352
387 nmdc:mga05p37_13854_c1 3300050507 Bacteria 9660
388 nmdc:mga05p37_156621_c1 3300050507 Unclassified 2783
389 nmdc:mga05p37_192348_c1 3300050507 Bacteria 2476
390 nmdc:mga05p37_287536_c1 3300050507 Bacteria 1958
391 nmdc:mga05p37_386898_c1 3300050507 Unclassified 1637
392 nmdc:mga05p37_578225_c1 3300050507 Unclassified 1273
393 nmdc:mga05p37_880100_c1 3300050507 Bacteria 969
394 nmdc:mga09592_13417_c1 3300050508 Bacteria 6688
395 nmdc:mga09592_271912_c1 3300050508 Unclassified 1470
396 nmdc:mga09592_29229_c1 3300050508 Bacteria 4583
397 nmdc:mga09592_476066_c1 3300050508 Unclassified 1076
398 nmdc:mga09592_590412_c1 3300050508 Bacteria 952
399 nmdc:mga0qj67_87989_c1 3300050509 Bacteria 2494
400 nmdc:mga0qj67_93558_c1 3300050509 Bacteria 2417
401 nmdc:mga06r32_1110224_c1 3300050510 Unclassified 740
402 nmdc:mga06r32_328421_c1 3300050510 Bacteria 1515
403 nmdc:mga06r32_356153_c1 3300050510 Bacteria 1448
404 nmdc:mga06r32_41108_c1 3300050510 Bacteria 4392
405 nmdc:mga08y16_12263_c1 3300050511 Bacteria 9008
406 nmdc:mga08y16_1288457_c1 3300050511 Bacteria 698
407 nmdc:mga08y16_1384734_c1 3300050511 Unclassified 667
408 nmdc:mga08y16_168043_c1 3300050511 Bacteria 2279
409 nmdc:mga08y16_17338_c1 3300050511 Bacteria 7582
410 nmdc:mga08y16_191041_c1 3300050511 Unclassified 2124
411 nmdc:mga08y16_2338_c2 3300050511 Bacteria 7332
412 nmdc:mga08y16_252528_c1 3300050511 Bacteria 1822
413 nmdc:mga08y16_314985_c1 3300050511 Unclassified 1611
414 nmdc:mga08y16_70550_c1 3300050511 Bacteria 3642
415 nmdc:mga08y16_76395_c1 3300050511 Bacteria 3491
416 nmdc:mga0n895_197491_c1 3300050512 Unclassified 2043
417 nmdc:mga0n895_59675_c1 3300050512 Bacteria 3764
418 nmdc:mga0n895_671228_c1 3300050512 Bacteria 1034
419 nmdc:mga0n895_742731_c1 3300050512 Archaea 975
420 nmdc:mga0n895_877868_c1 3300050512 Bacteria 883
421 nmdc:mga0rr50_19701_c1 3300050513 Bacteria 4561
422 nmdc:mga0rr50_228838_c1 3300050513 Bacteria 1538
423 nmdc:mga0rr50_266697_c1 3300050513 Bacteria 1426
424 nmdc:mga0rr50_763471_c1 3300050513 Unclassified 825
425 nmdc:mga0rr50_91905_c1 3300050513 Unclassified 2365
426 nmdc:mga08x19_195146_c1 3300050514 Bacteria 1386
427 nmdc:mga08x19_20544_c1 3300050514 Bacteria 4066
428 nmdc:mga08x19_679262_c1 3300050514 Unclassified 731
429 nmdc:mga0a205_1131689_c1 3300050515 Unclassified 630
430 nmdc:mga0a205_845469_c1 3300050515 Unclassified 762
431 Ga0495595_0040713 3300053084 Bacteria 2124
432 Ga0495619_0231303 3300053085 Bacteria 1281
433 Ga0495619_0492307 3300053085 Bacteria 843
434 Ga0500658_0203599 3300053134 Bacteria 905
435 Ga0501082_0192832 3300060353 Unclassified 1772
436 Ga0530510_0196040 3300061734 Unclassified 1500
437 Ga0114129_10206381
438 MRS1b_contig_1236823
439 Ga0065712_10003096
440 Ga0065715_10007490
441 Ga0065715_10093723
442 Ga0065715_10196144
443 Ga0065715_10262087
444 Ga0065715_10279031
445 Ga0065715_10458915
446 Ga0065707_10087276
447 Ga0065707_10123262
448 Ga0065707_10358223
449 Ga0070676_10199874
450 Ga0070683_100003040
451 Ga0070670_100003981
452 Ga0070670_100321990
453 Ga0070670_100763510
454 Ga0070666_10270987
455 Ga0070666_10372699
456 Ga0070682_100472733
457 Ga0068868_100352039
458 Ga0070689_100143072
459 Ga0070689_100216156
460 Ga0070689_100246672
461 Ga0070661_100240384
462 Ga0070661_100646807
463 Ga0070692_10543479
464 Ga0070668_100093225
465 Ga0070668_101117065
466 Ga0070669_100016394
467 Ga0070669_100181439
468 Ga0070675_100018035
469 Ga0070675_100215115
470 Ga0070671_100843055
471 Ga0070674_100003279
472 Ga0070674_100208833
473 Ga0070674_100506630
474 Ga0070673_100075785
475 Ga0070673_100203395
476 Ga0070659_100061645
477 Ga0070659_100135932
478 Ga0070667_100020252
479 Ga0070705_100161954
480 Ga0070705_100196175
481 Ga0070700_100463125
482 Ga0070700_100542634
483 Ga0070694_100015768
484 Ga0070694_100453223
485 Ga0070694_100831351
486 Ga0070708_100565041
487 Ga0070663_100859669
488 Ga0070663_101090619
489 Ga0070678_100119111
490 Ga0070678_100139526
491 Ga0070678_100276627
492 Ga0070678_100295385
493 Ga0070678_100564917
494 Ga0070662_100526001
495 Ga0068867_100295846
496 Ga0070685_10441266
497 Ga0070707_100836007
498 Ga0070699_100272581
499 Ga0070699_100278594
500 Ga0070699_100844016
501 Ga0070679_100109828
502 Ga0070684_100000221
503 Ga0070697_100474558
504 Ga0070697_100518685
505 Ga0070672_100062875
506 Ga0070672_100164929
507 Ga0070672_100285159
508 Ga0070672_101132626
509 Ga0070686_100485919
510 Ga0070695_100229296
511 Ga0070695_100236756
512 Ga0070696_100064707
513 Ga0070696_100122017
514 Ga0070693_100050306
515 Ga0070665_100060984
516 Ga0070665_100374389
517 Ga0070704_100102483
518 Ga0070704_100311776
519 Ga0070704_100349345
520 Ga0070704_100436371
521 Ga0070704_100614145
522 Ga0070664_100000594
523 Ga0070664_100383547
524 Ga0070664_100460650
525 Ga0070664_100683634
526 Ga0068857_100343840
527 Ga0070702_100513251
528 Ga0068859_100128576
529 Ga0068859_100284714
530 Ga0068864_100561784
531 Ga0068866_10029631
532 Ga0068866_10071020
533 Ga0068861_100056894
534 Ga0068861_100149639
535 Ga0068863_100019214
536 Ga0068863_100127933
537 Ga0068863_100205795
538 Ga0068863_100592221
539 Ga0068858_100081555
540 Ga0068860_100128287
541 Ga0068862_100087320
542 Ga0068862_100169745
543 Ga0068862_100327271
544 Ga0081539_10002472
545 Ga0075364_10028182
546 Ga0075364_10332201
547 Ga0075362_10011958
548 Ga0075367_10005507
549 Ga0075367_10006038
550 Ga0075367_10133376
551 Ga0075366_10025822
552 Ga0097621_100002229
553 Ga0097621_100079490
554 Ga0097621_100170422
555 Ga0097621_100456342
556 Ga0075370_10467726
557 Ga0068871_100001180
558 Ga0068871_100019315
559 Ga0075428_100056176
560 Ga0075428_100076491
561 Ga0075428_100108764
562 Ga0075428_100360481
563 Ga0075428_100615748
564 Ga0075428_101540054
565 Ga0075430_100021913
566 Ga0075430_100065151
567 Ga0075430_100087611
568 Ga0075431_100041256
569 Ga0075431_100067948
570 Ga0075431_100588555
571 Ga0075434_100096093
572 Ga0075434_100131362
573 Ga0075429_100034455
574 Ga0075429_100101287
575 Ga0068865_100001691
576 Ga0068865_100353973
577 Ga0068865_100508351
578 Ga0075436_100010431
579 Ga0075436_100380634
580 Ga0075436_100439414
581 Ga0075436_100446352
582 Ga0097620_100128572
583 Ga0097620_100284684
584 Ga0097620_101477596
585 Ga0075435_100109001
586 Ga0075435_100144733
587 Ga0075435_100430724
588 Ga0111539_10049557
589 Ga0111539_10059738
590 Ga0111539_10060848
591 Ga0111539_10124543
592 Ga0111539_10205821
593 Ga0111539_10325781
594 Ga0111539_10429457
595 Ga0111539_10713774
596 Ga0111539_11178357
597 Ga0111539_11494309
598 Ga0105245_10041244
599 Ga0105245_10103936
600 Ga0105245_10183508
601 Ga0105245_10559211
602 Ga0105247_10035986
603 Ga0105247_10078277
604 Ga0105247_10209028
605 Ga0114129_10003799
606 Ga0114129_10014474
607 Ga0114129_10023198
608 Ga0114129_10043958
609 Ga0114129_10172675
610 Ga0114129_10250884
611 Ga0114129_10290200
612 Ga0114129_10338955
613 Ga0114129_10625250
614 Ga0114129_10680942
615 Ga0114129_11149453
616 Ga0114129_11222183
617 Ga0114129_11504504
618 Ga0105243_10320108
619 Ga0105243_10657290
620 Ga0105243_11094339
621 Ga0105242_10053508
622 Ga0105242_10078254
623 Ga0105242_10145015
624 Ga0105242_10165710
625 Ga0105248_10186863
626 Ga0105248_10195614
627 Ga0105248_10226845
628 Ga0105248_10922068
629 Ga0105237_11153310
630 Ga0105238_11427559
631 Ga0105249_10055596
632 Ga0105249_10065852
633 Ga0105249_10985520
634 Ga0105239_10294110
635 Ga0105239_10515368
636 Ga0105246_10093915
637 Ga0105246_10782990
638 Ga0157374_10096931
639 Ga0157378_10622761
640 Ga0157378_11567692
641 Ga0163162_10242876
642 Ga0163162_10381863
643 Ga0157375_10187878
644 Ga0157375_10322903
645 Ga0157375_10603352
646 Ga0157375_11174777
647 Ga0157375_11174870
648 Ga0163163_10077149
649 Ga0163163_10231004
650 Ga0163163_10272604
651 Ga0163163_10616706
652 Ga0163163_11467075
653 Ga0157380_10094365
654 Ga0157380_10188474
655 Ga0157380_10481693
656 Ga0157380_10499300
657 Ga0157380_11308044
658 Ga0157377_10008387
659 Ga0157377_10054064
660 Ga0157377_10529352
661 Ga0157379_10027008
662 Ga0157376_10001432
663 Ga0207697_10047508
664 Ga0207653_10123311
665 Ga0207642_10091597
666 Ga0207710_10039758
667 Ga0207680_10027995
668 Ga0207680_10334091
669 Ga0207643_10025574
670 Ga0207660_10024149
671 Ga0207649_10203735
672 Ga0207649_10511304
673 Ga0207646_10257705
674 Ga0207681_10021901
675 Ga0207681_10097942
676 Ga0207681_10223597
677 Ga0207650_10004516
678 Ga0207650_10276170
679 Ga0207659_10148534
680 Ga0207687_10064779
681 Ga0207644_10140554
682 Ga0207644_10964850
683 Ga0207690_10153176
684 Ga0207690_10914578
685 Ga0207706_10153109
686 Ga0207709_10204389
687 Ga0207670_10012476
688 Ga0207669_10020932
689 Ga0207669_10058345
690 Ga0207669_10769310
691 Ga0207704_10004253
692 Ga0207704_10004909
693 Ga0207704_10213058
694 Ga0207691_10041344
695 Ga0207691_10286196
696 Ga0207711_10034066
697 Ga0207689_10068429
698 Ga0207689_10133633
699 Ga0207689_10256418
700 Ga0207689_10455741
701 Ga0207661_10004451
702 Ga0207679_10004360
703 Ga0207651_10046969
704 Ga0207651_10060043
705 Ga0207651_10152913
706 Ga0207651_10935268
707 Ga0207712_10694361
708 Ga0207640_10033953
709 Ga0207677_10294954
710 Ga0207678_10367061
711 Ga0207678_10438640
712 Ga0207708_10370470
713 Ga0207708_10448346
714 Ga0207708_10575049
715 Ga0207702_11122941
716 Ga0207641_10108824
717 Ga0207641_10911537
718 Ga0207648_10069796
719 Ga0207648_10120128
720 Ga0207648_10274238
721 Ga0207648_10357798
722 Ga0207648_11410756
723 Ga0207676_10110926
724 Ga0207676_10847191
725 Ga0207676_10955204
726 Ga0207674_10206043
727 Ga0207675_100070930
728 Ga0207683_10235397
729 Ga0207683_10810771
730 Ga0207698_10330986
731 Ga0207428_10000974
732 Ga0207428_10012342
733 Ga0207428_10064890
734 Ga0207428_10121137
735 Ga0207428_10342494
736 Ga0207428_10803756
737 Ga0268266_10002071
738 Ga0268266_10108769
739 Ga0268266_10291659
740 Ga0268266_10297425
741 Ga0268265_10132926
742 Ga0268265_10293222
743 Ga0268265_11426346
744 Ga0268264_10214444
745 Ga0268264_10748262
746 Ga0307517_10342478
747 Ga0265338_10006440
748 Ga0265325_10000873
749 Ga0265339_10018673
750 Ga0265331_10000111
751 Ga0265313_10002691
752 Ga0265314_10000082
753 Ga0265342_10038970
754 Ga0307410_10252202
755 Ga0307409_100146188
756 Ga0307416_100112887
757 Ga0307415_100262838
758 Ga0373940_0138913
759 Ga0373947_0276062
760 Ga0373937_0070645
761 Ga0373937_0722968
762 Ga0451853_2102406
763 Ga0439460_0234273
764 Ga0451577_0680130
765 Ga0453683_0001666
766 Ga0451576_0918105
767 Ga0495662_0114913
768 Ga0495640_0593749
769 Ga0495586_0429930
770 Ga0495587_0335452
771 Ga0495621_0012065
772 Ga0495645_0009381
773 Ga0495656_0007876
774 Ga0495634_0236235
775 Ga0495599_0173000
776 Ga0495647_0074372
777 Ga0495669_0008995
778 Ga0495675_0383553
779 Ga0495684_0325497
780 Ga0495602_0261385
781 Ga0496101_0191594
782 Ga0496102_0040537
783 Ga0496102_0539839
784 Ga0496103_0365799
785 Ga0496104_0003957
786 Ga0496104_0205201
787 Ga0496105_0203152
788 Ga0496105_0338118
789 Ga0496107_0421701
790 Ga0496108_0009376
791 Ga0496109_0007788
792 Ga0496109_0056102
793 Ga0496109_0182247
794 Ga0496110_0000770
795 Ga0496110_0237058
796 Ga0496110_0524187
797 Ga0496111_0073475
798 Ga0496112_0001715
799 Ga0496112_0042883
800 Ga0496112_0117479
801 Ga0496113_0030265
802 Ga0496113_0345759
803 Ga0496114_0086635
804 Ga0496114_0197481
805 Ga0496114_0878899
806 Ga0501040_0128564
807 Ga0501048_0029524
808 Ga0501075_0176945
809 Ga0501076_0033775
810 Ga0501076_0455798
811 Ga0501079_0028260
812 Ga0501080_0095478
813 Ga0501081_0030625
814 Ga0501044_0236063
815 nmdc:mga03683_12346_c1
816 nmdc:mga00v17_25564_c1
817 nmdc:mga00v17_289396_c1
818 nmdc:mga0yw44_134589_c1
819 nmdc:mga06z11_101598_c1
820 nmdc:mga06z11_11313_c1
821 nmdc:mga06z11_14531_c1
822 nmdc:mga05p37_112248_c1
823 nmdc:mga05p37_13854_c1
824 nmdc:mga05p37_156621_c1
825 nmdc:mga05p37_192348_c1
826 nmdc:mga05p37_287536_c1
827 nmdc:mga05p37_386898_c1
828 nmdc:mga05p37_578225_c1
829 nmdc:mga05p37_880100_c1
830 nmdc:mga09592_13417_c1
831 nmdc:mga09592_271912_c1
832 nmdc:mga09592_29229_c1
833 nmdc:mga09592_476066_c1
834 nmdc:mga09592_590412_c1
835 nmdc:mga0qj67_87989_c1
836 nmdc:mga0qj67_93558_c1
837 nmdc:mga06r32_1110224_c1
838 nmdc:mga06r32_328421_c1
839 nmdc:mga06r32_356153_c1
840 nmdc:mga06r32_41108_c1
841 nmdc:mga08y16_12263_c1
842 nmdc:mga08y16_1288457_c1
843 nmdc:mga08y16_1384734_c1
844 nmdc:mga08y16_168043_c1
845 nmdc:mga08y16_17338_c1
846 nmdc:mga08y16_191041_c1
847 nmdc:mga08y16_2338_c2
848 nmdc:mga08y16_252528_c1
849 nmdc:mga08y16_314985_c1
850 nmdc:mga08y16_70550_c1
851 nmdc:mga08y16_76395_c1
852 nmdc:mga0n895_197491_c1
853 nmdc:mga0n895_59675_c1
854 nmdc:mga0n895_671228_c1
855 nmdc:mga0n895_742731_c1
856 nmdc:mga0n895_877868_c1
857 nmdc:mga0rr50_19701_c1
858 nmdc:mga0rr50_228838_c1
859 nmdc:mga0rr50_266697_c1
860 nmdc:mga0rr50_763471_c1
861 nmdc:mga0rr50_91905_c1
862 nmdc:mga08x19_195146_c1
863 nmdc:mga08x19_20544_c1
864 nmdc:mga08x19_679262_c1
865 nmdc:mga0a205_1131689_c1
866 nmdc:mga0a205_845469_c1
867 Ga0495595_0040713
868 Ga0495619_0231303
869 Ga0495619_0492307
870 Ga0500658_0203599
871 Ga0501082_0192832
872 Ga0530510_0196040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dte-assembly1.cif.gz_A crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae 0.481 25 145
3dti-assembly1.cif.gz_A crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae 0.4722 23 148
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.4615 22 118
3ehg-assembly1.cif.gz_A crystal structure of the atp-binding domain of desk in complex with atp 0.4493 27 88
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.4366 24 130
ID Description Score Start End Superfamily
af_Q2FXE0_43_154_1.10.10.2910 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.7003 38 128 1.10.10.2910
3dtiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.572 23 128 1.10.10.2910
af_Q2FXE0_43_154_1.10.10.2910 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.5431 38 128 1.10.10.2910
3dtiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.5193 23 128 1.10.10.2910
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.4366 24 130 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A5B9W909-F1-model_v4 Uncharacterized protein 0.9314 15 193
AF-A0A5B9W909-F1-model_v4 Uncharacterized protein 0.9263 15 193
AF-A0A2V9XEV3-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9101 31 84
AF-A0A4P5X6D3-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.8968 23 190
AF-A0A2V9QIJ2-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.8919 26 190

Map