F443487

General Info

Members Datasets Scaffolds Average Seq Length
436 275 432 145

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101494139|Ga0070713_1014941391
Length 165
Sequence MLKRRSNATCRPAPRAPGRMTAMATDDPYDLQRFVAAQDAGGTYQQALAELRAGRKTSHWMWFVFPQIAGLGYSPTSRVYAITSLAEARAYLAHQVLGARLIECAGVLAGLRGRTAEQVFGEVDALKLCSSMTLFLHAAPGEPVFRQVLDQYFGGMTDSATEQRI

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
3 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
4 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
82 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
83 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
84 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.92
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 6.65
Rhizosphere 90.14
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01DJH1A 2088090003 Bacteria 527
2 Ga0070690_100018149 3300005330 Bacteria 4243
3 Ga0068869_100254215 3300005334 Bacteria 1404
4 Ga0070682_100092387 3300005337 Bacteria 1982
5 Ga0070682_100150913 3300005337 Bacteria 1594
6 Ga0068868_100125376 3300005338 Bacteria 2097
7 Ga0070660_100503604 3300005339 Bacteria 1007
8 Ga0070689_100082073 3300005340 Bacteria 2531
9 Ga0070691_10036635 3300005341 Bacteria 2312
10 Ga0070661_100000004 3300005344 Bacteria 243876
11 Ga0070692_10469580 3300005345 Bacteria 809
12 Ga0070668_100701183 3300005347 Bacteria 893
13 Ga0070669_100151741 3300005353 Bacteria 1794
14 Ga0070675_100077815 3300005354 Bacteria 2761
15 Ga0070675_100675738 3300005354 Bacteria 939
16 Ga0070671_100442462 3300005355 Bacteria 1114
17 Ga0070671_100849874 3300005355 Bacteria 796
18 Ga0070688_100911818 3300005365 Bacteria 694
19 Ga0070659_100090917 3300005366 Bacteria 2446
20 Ga0070659_101073337 3300005366 Bacteria 709
21 Ga0070659_101587161 3300005366 Bacteria 584
22 Ga0070667_100640910 3300005367 Bacteria 981
23 Ga0070667_100878689 3300005367 Bacteria 834
24 Ga0070703_10114108 3300005406 Bacteria 971
25 Ga0070709_10047343 3300005434 Bacteria 2678
26 Ga0070709_10594231 3300005434 Bacteria 851
27 Ga0070714_100883473 3300005435 Bacteria 867
28 Ga0070713_100132747 3300005436 Bacteria 2197
29 Ga0070713_100146682 3300005436 Bacteria 2095
30 Ga0070713_101494139 3300005436 Bacteria 656
31 Ga0070710_10087914 3300005437 Bacteria 1827
32 Ga0070710_10089460 3300005437 Bacteria 1813
33 Ga0070711_100114807 3300005439 Bacteria 1982
34 Ga0070705_100049256 3300005440 Bacteria 2445
35 Ga0070708_100096284 3300005445 Bacteria 2703
36 Ga0070678_100190154 3300005456 Bacteria 1687
37 Ga0070662_100027960 3300005457 Bacteria 3921
38 Ga0070681_10933609 3300005458 Bacteria 786
39 Ga0070706_100009266 3300005467 Bacteria 9172
40 Ga0070706_100207120 3300005467 Bacteria 1831
41 Ga0070706_100424716 3300005467 Bacteria 1237
42 Ga0070707_100004246 3300005468 Bacteria 13412
43 Ga0070707_100231668 3300005468 Bacteria 1798
44 Ga0070707_100502870 3300005468 Bacteria 1174
45 Ga0070707_100677797 3300005468 Bacteria 994
46 Ga0070707_100725789 3300005468 Bacteria 957
47 Ga0070698_100100562 3300005471 Bacteria 2864
48 Ga0070698_100593653 3300005471 Bacteria 1048
49 Ga0070699_100000682 3300005518 Bacteria 31654
50 Ga0070679_100233514 3300005530 Bacteria 1798
51 Ga0070684_100367912 3300005535 Bacteria 1323
52 Ga0070697_100322157 3300005536 Bacteria 1331
53 Ga0070697_101113632 3300005536 Bacteria 703
54 Ga0068853_100087600 3300005539 Bacteria 2732
55 Ga0070686_100276412 3300005544 Bacteria 1237
56 Ga0070693_100083501 3300005547 Bacteria 1909
57 Ga0070665_100006013 3300005548 Bacteria 12407
58 Ga0070665_100122260 3300005548 Bacteria 2605
59 Ga0070704_100043041 3300005549 Bacteria 3128
60 Ga0068855_100302884 3300005563 Bacteria 1770
61 Ga0070664_100235104 3300005564 Bacteria 1644
62 Ga0068857_100090744 3300005577 Bacteria 2734
63 Ga0068857_100184058 3300005577 Bacteria 1901
64 Ga0068854_100050416 3300005578 Bacteria 2978
65 Ga0068852_100062567 3300005616 Bacteria 3237
66 Ga0068864_100000930 3300005618 Bacteria 24547
67 Ga0068866_10100658 3300005718 Bacteria 1594
68 Ga0068866_11038032 3300005718 Bacteria 584
69 Ga0068861_100093032 3300005719 Bacteria 2383
70 Ga0068861_100110425 3300005719 Bacteria 2202
71 Ga0068851_10131273 3300005834 Bacteria 1355
72 Ga0068870_10343292 3300005840 Bacteria 956
73 Ga0068863_100098250 3300005841 Bacteria 2780
74 Ga0068858_100000022 3300005842 Bacteria 169718
75 Ga0068858_100154409 3300005842 Bacteria 2159
76 Ga0068860_100110015 3300005843 Bacteria 2633
77 Ga0068862_100399330 3300005844 Bacteria 1286
78 Ga0081540_1000824 3300005983 Bacteria 28336
79 Ga0070717_10182437 3300006028 Bacteria 1830
80 Ga0070717_10433541 3300006028 Bacteria 1183
81 Ga0070717_10670561 3300006028 Bacteria 941
82 Ga0070717_11402467 3300006028 Bacteria 634
83 Ga0070716_100007263 3300006173 Bacteria 5447
84 Ga0070716_100103755 3300006173 Bacteria 1749
85 Ga0070712_100030396 3300006175 Bacteria 3628
86 Ga0070712_100076212 3300006175 Bacteria 2414
87 Ga0070712_100386258 3300006175 Bacteria 1153
88 Ga0097621_100075052 3300006237 Bacteria 2801
89 Ga0075370_10055587 3300006353 Bacteria 2249
90 Ga0068871_100152049 3300006358 Bacteria 1974
91 Ga0068871_100268847 3300006358 Bacteria 1489
92 Ga0075431_101506105 3300006847 Bacteria 631
93 Ga0075434_101080464 3300006871 Bacteria 816
94 Ga0075434_101366421 3300006871 Bacteria 719
95 Ga0075429_100800526 3300006880 Bacteria 825
96 Ga0068865_101317074 3300006881 Bacteria 643
97 Ga0075435_100460345 3300007076 Bacteria 1097
98 Ga0099795_10378047 3300007788 Bacteria 639
99 Ga0105240_10195822 3300009093 Bacteria 2373
100 Ga0111539_10086651 3300009094 Unclassified 3680
101 Ga0105245_10923840 3300009098 Bacteria 915
102 Ga0105247_10041186 3300009101 Bacteria 2826
103 Ga0105247_10141648 3300009101 Bacteria 1576
104 Ga0105247_10727071 3300009101 Bacteria 750
105 Ga0114129_10006106 3300009147 Bacteria 17081
106 Ga0114129_10292176 3300009147 Bacteria 2175
107 Ga0105243_10116052 3300009148 Bacteria 2248
108 Ga0105243_11515557 3300009148 Bacteria 695
109 Ga0105248_10072238 3300009177 Bacteria 3878
110 Ga0105248_10116473 3300009177 Bacteria 3014
111 Ga0105248_12231981 3300009177 Bacteria 623
112 Ga0105237_10889639 3300009545 Bacteria 897
113 Ga0105237_11944704 3300009545 Bacteria 596
114 Ga0105237_12004525 3300009545 Bacteria 587
115 Ga0105239_10526327 3300010375 Bacteria 1345
116 Ga0105246_11729748 3300011119 Bacteria 595
117 Ga0157323_1028930 3300012495 Bacteria 577
118 Ga0157314_1011178 3300012500 Bacteria 787
119 Ga0157342_1055254 3300012507 Bacteria 569
120 Ga0157338_1056223 3300012515 Bacteria 579
121 Ga0157373_10039780 3300013100 Bacteria 3365
122 Ga0157371_10032698 3300013102 Bacteria 3742
123 Ga0157370_10537820 3300013104 Bacteria 1072
124 Ga0157369_10613385 3300013105 Bacteria 1123
125 Ga0157369_10792223 3300013105 Bacteria 974
126 Ga0157374_10488464 3300013296 Bacteria 1235
127 Ga0157374_11007131 3300013296 Bacteria 852
128 Ga0157374_11682334 3300013296 Bacteria 659
129 Ga0157378_10847157 3300013297 Bacteria 942
130 Ga0163162_10024602 3300013306 Bacteria 5946
131 Ga0157372_10138057 3300013307 Bacteria 2808
132 Ga0157372_11088441 3300013307 Bacteria 925
133 Ga0157375_10136034 3300013308 Bacteria 2581
134 Ga0163163_10254190 3300014325 Bacteria 1808
135 Ga0163163_10265264 3300014325 Bacteria 1768
136 Ga0182008_10067760 3300014497 Bacteria 1756
137 Ga0182008_10119499 3300014497 Bacteria 1309
138 Ga0157377_10033266 3300014745 Bacteria 2813
139 Ga0157379_10402583 3300014968 Bacteria 1258
140 Ga0182005_1040190 3300015265 Unclassified 1272
141 Ga0163161_10426300 3300017792 Bacteria 1068
142 Ga0206353_10549335 3300020082 Bacteria 899
143 Ga0207697_10229015 3300025315 Bacteria 820
144 Ga0207653_10116753 3300025885 Bacteria 957
145 Ga0207692_10060640 3300025898 Bacteria 1957
146 Ga0207642_10090037 3300025899 Bacteria 1513
147 Ga0207710_10090045 3300025900 Bacteria 1434
148 Ga0207680_10489803 3300025903 Bacteria 875
149 Ga0207685_10111695 3300025905 Bacteria 1186
150 Ga0207699_10060098 3300025906 Bacteria 2280
151 Ga0207699_10224455 3300025906 Bacteria 1284
152 Ga0207645_10092283 3300025907 Bacteria 1948
153 Ga0207643_10006027 3300025908 Bacteria 6479
154 Ga0207684_10020450 3300025910 Bacteria 5656
155 Ga0207684_10066700 3300025910 Bacteria 3057
156 Ga0207684_10504423 3300025910 Bacteria 1037
157 Ga0207693_10019920 3300025915 Bacteria 5335
158 Ga0207693_10125669 3300025915 Bacteria 2016
159 Ga0207693_10174023 3300025915 Bacteria 1694
160 Ga0207693_10328579 3300025915 Bacteria 1197
161 Ga0207663_10043034 3300025916 Bacteria 2763
162 Ga0207662_10061263 3300025918 Bacteria 2259
163 Ga0207657_10066131 3300025919 Bacteria 3078
164 Ga0207649_10000003 3300025920 Bacteria 388908
165 Ga0207646_10087251 3300025922 Bacteria 2792
166 Ga0207646_10307515 3300025922 Bacteria 1432
167 Ga0207646_10393407 3300025922 Bacteria 1252
168 Ga0207646_10864069 3300025922 Bacteria 804
169 Ga0207681_10506860 3300025923 Bacteria 989
170 Ga0207694_10352564 3300025924 Bacteria 1218
171 Ga0207659_10727722 3300025926 Bacteria 850
172 Ga0207687_10258800 3300025927 Bacteria 1387
173 Ga0207700_10019614 3300025928 Bacteria 4569
174 Ga0207700_10020832 3300025928 Bacteria 4463
175 Ga0207700_10651174 3300025928 Bacteria 939
176 Ga0207700_11402348 3300025928 Bacteria 621
177 Ga0207664_10020229 3300025929 Bacteria 4930
178 Ga0207664_10070181 3300025929 Bacteria 2819
179 Ga0207664_10454488 3300025929 Bacteria 1143
180 Ga0207664_10852627 3300025929 Bacteria 819
181 Ga0207664_10986321 3300025929 Bacteria 755
182 Ga0207690_10210462 3300025932 Bacteria 1482
183 Ga0207706_10033370 3300025933 Bacteria 4583
184 Ga0207709_10089976 3300025935 Bacteria 2003
185 Ga0207665_10008206 3300025939 Bacteria 6896
186 Ga0207665_10048695 3300025939 Bacteria 2846
187 Ga0207711_10024043 3300025941 Bacteria 5100
188 Ga0207711_10105243 3300025941 Bacteria 2502
189 Ga0207711_10714530 3300025941 Bacteria 934
190 Ga0207689_10030711 3300025942 Bacteria 4477
191 Ga0207661_10653501 3300025944 Bacteria 966
192 Ga0207679_10371806 3300025945 Bacteria 1251
193 Ga0207667_11478036 3300025949 Bacteria 651
194 Ga0207712_10417116 3300025961 Bacteria 1131
195 Ga0207640_10106804 3300025981 Bacteria 1975
196 Ga0207658_10704854 3300025986 Bacteria 912
197 Ga0207677_10345206 3300026023 Bacteria 1245
198 Ga0207703_10000048 3300026035 Bacteria 151143
199 Ga0207703_11111196 3300026035 Bacteria 759
200 Ga0207639_10307405 3300026041 Bacteria 1403
201 Ga0207678_10003453 3300026067 Bacteria 14241
202 Ga0207702_10019227 3300026078 Bacteria 5650
203 Ga0207702_10494398 3300026078 Bacteria 1192
204 Ga0207648_10032654 3300026089 Bacteria 4594
205 Ga0207676_10000239 3300026095 Bacteria 47772
206 Ga0207676_11273851 3300026095 Bacteria 729
207 Ga0207674_10005432 3300026116 Bacteria 15141
208 Ga0207675_100213941 3300026118 Bacteria 1855
209 Ga0207675_100275646 3300026118 Bacteria 1633
210 Ga0207683_10370663 3300026121 Bacteria 1315
211 Ga0207683_10708299 3300026121 Bacteria 933
212 Ga0268266_10015036 3300028379 Bacteria 6644
213 Ga0268266_10503641 3300028379 Bacteria 1156
214 Ga0265763_1040003 3300030763 Bacteria 562
215 Ga0265770_1128721 3300030878 Bacteria 539
216 Ga0265760_10049146 3300031090 Bacteria 1268
217 Ga0307408_101027728 3300031548 Bacteria 761
218 Ga0307415_101094575 3300032126 Bacteria 746
219 Ga0307415_101187188 3300032126 Bacteria 718
220 Ga0373948_0032555 3300034817 Bacteria 1058
221 Ga0373958_0025175 3300034819 Bacteria 1131
222 Ga0373926_0000761 3300035083 Bacteria 9026
223 Ga0373928_0016884 3300035084 Bacteria 1497
224 Ga0373934_0004895 3300035086 Bacteria 4955
225 Ga0373940_0337212 3300035088 Bacteria 526
226 Ga0373944_0001900 3300035089 Bacteria 5280
227 Ga0373949_0012054 3300035090 Bacteria 1909
228 Ga0373952_0022850 3300035092 Bacteria 1332
229 Ga0373923_0000124 3300035111 Bacteria 14180
230 Ga0373932_0004292 3300035112 Bacteria 3383
231 Ga0373936_0000187 3300035113 Bacteria 20656
232 Ga0373936_0119002 3300035113 Bacteria 1127
233 Ga0373941_0038482 3300035115 Bacteria 1465
234 Ga0373945_0001244 3300035116 Bacteria 7743
235 Ga0373953_0001294 3300035117 Bacteria 7174
236 Ga0373954_0028107 3300035118 Bacteria 2583
237 Ga0373956_0022847 3300035119 Bacteria 2679
238 Ga0373957_0047911 3300035120 Bacteria 1627
239 Ga0373957_0173952 3300035120 Bacteria 890
240 Ga0373943_0016225 3300035170 Bacteria 3394
241 Ga0373943_0287043 3300035170 Bacteria 932
242 Ga0373946_0000543 3300035171 Bacteria 12518
243 Ga0373955_0007724 3300035172 Bacteria 4954
244 Ga0373955_0079343 3300035172 Bacteria 1851
245 Ga0373962_0008870 3300035242 Bacteria 2483
246 Ga0373924_0001045 3300035410 Bacteria 8804
247 Ga0373935_0009226 3300035692 Bacteria 5903
248 Ga0373935_0207937 3300035692 Bacteria 1355
249 Ga0373935_0502415 3300035692 Bacteria 880
250 Ga0373927_0009479 3300035695 Bacteria 6528
251 Ga0373933_0012809 3300035724 Bacteria 4637
252 Ga0373933_0593034 3300035724 Bacteria 727
253 Ga0373947_0003228 3300035725 Bacteria 9674
254 Ga0373937_0006504 3300036401 Bacteria 10085
255 Ga0373937_0020351 3300036401 Bacteria 5949
256 Ga0373937_0104952 3300036401 Bacteria 2625
257 Ga0373925_0000710 3300037068 Bacteria 31112
258 Ga0395900_0048005 3300037418 Bacteria 4397
259 Ga0395900_0255462 3300037418 Bacteria 1752
260 Ga0395898_0011357 3300037466 Bacteria 9254
261 Ga0395898_0368604 3300037466 Bacteria 1370
262 Ga0395905_0125588 3300037471 Bacteria 2412
263 Ga0436364_0695951 3300037853 Bacteria 3878
264 Ga0436364_1517018 3300037853 Bacteria 10872
265 Ga0436365_1458933 3300039437 Bacteria 617
266 Ga0436360_0489904 3300039438 Bacteria 724
267 Ga0436363_0688255 3300039450 Bacteria 501
268 Ga0436363_1003852 3300039450 Unclassified 540
269 Ga0436362_0954635 3300039453 Bacteria 1351
270 Ga0451793_0703339 3300041452 Bacteria 643
271 Ga0451797_0165164 3300041453 Bacteria 1184
272 Ga0451802_1302443 3300041460 Bacteria 978
273 Ga0451802_1596096 3300041460 Bacteria 1235
274 Ga0451849_0616188 3300041505 Bacteria 848
275 Ga0466963_0260446 3300044694 Bacteria 1218
276 Ga0451576_1335649 3300045051 Bacteria 747
277 Ga0466967_0427866 3300045976 Bacteria 1291
278 Ga0495592_0023412 3300046454 Bacteria 4696
279 Ga0495592_0065640 3300046454 Bacteria 2656
280 Ga0495592_0465575 3300046454 Bacteria 790
281 Ga0495603_0020816 3300046455 Bacteria 3971
282 Ga0495629_0012759 3300046459 Bacteria 6081
283 Ga0495641_0007073 3300046461 Bacteria 7103
284 Ga0495651_0000444 3300046462 Bacteria 31916
285 Ga0495651_0026443 3300046462 Bacteria 4520
286 Ga0495651_0326814 3300046462 Bacteria 1020
287 Ga0495653_0015420 3300046463 Bacteria 6229
288 Ga0495653_0253337 3300046463 Bacteria 1167
289 Ga0495653_0385864 3300046463 Bacteria 893
290 Ga0495580_0037558 3300046472 Bacteria 3474
291 Ga0495582_0002868 3300046473 Bacteria 9640
292 Ga0495639_0003241 3300046475 Bacteria 7069
293 Ga0495662_0001521 3300046476 Bacteria 11507
294 Ga0495662_0018551 3300046476 Bacteria 3368
295 Ga0495664_0013136 3300046477 Bacteria 4696
296 Ga0495594_0035660 3300046499 Bacteria 2710
297 Ga0495608_0003665 3300046511 Bacteria 11045
298 Ga0495608_0020366 3300046511 Bacteria 4558
299 Ga0495608_0038902 3300046511 Bacteria 3191
300 Ga0495618_0075937 3300046514 Bacteria 2140
301 Ga0495618_0085937 3300046514 Bacteria 2011
302 Ga0495618_0089274 3300046514 Bacteria 1971
303 Ga0495618_0499387 3300046514 Bacteria 733
304 Ga0495628_0015357 3300046516 Bacteria 6395
305 Ga0495628_0029822 3300046516 Bacteria 4420
306 Ga0495628_0144589 3300046516 Bacteria 1813
307 Ga0495630_0000690 3300046517 Bacteria 24225
308 Ga0495630_0149773 3300046517 Bacteria 1775
309 Ga0495630_0221868 3300046517 Bacteria 1443
310 Ga0495630_0536557 3300046517 Bacteria 897
311 Ga0495631_0459569 3300046518 Bacteria 542
312 Ga0495666_0003593 3300046526 Bacteria 7842
313 Ga0495652_0000159 3300046529 Bacteria 77012
314 Ga0495652_0153299 3300046529 Bacteria 1797
315 Ga0495652_0236815 3300046529 Bacteria 1361
316 Ga0495652_0270754 3300046529 Bacteria 1248
317 Ga0495652_0362971 3300046529 Bacteria 1034
318 Ga0495654_0373327 3300046530 Bacteria 570
319 Ga0495665_0000714 3300046531 Bacteria 17144
320 Ga0495665_0504657 3300046531 Bacteria 609
321 Ga0495640_0001225 3300046533 Bacteria 20089
322 Ga0495640_0013988 3300046533 Bacteria 6089
323 Ga0495586_0015134 3300046535 Bacteria 4104
324 Ga0495587_0000767 3300046536 Bacteria 21413
325 Ga0495587_0014787 3300046536 Bacteria 4885
326 Ga0495587_0027124 3300046536 Bacteria 3488
327 Ga0495645_0004159 3300046543 Bacteria 9889
328 Ga0495645_0011888 3300046543 Bacteria 6135
329 Ga0495645_0042349 3300046543 Bacteria 3320
330 Ga0495645_0168814 3300046543 Bacteria 1507
331 Ga0495622_0046284 3300046557 Bacteria 2021
332 Ga0495622_0420692 3300046557 Bacteria 574
333 Ga0495667_0003094 3300046559 Bacteria 11158
334 Ga0495667_0213948 3300046559 Bacteria 1231
335 Ga0495634_0007638 3300046642 Bacteria 8099
336 Ga0495634_0052373 3300046642 Bacteria 2736
337 Ga0495634_0119674 3300046642 Bacteria 1687
338 Ga0495634_0171996 3300046642 Bacteria 1361
339 Ga0495635_0006316 3300046663 Bacteria 8257
340 Ga0495635_0114915 3300046663 Bacteria 1837
341 Ga0495635_0160669 3300046663 Bacteria 1529
342 Ga0495635_0451855 3300046663 Bacteria 849
343 Ga0495635_0706746 3300046663 Bacteria 653
344 Ga0495588_0171712 3300046674 Bacteria 1146
345 Ga0495657_0001225 3300046675 Bacteria 22494
346 Ga0495657_0050279 3300046675 Bacteria 2802
347 Ga0495657_0191611 3300046675 Bacteria 1249
348 Ga0495599_0002030 3300046678 Bacteria 11712
349 Ga0495599_0025867 3300046678 Bacteria 3676
350 Ga0495599_0084249 3300046678 Bacteria 1985
351 Ga0495599_0211532 3300046678 Bacteria 1189
352 Ga0495623_0011352 3300046679 Bacteria 5763
353 Ga0495623_0042520 3300046679 Bacteria 2894
354 Ga0495623_0115561 3300046679 Bacteria 1622
355 Ga0495623_0144047 3300046679 Bacteria 1415
356 Ga0495646_0005348 3300046680 Bacteria 8103
357 Ga0495646_0124457 3300046680 Bacteria 1456
358 Ga0495646_0204415 3300046680 Bacteria 1074
359 Ga0495647_0006478 3300046681 Bacteria 3880
360 Ga0495658_0002793 3300046683 Bacteria 8773
361 Ga0495613_0074586 3300046689 Bacteria 2470
362 Ga0495624_0000780 3300046690 Bacteria 25115
363 Ga0495600_0001844 3300046809 Bacteria 11873
364 Ga0495600_0060682 3300046809 Bacteria 2469
365 Ga0495600_0075974 3300046809 Bacteria 2193
366 Ga0495581_0002815 3300047315 Bacteria 9932
367 Ga0495604_0002683 3300047317 Bacteria 14270
368 Ga0495604_0032412 3300047317 Bacteria 4141
369 Ga0495604_0550870 3300047317 Bacteria 744
370 Ga0495674_0002259 3300047319 Bacteria 18936
371 Ga0495674_0007120 3300047319 Bacteria 10702
372 Ga0495674_0028879 3300047319 Bacteria 5052
373 Ga0495674_0091121 3300047319 Bacteria 2604
374 Ga0495674_0183878 3300047319 Bacteria 1739
375 Ga0495676_0003733 3300047321 Bacteria 13830
376 Ga0495680_0007702 3300047322 Bacteria 9830
377 Ga0495680_0016971 3300047322 Bacteria 6233
378 Ga0495680_0245117 3300047322 Bacteria 1271
379 Ga0495680_0393776 3300047322 Bacteria 957
380 Ga0495675_0013866 3300047444 Bacteria 5095
381 Ga0495675_0031547 3300047444 Bacteria 3383
382 Ga0495675_0641016 3300047444 Bacteria 599
383 Ga0495684_0002248 3300047471 Bacteria 15460
384 Ga0495684_0013779 3300047471 Bacteria 6222
385 Ga0495593_0000853 3300047673 Bacteria 17662
386 Ga0495602_0001444 3300048088 Bacteria 23598
387 Ga0495602_0166285 3300048088 Bacteria 1716
388 Ga0495602_0278661 3300048088 Bacteria 1233
389 Ga0495602_0390602 3300048088 Bacteria 994
390 Ga0495614_0017054 3300048089 Bacteria 3156
391 Ga0496100_0005711 3300048903 Bacteria 6729
392 Ga0496100_0024230 3300048903 Bacteria 3698
393 Ga0496101_0278221 3300048904 Bacteria 1307
394 Ga0496102_0601258 3300048905 Bacteria 1023
395 Ga0496102_0968639 3300048905 Bacteria 771
396 Ga0496103_0151906 3300048906 Bacteria 1483
397 Ga0496103_0287379 3300048906 Bacteria 1058
398 Ga0496104_0285310 3300048907 Bacteria 1564
399 Ga0496105_0069021 3300048908 Bacteria 2920
400 Ga0496105_0093654 3300048908 Bacteria 2481
401 Ga0496106_0510873 3300048909 Bacteria 965
402 Ga0496106_0783549 3300048909 Bacteria 757
403 Ga0496107_0062422 3300048910 Bacteria 2699
404 Ga0496107_0500321 3300048910 Bacteria 901
405 Ga0496108_0168421 3300048911 Bacteria 1894
406 Ga0496109_0966333 3300048912 Bacteria 789
407 Ga0496110_0066763 3300048913 Bacteria 3181
408 Ga0496111_0094497 3300048914 Bacteria 2192
409 Ga0496112_0069726 3300048915 Bacteria 3472
410 Ga0496113_0019253 3300048916 Bacteria 4771
411 Ga0496113_0099644 3300048916 Bacteria 2250
412 Ga0496113_0977337 3300048916 Bacteria 667
413 Ga0496114_0171962 3300048917 Bacteria 1888
414 Ga0496115_0039617 3300048918 Bacteria 3743
415 Ga0496115_0131433 3300048918 Bacteria 2063
416 Ga0496121_0417048 3300048924 Bacteria 875
417 Ga0496125_0412360 3300048928 Bacteria 786
418 Ga0496126_0089979 3300048929 Bacteria 2701
419 nmdc:mga07m45_1083_c1 3300050496 Bacteria 12127
420 nmdc:mga05p37_55289_c1 3300050507 Unclassified 4884
421 nmdc:mga09592_734007_c1 3300050508 Bacteria 839
422 nmdc:mga08y16_240787_c1 3300050511 Unclassified 1870
423 nmdc:mga0n895_29353_c1 3300050512 Bacteria 5244
424 nmdc:mga0rr50_181201_c1 3300050513 Bacteria 1722
425 nmdc:mga0rr50_447327_c1 3300050513 Bacteria 1095
426 nmdc:mga0a205_59911_c1 3300050515 Unclassified 3677
427 Ga0495601_0003542 3300053077 Bacteria 8975
428 Ga0495601_0473573 3300053077 Bacteria 809
429 Ga0495612_0000732 3300053078 Bacteria 13334
430 Ga0495595_0003218 3300053084 Bacteria 6482
431 Ga0495595_0459159 3300053084 Bacteria 648
432 Ga0495619_0006860 3300053085 Bacteria 7202

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_101080464 Ga0075434_1010804641 124
2 3300012507 Ga0157342_1055254 Ga0157342_10552541 124
3 iso_pu_bacteria 2728369276 2729908223 131
4 3300005355 Ga0070671_100442462 Ga0070671_1004424622 132
5 3300011119 Ga0105246_11729748 Ga0105246_117297481 132
6 3300013296 Ga0157374_11682334 Ga0157374_116823341 132
7 3300025986 Ga0207658_10704854 Ga0207658_107048542 133
8 3300048928 Ga0496125_0412360 Ga0496125_0412360_176_583 133
9 3300006353 Ga0075370_10055587 Ga0075370_100555874 134
10 3300050496 nmdc:mga07m45_1083_c1 nmdc:mga07m45_1083_c1_10848_11258 134
11 3300005344 Ga0070661_100000004 Ga0070661_100000004143 135
12 3300012495 Ga0157323_1028930 Ga0157323_10289301 135
13 3300025920 Ga0207649_10000003 Ga0207649_10000003116 135
14 3300039450 Ga0436363_0688255 Ga0436363_0688255_33_443 135
15 3300048924 Ga0496121_0417048 Ga0496121_0417048_307_714 135
16 3300005347 Ga0070668_100701183 Ga0070668_1007011832 136
17 3300005366 Ga0070659_101587161 Ga0070659_1015871611 136
18 3300005718 Ga0068866_11038032 Ga0068866_110380321 136
19 3300026121 Ga0207683_10370663 Ga0207683_103706632 136
20 3300032126 Ga0307415_101094575 Ga0307415_1010945752 136
21 3300037418 Ga0395900_0048005 Ga0395900_0048005_629_1048 136
22 3300037466 Ga0395898_0368604 Ga0395898_0368604_565_984 136
23 3300041452 Ga0451793_0703339 Ga0451793_0703339_149_568 136
24 3300048907 Ga0496104_0285310 Ga0496104_0285310_57_479 136
25 3300048908 Ga0496105_0093654 Ga0496105_0093654_1847_2269 136
26 iso_pu_bacteria 2643221961 2645720558 136
27 3300037466 Ga0395898_0011357 Ga0395898_0011357_3956_4372 137
28 iso_pu_bacteria 2808606371 2808896642 137
29 3300005355 Ga0070671_100849874 Ga0070671_1008498742 138
30 3300005436 Ga0070713_100146682 Ga0070713_1001466822 138
31 3300005616 Ga0068852_100062567 Ga0068852_1000625672 138
32 3300025928 Ga0207700_10020832 Ga0207700_100208323 138
33 3300046518 Ga0495631_0459569 Ga0495631_0459569_15_452 138
34 3300048929 Ga0496126_0089979 Ga0496126_0089979_497_919 138
35 3300005366 Ga0070659_101073337 Ga0070659_1010733371 139
36 3300005367 Ga0070667_100878689 Ga0070667_1008786892 139
37 3300005618 Ga0068864_100000930 Ga0068864_10000093014 139
38 3300005719 Ga0068861_100093032 Ga0068861_1000930323 139
39 3300005842 Ga0068858_100000022 Ga0068858_100000022105 139
40 3300006358 Ga0068871_100268847 Ga0068871_1002688473 139
41 3300006847 Ga0075431_101506105 Ga0075431_1015061051 139
42 3300006880 Ga0075429_100800526 Ga0075429_1008005262 139
43 3300007076 Ga0075435_100460345 Ga0075435_1004603452 139
44 3300009094 Ga0111539_10086651 Ga0111539_100866516 139
45 3300009101 Ga0105247_10041186 Ga0105247_100411862 139
46 3300009147 Ga0114129_10006106 Ga0114129_100061063 139
47 3300009148 Ga0105243_10116052 Ga0105243_101160522 139
48 3300009177 Ga0105248_10072238 Ga0105248_100722384 139
49 3300009177 Ga0105248_10116473 Ga0105248_101164735 139
50 3300013306 Ga0163162_10024602 Ga0163162_100246026 139
51 3300025315 Ga0207697_10229015 Ga0207697_102290152 139
52 3300025900 Ga0207710_10090045 Ga0207710_100900452 139
53 3300025941 Ga0207711_10024043 Ga0207711_100240434 139
54 3300025941 Ga0207711_10105243 Ga0207711_101052433 139
55 3300025961 Ga0207712_10417116 Ga0207712_104171162 139
56 3300026035 Ga0207703_10000048 Ga0207703_10000048106 139
57 3300026095 Ga0207676_10000239 Ga0207676_1000023921 139
58 3300026118 Ga0207675_100213941 Ga0207675_1002139412 139
59 3300031548 Ga0307408_101027728 Ga0307408_1010277281 139
60 3300032126 Ga0307415_101187188 Ga0307415_1011871881 139
61 3300037418 Ga0395900_0255462 Ga0395900_0255462_230_673 139
62 3300037471 Ga0395905_0125588 Ga0395905_0125588_573_1016 139
63 3300041453 Ga0451797_0165164 Ga0451797_0165164_588_1007 139
64 3300041460 Ga0451802_1596096 Ga0451802_1596096_745_1164 139
65 3300041505 Ga0451849_0616188 Ga0451849_0616188_234_653 139
66 3300045051 Ga0451576_1335649 Ga0451576_1335649_54_473 139
67 3300048088 Ga0495602_0278661 Ga0495602_0278661_517_1017 139
68 3300048903 Ga0496100_0005711 Ga0496100_0005711_1127_1558 139
69 3300048906 Ga0496103_0287379 Ga0496103_0287379_567_1004 139
70 3300048909 Ga0496106_0510873 Ga0496106_0510873_157_588 139
71 3300048910 Ga0496107_0500321 Ga0496107_0500321_180_611 139
72 3300048918 Ga0496115_0039617 Ga0496115_0039617_368_799 139
73 3300050507 nmdc:mga05p37_55289_c1 nmdc:mga05p37_55289_c1_3936_4364 139
74 3300050508 nmdc:mga09592_734007_c1 nmdc:mga09592_734007_c1_167_595 139
75 3300050511 nmdc:mga08y16_240787_c1 nmdc:mga08y16_240787_c1_753_1181 139
76 3300050512 nmdc:mga0n895_29353_c1 nmdc:mga0n895_29353_c1_917_1345 139
77 3300050513 nmdc:mga0rr50_181201_c1 nmdc:mga0rr50_181201_c1_245_673 139
78 3300050515 nmdc:mga0a205_59911_c1 nmdc:mga0a205_59911_c1_1676_2104 139
79 3300005330 Ga0070690_100018149 Ga0070690_1000181495 140
80 3300005334 Ga0068869_100254215 Ga0068869_1002542152 140
81 3300005337 Ga0070682_100092387 Ga0070682_1000923873 140
82 3300005337 Ga0070682_100150913 Ga0070682_1001509132 140
83 3300005338 Ga0068868_100125376 Ga0068868_1001253763 140
84 3300005339 Ga0070660_100503604 Ga0070660_1005036041 140
85 3300005340 Ga0070689_100082073 Ga0070689_1000820732 140
86 3300005341 Ga0070691_10036635 Ga0070691_100366353 140
87 3300005345 Ga0070692_10469580 Ga0070692_104695802 140
88 3300005353 Ga0070669_100151741 Ga0070669_1001517411 140
89 3300005354 Ga0070675_100077815 Ga0070675_1000778153 140
90 3300005354 Ga0070675_100675738 Ga0070675_1006757382 140
91 3300005365 Ga0070688_100911818 Ga0070688_1009118181 140
92 3300005366 Ga0070659_100090917 Ga0070659_1000909172 140
93 3300005367 Ga0070667_100640910 Ga0070667_1006409101 140
94 3300005406 Ga0070703_10114108 Ga0070703_101141082 140
95 3300005434 Ga0070709_10047343 Ga0070709_100473433 140
96 3300005434 Ga0070709_10594231 Ga0070709_105942311 140
97 3300005435 Ga0070714_100883473 Ga0070714_1008834731 140
98 3300005436 Ga0070713_100132747 Ga0070713_1001327472 140
99 3300005436 Ga0070713_101494139 Ga0070713_1014941391 140
100 3300005437 Ga0070710_10087914 Ga0070710_100879143 140
101 3300005437 Ga0070710_10089460 Ga0070710_100894602 140
102 3300005439 Ga0070711_100114807 Ga0070711_1001148072 140
103 3300005440 Ga0070705_100049256 Ga0070705_1000492562 140
104 3300005445 Ga0070708_100096284 Ga0070708_1000962845 140
105 3300005456 Ga0070678_100190154 Ga0070678_1001901541 140
106 3300005457 Ga0070662_100027960 Ga0070662_1000279602 140
107 3300005458 Ga0070681_10933609 Ga0070681_109336092 140
108 3300005467 Ga0070706_100009266 Ga0070706_1000092663 140
109 3300005467 Ga0070706_100207120 Ga0070706_1002071202 140
110 3300005467 Ga0070706_100424716 Ga0070706_1004247162 140
111 3300005468 Ga0070707_100004246 Ga0070707_1000042467 140
112 3300005468 Ga0070707_100231668 Ga0070707_1002316683 140
113 3300005468 Ga0070707_100502870 Ga0070707_1005028702 140
114 3300005468 Ga0070707_100677797 Ga0070707_1006777972 140
115 3300005468 Ga0070707_100725789 Ga0070707_1007257892 140
116 3300005471 Ga0070698_100100562 Ga0070698_1001005622 140
117 3300005471 Ga0070698_100593653 Ga0070698_1005936532 140
118 3300005518 Ga0070699_100000682 Ga0070699_1000006829 140
119 3300005530 Ga0070679_100233514 Ga0070679_1002335142 140
120 3300005535 Ga0070684_100367912 Ga0070684_1003679122 140
121 3300005536 Ga0070697_100322157 Ga0070697_1003221571 140
122 3300005536 Ga0070697_101113632 Ga0070697_1011136321 140
123 3300005539 Ga0068853_100087600 Ga0068853_1000876002 140
124 3300005544 Ga0070686_100276412 Ga0070686_1002764122 140
125 3300005547 Ga0070693_100083501 Ga0070693_1000835012 140
126 3300005548 Ga0070665_100006013 Ga0070665_10000601316 140
127 3300005548 Ga0070665_100122260 Ga0070665_1001222603 140
128 3300005549 Ga0070704_100043041 Ga0070704_1000430413 140
129 3300005563 Ga0068855_100302884 Ga0068855_1003028842 140
130 3300005564 Ga0070664_100235104 Ga0070664_1002351042 140
131 3300005577 Ga0068857_100090744 Ga0068857_1000907444 140
132 3300005577 Ga0068857_100184058 Ga0068857_1001840582 140
133 3300005578 Ga0068854_100050416 Ga0068854_1000504163 140
134 3300005718 Ga0068866_10100658 Ga0068866_101006581 140
135 3300005719 Ga0068861_100110425 Ga0068861_1001104252 140
136 3300005834 Ga0068851_10131273 Ga0068851_101312732 140
137 3300005840 Ga0068870_10343292 Ga0068870_103432921 140
138 3300005841 Ga0068863_100098250 Ga0068863_1000982502 140
139 3300005842 Ga0068858_100154409 Ga0068858_1001544092 140
140 3300005843 Ga0068860_100110015 Ga0068860_1001100154 140
141 3300005844 Ga0068862_100399330 Ga0068862_1003993302 140
142 3300005983 Ga0081540_1000824 Ga0081540_100082432 140
143 3300006028 Ga0070717_10182437 Ga0070717_101824372 140
144 3300006028 Ga0070717_10433541 Ga0070717_104335412 140
145 3300006028 Ga0070717_10670561 Ga0070717_106705612 140
146 3300006028 Ga0070717_11402467 Ga0070717_114024672 140
147 3300006173 Ga0070716_100007263 Ga0070716_1000072632 140
148 3300006173 Ga0070716_100103755 Ga0070716_1001037553 140
149 3300006175 Ga0070712_100030396 Ga0070712_1000303963 140
150 3300006175 Ga0070712_100076212 Ga0070712_1000762122 140
151 3300006175 Ga0070712_100386258 Ga0070712_1003862582 140
152 3300006237 Ga0097621_100075052 Ga0097621_1000750522 140
153 3300006358 Ga0068871_100152049 Ga0068871_1001520491 140
154 3300006871 Ga0075434_101366421 Ga0075434_1013664212 140
155 3300006881 Ga0068865_101317074 Ga0068865_1013170742 140
156 3300007788 Ga0099795_10378047 Ga0099795_103780471 140
157 3300009093 Ga0105240_10195822 Ga0105240_101958223 140
158 3300009098 Ga0105245_10923840 Ga0105245_109238402 140
159 3300009101 Ga0105247_10141648 Ga0105247_101416482 140
160 3300009101 Ga0105247_10727071 Ga0105247_107270712 140
161 3300009147 Ga0114129_10292176 Ga0114129_102921763 140
162 3300009148 Ga0105243_11515557 Ga0105243_115155571 140
163 3300009177 Ga0105248_12231981 Ga0105248_122319812 140
164 3300009545 Ga0105237_10889639 Ga0105237_108896392 140
165 3300009545 Ga0105237_11944704 Ga0105237_119447042 140
166 3300009545 Ga0105237_12004525 Ga0105237_120045251 140
167 3300010375 Ga0105239_10526327 Ga0105239_105263272 140
168 3300012500 Ga0157314_1011178 Ga0157314_10111781 140
169 3300012515 Ga0157338_1056223 Ga0157338_10562231 140
170 3300013100 Ga0157373_10039780 Ga0157373_100397804 140
171 3300013102 Ga0157371_10032698 Ga0157371_100326982 140
172 3300013104 Ga0157370_10537820 Ga0157370_105378202 140
173 3300013105 Ga0157369_10613385 Ga0157369_106133852 140
174 3300013105 Ga0157369_10792223 Ga0157369_107922232 140
175 3300013296 Ga0157374_10488464 Ga0157374_104884641 140
176 3300013296 Ga0157374_11007131 Ga0157374_110071312 140
177 3300013297 Ga0157378_10847157 Ga0157378_108471572 140
178 3300013307 Ga0157372_10138057 Ga0157372_101380572 140
179 3300013307 Ga0157372_11088441 Ga0157372_110884412 140
180 3300013308 Ga0157375_10136034 Ga0157375_101360342 140
181 3300014325 Ga0163163_10254190 Ga0163163_102541901 140
182 3300014325 Ga0163163_10265264 Ga0163163_102652641 140
183 3300014497 Ga0182008_10067760 Ga0182008_100677602 140
184 3300014497 Ga0182008_10119499 Ga0182008_101194991 140
185 3300014745 Ga0157377_10033266 Ga0157377_100332662 140
186 3300014968 Ga0157379_10402583 Ga0157379_104025831 140
187 3300015265 Ga0182005_1040190 Ga0182005_10401901 140
188 3300020082 Ga0206353_10549335 Ga0206353_105493352 140
189 3300025885 Ga0207653_10116753 Ga0207653_101167532 140
190 3300025898 Ga0207692_10060640 Ga0207692_100606402 140
191 3300025899 Ga0207642_10090037 Ga0207642_100900372 140
192 3300025903 Ga0207680_10489803 Ga0207680_104898031 140
193 3300025905 Ga0207685_10111695 Ga0207685_101116951 140
194 3300025906 Ga0207699_10060098 Ga0207699_100600983 140
195 3300025906 Ga0207699_10224455 Ga0207699_102244551 140
196 3300025907 Ga0207645_10092283 Ga0207645_100922832 140
197 3300025908 Ga0207643_10006027 Ga0207643_100060272 140
198 3300025910 Ga0207684_10020450 Ga0207684_100204507 140
199 3300025910 Ga0207684_10066700 Ga0207684_100667004 140
200 3300025910 Ga0207684_10504423 Ga0207684_105044232 140
201 3300025915 Ga0207693_10019920 Ga0207693_100199207 140
202 3300025915 Ga0207693_10125669 Ga0207693_101256693 140
203 3300025915 Ga0207693_10174023 Ga0207693_101740233 140
204 3300025915 Ga0207693_10328579 Ga0207693_103285792 140
205 3300025916 Ga0207663_10043034 Ga0207663_100430342 140
206 3300025918 Ga0207662_10061263 Ga0207662_100612632 140
207 3300025919 Ga0207657_10066131 Ga0207657_100661312 140
208 3300025922 Ga0207646_10087251 Ga0207646_100872514 140
209 3300025922 Ga0207646_10307515 Ga0207646_103075152 140
210 3300025922 Ga0207646_10393407 Ga0207646_103934072 140
211 3300025922 Ga0207646_10864069 Ga0207646_108640692 140
212 3300025923 Ga0207681_10506860 Ga0207681_105068602 140
213 3300025924 Ga0207694_10352564 Ga0207694_103525642 140
214 3300025926 Ga0207659_10727722 Ga0207659_107277221 140
215 3300025927 Ga0207687_10258800 Ga0207687_102588002 140
216 3300025928 Ga0207700_10019614 Ga0207700_100196142 140
217 3300025928 Ga0207700_10651174 Ga0207700_106511741 140
218 3300025928 Ga0207700_11402348 Ga0207700_114023481 140
219 3300025929 Ga0207664_10020229 Ga0207664_100202292 140
220 3300025929 Ga0207664_10070181 Ga0207664_100701814 140
221 3300025929 Ga0207664_10454488 Ga0207664_104544882 140
222 3300025929 Ga0207664_10852627 Ga0207664_108526272 140
223 3300025929 Ga0207664_10986321 Ga0207664_109863211 140
224 3300025932 Ga0207690_10210462 Ga0207690_102104622 140
225 3300025933 Ga0207706_10033370 Ga0207706_100333702 140
226 3300025935 Ga0207709_10089976 Ga0207709_100899762 140
227 3300025939 Ga0207665_10008206 Ga0207665_100082068 140
228 3300025939 Ga0207665_10048695 Ga0207665_100486952 140
229 3300025941 Ga0207711_10714530 Ga0207711_107145301 140
230 3300025942 Ga0207689_10030711 Ga0207689_100307114 140
231 3300025944 Ga0207661_10653501 Ga0207661_106535012 140
232 3300025945 Ga0207679_10371806 Ga0207679_103718061 140
233 3300025949 Ga0207667_11478036 Ga0207667_114780361 140
234 3300025981 Ga0207640_10106804 Ga0207640_101068043 140
235 3300026023 Ga0207677_10345206 Ga0207677_103452062 140
236 3300026035 Ga0207703_11111196 Ga0207703_111111961 140
237 3300026041 Ga0207639_10307405 Ga0207639_103074052 140
238 3300026067 Ga0207678_10003453 Ga0207678_1000345316 140
239 3300026078 Ga0207702_10019227 Ga0207702_100192272 140
240 3300026078 Ga0207702_10494398 Ga0207702_104943982 140
241 3300026089 Ga0207648_10032654 Ga0207648_100326541 140
242 3300026095 Ga0207676_11273851 Ga0207676_112738512 140
243 3300026116 Ga0207674_10005432 Ga0207674_100054322 140
244 3300026118 Ga0207675_100275646 Ga0207675_1002756463 140
245 3300026121 Ga0207683_10708299 Ga0207683_107082992 140
246 3300028379 Ga0268266_10015036 Ga0268266_100150366 140
247 3300028379 Ga0268266_10503641 Ga0268266_105036411 140
248 3300030763 Ga0265763_1040003 Ga0265763_10400032 140
249 3300030878 Ga0265770_1128721 Ga0265770_11287211 140
250 3300031090 Ga0265760_10049146 Ga0265760_100491462 140
251 3300034817 Ga0373948_0032555 Ga0373948_0032555_479_910 140
252 3300034819 Ga0373958_0025175 Ga0373958_0025175_566_997 140
253 3300035083 Ga0373926_0000761 Ga0373926_0000761_3648_4088 140
254 3300035084 Ga0373928_0016884 Ga0373928_0016884_731_1162 140
255 3300035086 Ga0373934_0004895 Ga0373934_0004895_2219_2659 140
256 3300035088 Ga0373940_0337212 Ga0373940_0337212_34_465 140
257 3300035089 Ga0373944_0001900 Ga0373944_0001900_4594_5034 140
258 3300035090 Ga0373949_0012054 Ga0373949_0012054_1153_1584 140
259 3300035092 Ga0373952_0022850 Ga0373952_0022850_327_758 140
260 3300035111 Ga0373923_0000124 Ga0373923_0000124_12816_13256 140
261 3300035112 Ga0373932_0004292 Ga0373932_0004292_1306_1737 140
262 3300035113 Ga0373936_0000187 Ga0373936_0000187_7656_8096 140
263 3300035113 Ga0373936_0119002 Ga0373936_0119002_337_768 140
264 3300035115 Ga0373941_0038482 Ga0373941_0038482_249_680 140
265 3300035116 Ga0373945_0001244 Ga0373945_0001244_2365_2805 140
266 3300035117 Ga0373953_0001294 Ga0373953_0001294_551_991 140
267 3300035118 Ga0373954_0028107 Ga0373954_0028107_1729_2169 140
268 3300035119 Ga0373956_0022847 Ga0373956_0022847_381_821 140
269 3300035120 Ga0373957_0047911 Ga0373957_0047911_798_1280 140
270 3300035120 Ga0373957_0173952 Ga0373957_0173952_238_678 140
271 3300035170 Ga0373943_0016225 Ga0373943_0016225_2113_2553 140
272 3300035170 Ga0373943_0287043 Ga0373943_0287043_419_850 140
273 3300035171 Ga0373946_0000543 Ga0373946_0000543_6743_7183 140
274 3300035172 Ga0373955_0007724 Ga0373955_0007724_3978_4418 140
275 3300035172 Ga0373955_0079343 Ga0373955_0079343_153_635 140
276 3300035242 Ga0373962_0008870 Ga0373962_0008870_1783_2214 140
277 3300035410 Ga0373924_0001045 Ga0373924_0001045_5523_5963 140
278 3300035692 Ga0373935_0009226 Ga0373935_0009226_653_1093 140
279 3300035692 Ga0373935_0207937 Ga0373935_0207937_451_933 140
280 3300035692 Ga0373935_0502415 Ga0373935_0502415_108_539 140
281 3300035695 Ga0373927_0009479 Ga0373927_0009479_324_764 140
282 3300035724 Ga0373933_0012809 Ga0373933_0012809_3517_3957 140
283 3300035724 Ga0373933_0593034 Ga0373933_0593034_50_481 140
284 3300035725 Ga0373947_0003228 Ga0373947_0003228_2492_2932 140
285 3300036401 Ga0373937_0006504 Ga0373937_0006504_8572_9054 140
286 3300036401 Ga0373937_0020351 Ga0373937_0020351_149_589 140
287 3300036401 Ga0373937_0104952 Ga0373937_0104952_194_625 140
288 3300037068 Ga0373925_0000710 Ga0373925_0000710_13845_14285 140
289 3300037853 Ga0436364_0695951 Ga0436364_0695951_904_1350 140
290 3300037853 Ga0436364_1517018 Ga0436364_1517018_8388_8864 140
291 3300039437 Ga0436365_1458933 Ga0436365_1458933_91_522 140
292 3300039438 Ga0436360_0489904 Ga0436360_0489904_81_512 140
293 3300039450 Ga0436363_1003852 Ga0436363_1003852_47_514 140
294 3300039453 Ga0436362_0954635 Ga0436362_0954635_717_1148 140
295 3300041460 Ga0451802_1302443 Ga0451802_1302443_482_916 140
296 3300044694 Ga0466963_0260446 Ga0466963_0260446_280_711 140
297 3300045976 Ga0466967_0427866 Ga0466967_0427866_490_921 140
298 3300046454 Ga0495592_0023412 Ga0495592_0023412_538_978 140
299 3300046454 Ga0495592_0065640 Ga0495592_0065640_1008_1490 140
300 3300046454 Ga0495592_0465575 Ga0495592_0465575_207_638 140
301 3300046455 Ga0495603_0020816 Ga0495603_0020816_2843_3283 140
302 3300046459 Ga0495629_0012759 Ga0495629_0012759_5332_5772 140
303 3300046461 Ga0495641_0007073 Ga0495641_0007073_6481_6921 140
304 3300046462 Ga0495651_0000444 Ga0495651_0000444_7244_7726 140
305 3300046462 Ga0495651_0026443 Ga0495651_0026443_2258_2689 140
306 3300046462 Ga0495651_0326814 Ga0495651_0326814_271_711 140
307 3300046463 Ga0495653_0015420 Ga0495653_0015420_4338_4820 140
308 3300046463 Ga0495653_0253337 Ga0495653_0253337_248_679 140
309 3300046463 Ga0495653_0385864 Ga0495653_0385864_271_711 140
310 3300046472 Ga0495580_0037558 Ga0495580_0037558_187_627 140
311 3300046473 Ga0495582_0002868 Ga0495582_0002868_4927_5367 140
312 3300046475 Ga0495639_0003241 Ga0495639_0003241_2084_2524 140
313 3300046476 Ga0495662_0001521 Ga0495662_0001521_6367_6807 140
314 3300046476 Ga0495662_0018551 Ga0495662_0018551_1822_2271 140
315 3300046477 Ga0495664_0013136 Ga0495664_0013136_538_978 140
316 3300046499 Ga0495594_0035660 Ga0495594_0035660_1492_1932 140
317 3300046511 Ga0495608_0003665 Ga0495608_0003665_5793_6275 140
318 3300046511 Ga0495608_0020366 Ga0495608_0020366_3936_4376 140
319 3300046511 Ga0495608_0038902 Ga0495608_0038902_904_1335 140
320 3300046514 Ga0495618_0075937 Ga0495618_0075937_938_1378 140
321 3300046514 Ga0495618_0085937 Ga0495618_0085937_1477_1908 140
322 3300046514 Ga0495618_0089274 Ga0495618_0089274_205_636 140
323 3300046514 Ga0495618_0499387 Ga0495618_0499387_91_522 140
324 3300046516 Ga0495628_0015357 Ga0495628_0015357_46_486 140
325 3300046516 Ga0495628_0029822 Ga0495628_0029822_173_613 140
326 3300046516 Ga0495628_0144589 Ga0495628_0144589_1304_1735 140
327 3300046517 Ga0495630_0000690 Ga0495630_0000690_13827_14267 140
328 3300046517 Ga0495630_0149773 Ga0495630_0149773_289_720 140
329 3300046517 Ga0495630_0221868 Ga0495630_0221868_401_850 140
330 3300046517 Ga0495630_0536557 Ga0495630_0536557_271_753 140
331 3300046526 Ga0495666_0003593 Ga0495666_0003593_4570_5010 140
332 3300046529 Ga0495652_0000159 Ga0495652_0000159_43489_43971 140
333 3300046529 Ga0495652_0153299 Ga0495652_0153299_1153_1584 140
334 3300046529 Ga0495652_0236815 Ga0495652_0236815_892_1341 140
335 3300046529 Ga0495652_0270754 Ga0495652_0270754_271_711 140
336 3300046529 Ga0495652_0362971 Ga0495652_0362971_48_479 140
337 3300046530 Ga0495654_0373327 Ga0495654_0373327_90_518 140
338 3300046531 Ga0495665_0000714 Ga0495665_0000714_12986_13426 140
339 3300046531 Ga0495665_0504657 Ga0495665_0504657_141_569 140
340 3300046533 Ga0495640_0001225 Ga0495640_0001225_13740_14180 140
341 3300046533 Ga0495640_0013988 Ga0495640_0013988_3742_4191 140
342 3300046535 Ga0495586_0015134 Ga0495586_0015134_3417_3857 140
343 3300046536 Ga0495587_0000767 Ga0495587_0000767_19423_19905 140
344 3300046536 Ga0495587_0014787 Ga0495587_0014787_199_639 140
345 3300046536 Ga0495587_0027124 Ga0495587_0027124_2849_3280 140
346 3300046543 Ga0495645_0004159 Ga0495645_0004159_3935_4375 140
347 3300046543 Ga0495645_0011888 Ga0495645_0011888_3261_3743 140
348 3300046543 Ga0495645_0042349 Ga0495645_0042349_2613_3044 140
349 3300046543 Ga0495645_0168814 Ga0495645_0168814_864_1313 140
350 3300046557 Ga0495622_0046284 Ga0495622_0046284_200_640 140
351 3300046557 Ga0495622_0420692 Ga0495622_0420692_117_545 140
352 3300046559 Ga0495667_0003094 Ga0495667_0003094_6872_7312 140
353 3300046559 Ga0495667_0213948 Ga0495667_0213948_208_639 140
354 3300046642 Ga0495634_0007638 Ga0495634_0007638_4940_5380 140
355 3300046642 Ga0495634_0052373 Ga0495634_0052373_1696_2178 140
356 3300046642 Ga0495634_0119674 Ga0495634_0119674_743_1174 140
357 3300046642 Ga0495634_0171996 Ga0495634_0171996_334_783 140
358 3300046663 Ga0495635_0006316 Ga0495635_0006316_5519_5959 140
359 3300046663 Ga0495635_0114915 Ga0495635_0114915_141_623 140
360 3300046663 Ga0495635_0160669 Ga0495635_0160669_1056_1505 140
361 3300046663 Ga0495635_0451855 Ga0495635_0451855_52_483 140
362 3300046663 Ga0495635_0706746 Ga0495635_0706746_12_443 140
363 3300046674 Ga0495588_0171712 Ga0495588_0171712_118_558 140
364 3300046675 Ga0495657_0001225 Ga0495657_0001225_17277_17759 140
365 3300046675 Ga0495657_0050279 Ga0495657_0050279_1825_2265 140
366 3300046675 Ga0495657_0191611 Ga0495657_0191611_425_856 140
367 3300046678 Ga0495599_0002030 Ga0495599_0002030_11115_11555 140
368 3300046678 Ga0495599_0025867 Ga0495599_0025867_2696_3178 140
369 3300046678 Ga0495599_0084249 Ga0495599_0084249_414_845 140
370 3300046678 Ga0495599_0211532 Ga0495599_0211532_705_1136 140
371 3300046679 Ga0495623_0011352 Ga0495623_0011352_4787_5227 140
372 3300046679 Ga0495623_0042520 Ga0495623_0042520_418_900 140
373 3300046679 Ga0495623_0115561 Ga0495623_0115561_12_455 140
374 3300046679 Ga0495623_0144047 Ga0495623_0144047_256_687 140
375 3300046680 Ga0495646_0005348 Ga0495646_0005348_930_1370 140
376 3300046680 Ga0495646_0124457 Ga0495646_0124457_128_610 140
377 3300046680 Ga0495646_0204415 Ga0495646_0204415_349_780 140
378 3300046681 Ga0495647_0006478 Ga0495647_0006478_249_689 140
379 3300046683 Ga0495658_0002793 Ga0495658_0002793_6036_6476 140
380 3300046689 Ga0495613_0074586 Ga0495613_0074586_206_646 140
381 3300046690 Ga0495624_0000780 Ga0495624_0000780_16693_17133 140
382 3300046809 Ga0495600_0001844 Ga0495600_0001844_10496_10978 140
383 3300046809 Ga0495600_0060682 Ga0495600_0060682_393_833 140
384 3300046809 Ga0495600_0075974 Ga0495600_0075974_523_954 140
385 3300047315 Ga0495581_0002815 Ga0495581_0002815_3978_4418 140
386 3300047317 Ga0495604_0002683 Ga0495604_0002683_9254_9736 140
387 3300047317 Ga0495604_0032412 Ga0495604_0032412_2139_2579 140
388 3300047317 Ga0495604_0550870 Ga0495604_0550870_43_474 140
389 3300047319 Ga0495674_0002259 Ga0495674_0002259_6058_6507 140
390 3300047319 Ga0495674_0007120 Ga0495674_0007120_5935_6417 140
391 3300047319 Ga0495674_0028879 Ga0495674_0028879_3978_4418 140
392 3300047319 Ga0495674_0091121 Ga0495674_0091121_1197_1628 140
393 3300047319 Ga0495674_0183878 Ga0495674_0183878_1279_1710 140
394 3300047321 Ga0495676_0003733 Ga0495676_0003733_6743_7183 140
395 3300047322 Ga0495680_0007702 Ga0495680_0007702_6671_7111 140
396 3300047322 Ga0495680_0016971 Ga0495680_0016971_3624_4106 140
397 3300047322 Ga0495680_0245117 Ga0495680_0245117_591_1022 140
398 3300047322 Ga0495680_0393776 Ga0495680_0393776_436_867 140
399 3300047444 Ga0495675_0013866 Ga0495675_0013866_4495_4935 140
400 3300047444 Ga0495675_0031547 Ga0495675_0031547_2267_2749 140
401 3300047444 Ga0495675_0641016 Ga0495675_0641016_49_480 140
402 3300047471 Ga0495684_0002248 Ga0495684_0002248_5866_6306 140
403 3300047471 Ga0495684_0013779 Ga0495684_0013779_982_1464 140
404 3300047673 Ga0495593_0000853 Ga0495593_0000853_4566_5006 140
405 3300048088 Ga0495602_0001444 Ga0495602_0001444_10206_10688 140
406 3300048088 Ga0495602_0166285 Ga0495602_0166285_740_1180 140
407 3300048088 Ga0495602_0390602 Ga0495602_0390602_38_469 140
408 3300048089 Ga0495614_0017054 Ga0495614_0017054_1955_2395 140
409 3300048903 Ga0496100_0024230 Ga0496100_0024230_1935_2366 140
410 3300048904 Ga0496101_0278221 Ga0496101_0278221_66_497 140
411 3300048905 Ga0496102_0601258 Ga0496102_0601258_529_960 140
412 3300048905 Ga0496102_0968639 Ga0496102_0968639_270_701 140
413 3300048906 Ga0496103_0151906 Ga0496103_0151906_82_513 140
414 3300048908 Ga0496105_0069021 Ga0496105_0069021_1018_1449 140
415 3300048909 Ga0496106_0783549 Ga0496106_0783549_312_743 140
416 3300048910 Ga0496107_0062422 Ga0496107_0062422_917_1348 140
417 3300048911 Ga0496108_0168421 Ga0496108_0168421_935_1366 140
418 3300048912 Ga0496109_0966333 Ga0496109_0966333_228_659 140
419 3300048913 Ga0496110_0066763 Ga0496110_0066763_917_1348 140
420 3300048914 Ga0496111_0094497 Ga0496111_0094497_960_1391 140
421 3300048915 Ga0496112_0069726 Ga0496112_0069726_1236_1667 140
422 3300048916 Ga0496113_0019253 Ga0496113_0019253_3242_3673 140
423 3300048916 Ga0496113_0099644 Ga0496113_0099644_653_1084 140
424 3300048916 Ga0496113_0977337 Ga0496113_0977337_213_644 140
425 3300048917 Ga0496114_0171962 Ga0496114_0171962_1202_1633 140
426 3300048918 Ga0496115_0131433 Ga0496115_0131433_529_960 140
427 3300050513 nmdc:mga0rr50_447327_c1 nmdc:mga0rr50_447327_c1_14_445 140
428 3300053077 Ga0495601_0003542 Ga0495601_0003542_4594_5034 140
429 3300053077 Ga0495601_0473573 Ga0495601_0473573_251_682 140
430 3300053078 Ga0495612_0000732 Ga0495612_0000732_5656_6087 140
431 3300053084 Ga0495595_0003218 Ga0495595_0003218_1504_1944 140
432 3300053084 Ga0495595_0459159 Ga0495595_0459159_74_556 140
433 3300053085 Ga0495619_0006860 Ga0495619_0006860_4547_4987 140
434 iso_pu_bacteria 8002060224 8002062210 140
435 2088090003 LJN_F7QKVOU01DJH1A LJN_01588140 141
436 3300017792 Ga0163161_10426300 Ga0163161_104263001 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

28

165

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.971 3 140
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9439 3 140
4qjy-assembly1.cif.gz_B crystal structure of native ara127n, a gh127 beta-l-arabinofuranosidase from geobacillus stearothermophilus t6 0.4845 3 130
1oxj-assembly1.cif.gz_A crystal structure of the smaug rna binding domain 0.4805 14 123
4qjy-assembly1.cif.gz_B crystal structure of native ara127n, a gh127 beta-l-arabinofuranosidase from geobacillus stearothermophilus t6 0.4462 3 130
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.971 3 140 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9439 3 140 1.25.40.380
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5593 1 125 1.25.10.10
af_Q9W1C5_327_407_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5098 60 127 1.25.10.10
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5062 1 125 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A519V3I3-F1-model_v4 DUF1810 domain-containing protein 0.9945 7 140
AF-A0A7Y0BSW8-F1-model_v4 DUF1810 domain-containing protein 0.9934 4 141
AF-A0A367AF78-F1-model_v4 DUF1810 domain-containing protein 0.9933 7 138
AF-A0A4U1L5E1-F1-model_v4 DUF1810 domain-containing protein 0.993 7 141
AF-A0A0K1PJM3-F1-model_v4 NTP pyrophosphohydrolase 0.9929 3 138 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.32 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map