F443487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 436 | 275 | 432 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_101494139|Ga0070713_1014941391 |
| Length | 165 |
| Sequence | MLKRRSNATCRPAPRAPGRMTAMATDDPYDLQRFVAAQDAGGTYQQALAELRAGRKTSHWMWFVFPQIAGLGYSPTSRVYAITSLAEARAYLAHQVLGARLIECAGVLAGLRGRTAEQVFGEVDALKLCSSMTLFLHAAPGEPVFRQVLDQYFGGMTDSATEQRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 3 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 4 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 82 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 83 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 84 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 153 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 0.92 |
| Isolates | 0.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0 |
| Rhizoplane | 6.65 |
| Rhizosphere | 90.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F7QKVOU01DJH1A | 2088090003 | Bacteria | 527 |
| 2 | Ga0070690_100018149 | 3300005330 | Bacteria | 4243 |
| 3 | Ga0068869_100254215 | 3300005334 | Bacteria | 1404 |
| 4 | Ga0070682_100092387 | 3300005337 | Bacteria | 1982 |
| 5 | Ga0070682_100150913 | 3300005337 | Bacteria | 1594 |
| 6 | Ga0068868_100125376 | 3300005338 | Bacteria | 2097 |
| 7 | Ga0070660_100503604 | 3300005339 | Bacteria | 1007 |
| 8 | Ga0070689_100082073 | 3300005340 | Bacteria | 2531 |
| 9 | Ga0070691_10036635 | 3300005341 | Bacteria | 2312 |
| 10 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 11 | Ga0070692_10469580 | 3300005345 | Bacteria | 809 |
| 12 | Ga0070668_100701183 | 3300005347 | Bacteria | 893 |
| 13 | Ga0070669_100151741 | 3300005353 | Bacteria | 1794 |
| 14 | Ga0070675_100077815 | 3300005354 | Bacteria | 2761 |
| 15 | Ga0070675_100675738 | 3300005354 | Bacteria | 939 |
| 16 | Ga0070671_100442462 | 3300005355 | Bacteria | 1114 |
| 17 | Ga0070671_100849874 | 3300005355 | Bacteria | 796 |
| 18 | Ga0070688_100911818 | 3300005365 | Bacteria | 694 |
| 19 | Ga0070659_100090917 | 3300005366 | Bacteria | 2446 |
| 20 | Ga0070659_101073337 | 3300005366 | Bacteria | 709 |
| 21 | Ga0070659_101587161 | 3300005366 | Bacteria | 584 |
| 22 | Ga0070667_100640910 | 3300005367 | Bacteria | 981 |
| 23 | Ga0070667_100878689 | 3300005367 | Bacteria | 834 |
| 24 | Ga0070703_10114108 | 3300005406 | Bacteria | 971 |
| 25 | Ga0070709_10047343 | 3300005434 | Bacteria | 2678 |
| 26 | Ga0070709_10594231 | 3300005434 | Bacteria | 851 |
| 27 | Ga0070714_100883473 | 3300005435 | Bacteria | 867 |
| 28 | Ga0070713_100132747 | 3300005436 | Bacteria | 2197 |
| 29 | Ga0070713_100146682 | 3300005436 | Bacteria | 2095 |
| 30 | Ga0070713_101494139 | 3300005436 | Bacteria | 656 |
| 31 | Ga0070710_10087914 | 3300005437 | Bacteria | 1827 |
| 32 | Ga0070710_10089460 | 3300005437 | Bacteria | 1813 |
| 33 | Ga0070711_100114807 | 3300005439 | Bacteria | 1982 |
| 34 | Ga0070705_100049256 | 3300005440 | Bacteria | 2445 |
| 35 | Ga0070708_100096284 | 3300005445 | Bacteria | 2703 |
| 36 | Ga0070678_100190154 | 3300005456 | Bacteria | 1687 |
| 37 | Ga0070662_100027960 | 3300005457 | Bacteria | 3921 |
| 38 | Ga0070681_10933609 | 3300005458 | Bacteria | 786 |
| 39 | Ga0070706_100009266 | 3300005467 | Bacteria | 9172 |
| 40 | Ga0070706_100207120 | 3300005467 | Bacteria | 1831 |
| 41 | Ga0070706_100424716 | 3300005467 | Bacteria | 1237 |
| 42 | Ga0070707_100004246 | 3300005468 | Bacteria | 13412 |
| 43 | Ga0070707_100231668 | 3300005468 | Bacteria | 1798 |
| 44 | Ga0070707_100502870 | 3300005468 | Bacteria | 1174 |
| 45 | Ga0070707_100677797 | 3300005468 | Bacteria | 994 |
| 46 | Ga0070707_100725789 | 3300005468 | Bacteria | 957 |
| 47 | Ga0070698_100100562 | 3300005471 | Bacteria | 2864 |
| 48 | Ga0070698_100593653 | 3300005471 | Bacteria | 1048 |
| 49 | Ga0070699_100000682 | 3300005518 | Bacteria | 31654 |
| 50 | Ga0070679_100233514 | 3300005530 | Bacteria | 1798 |
| 51 | Ga0070684_100367912 | 3300005535 | Bacteria | 1323 |
| 52 | Ga0070697_100322157 | 3300005536 | Bacteria | 1331 |
| 53 | Ga0070697_101113632 | 3300005536 | Bacteria | 703 |
| 54 | Ga0068853_100087600 | 3300005539 | Bacteria | 2732 |
| 55 | Ga0070686_100276412 | 3300005544 | Bacteria | 1237 |
| 56 | Ga0070693_100083501 | 3300005547 | Bacteria | 1909 |
| 57 | Ga0070665_100006013 | 3300005548 | Bacteria | 12407 |
| 58 | Ga0070665_100122260 | 3300005548 | Bacteria | 2605 |
| 59 | Ga0070704_100043041 | 3300005549 | Bacteria | 3128 |
| 60 | Ga0068855_100302884 | 3300005563 | Bacteria | 1770 |
| 61 | Ga0070664_100235104 | 3300005564 | Bacteria | 1644 |
| 62 | Ga0068857_100090744 | 3300005577 | Bacteria | 2734 |
| 63 | Ga0068857_100184058 | 3300005577 | Bacteria | 1901 |
| 64 | Ga0068854_100050416 | 3300005578 | Bacteria | 2978 |
| 65 | Ga0068852_100062567 | 3300005616 | Bacteria | 3237 |
| 66 | Ga0068864_100000930 | 3300005618 | Bacteria | 24547 |
| 67 | Ga0068866_10100658 | 3300005718 | Bacteria | 1594 |
| 68 | Ga0068866_11038032 | 3300005718 | Bacteria | 584 |
| 69 | Ga0068861_100093032 | 3300005719 | Bacteria | 2383 |
| 70 | Ga0068861_100110425 | 3300005719 | Bacteria | 2202 |
| 71 | Ga0068851_10131273 | 3300005834 | Bacteria | 1355 |
| 72 | Ga0068870_10343292 | 3300005840 | Bacteria | 956 |
| 73 | Ga0068863_100098250 | 3300005841 | Bacteria | 2780 |
| 74 | Ga0068858_100000022 | 3300005842 | Bacteria | 169718 |
| 75 | Ga0068858_100154409 | 3300005842 | Bacteria | 2159 |
| 76 | Ga0068860_100110015 | 3300005843 | Bacteria | 2633 |
| 77 | Ga0068862_100399330 | 3300005844 | Bacteria | 1286 |
| 78 | Ga0081540_1000824 | 3300005983 | Bacteria | 28336 |
| 79 | Ga0070717_10182437 | 3300006028 | Bacteria | 1830 |
| 80 | Ga0070717_10433541 | 3300006028 | Bacteria | 1183 |
| 81 | Ga0070717_10670561 | 3300006028 | Bacteria | 941 |
| 82 | Ga0070717_11402467 | 3300006028 | Bacteria | 634 |
| 83 | Ga0070716_100007263 | 3300006173 | Bacteria | 5447 |
| 84 | Ga0070716_100103755 | 3300006173 | Bacteria | 1749 |
| 85 | Ga0070712_100030396 | 3300006175 | Bacteria | 3628 |
| 86 | Ga0070712_100076212 | 3300006175 | Bacteria | 2414 |
| 87 | Ga0070712_100386258 | 3300006175 | Bacteria | 1153 |
| 88 | Ga0097621_100075052 | 3300006237 | Bacteria | 2801 |
| 89 | Ga0075370_10055587 | 3300006353 | Bacteria | 2249 |
| 90 | Ga0068871_100152049 | 3300006358 | Bacteria | 1974 |
| 91 | Ga0068871_100268847 | 3300006358 | Bacteria | 1489 |
| 92 | Ga0075431_101506105 | 3300006847 | Bacteria | 631 |
| 93 | Ga0075434_101080464 | 3300006871 | Bacteria | 816 |
| 94 | Ga0075434_101366421 | 3300006871 | Bacteria | 719 |
| 95 | Ga0075429_100800526 | 3300006880 | Bacteria | 825 |
| 96 | Ga0068865_101317074 | 3300006881 | Bacteria | 643 |
| 97 | Ga0075435_100460345 | 3300007076 | Bacteria | 1097 |
| 98 | Ga0099795_10378047 | 3300007788 | Bacteria | 639 |
| 99 | Ga0105240_10195822 | 3300009093 | Bacteria | 2373 |
| 100 | Ga0111539_10086651 | 3300009094 | Unclassified | 3680 |
| 101 | Ga0105245_10923840 | 3300009098 | Bacteria | 915 |
| 102 | Ga0105247_10041186 | 3300009101 | Bacteria | 2826 |
| 103 | Ga0105247_10141648 | 3300009101 | Bacteria | 1576 |
| 104 | Ga0105247_10727071 | 3300009101 | Bacteria | 750 |
| 105 | Ga0114129_10006106 | 3300009147 | Bacteria | 17081 |
| 106 | Ga0114129_10292176 | 3300009147 | Bacteria | 2175 |
| 107 | Ga0105243_10116052 | 3300009148 | Bacteria | 2248 |
| 108 | Ga0105243_11515557 | 3300009148 | Bacteria | 695 |
| 109 | Ga0105248_10072238 | 3300009177 | Bacteria | 3878 |
| 110 | Ga0105248_10116473 | 3300009177 | Bacteria | 3014 |
| 111 | Ga0105248_12231981 | 3300009177 | Bacteria | 623 |
| 112 | Ga0105237_10889639 | 3300009545 | Bacteria | 897 |
| 113 | Ga0105237_11944704 | 3300009545 | Bacteria | 596 |
| 114 | Ga0105237_12004525 | 3300009545 | Bacteria | 587 |
| 115 | Ga0105239_10526327 | 3300010375 | Bacteria | 1345 |
| 116 | Ga0105246_11729748 | 3300011119 | Bacteria | 595 |
| 117 | Ga0157323_1028930 | 3300012495 | Bacteria | 577 |
| 118 | Ga0157314_1011178 | 3300012500 | Bacteria | 787 |
| 119 | Ga0157342_1055254 | 3300012507 | Bacteria | 569 |
| 120 | Ga0157338_1056223 | 3300012515 | Bacteria | 579 |
| 121 | Ga0157373_10039780 | 3300013100 | Bacteria | 3365 |
| 122 | Ga0157371_10032698 | 3300013102 | Bacteria | 3742 |
| 123 | Ga0157370_10537820 | 3300013104 | Bacteria | 1072 |
| 124 | Ga0157369_10613385 | 3300013105 | Bacteria | 1123 |
| 125 | Ga0157369_10792223 | 3300013105 | Bacteria | 974 |
| 126 | Ga0157374_10488464 | 3300013296 | Bacteria | 1235 |
| 127 | Ga0157374_11007131 | 3300013296 | Bacteria | 852 |
| 128 | Ga0157374_11682334 | 3300013296 | Bacteria | 659 |
| 129 | Ga0157378_10847157 | 3300013297 | Bacteria | 942 |
| 130 | Ga0163162_10024602 | 3300013306 | Bacteria | 5946 |
| 131 | Ga0157372_10138057 | 3300013307 | Bacteria | 2808 |
| 132 | Ga0157372_11088441 | 3300013307 | Bacteria | 925 |
| 133 | Ga0157375_10136034 | 3300013308 | Bacteria | 2581 |
| 134 | Ga0163163_10254190 | 3300014325 | Bacteria | 1808 |
| 135 | Ga0163163_10265264 | 3300014325 | Bacteria | 1768 |
| 136 | Ga0182008_10067760 | 3300014497 | Bacteria | 1756 |
| 137 | Ga0182008_10119499 | 3300014497 | Bacteria | 1309 |
| 138 | Ga0157377_10033266 | 3300014745 | Bacteria | 2813 |
| 139 | Ga0157379_10402583 | 3300014968 | Bacteria | 1258 |
| 140 | Ga0182005_1040190 | 3300015265 | Unclassified | 1272 |
| 141 | Ga0163161_10426300 | 3300017792 | Bacteria | 1068 |
| 142 | Ga0206353_10549335 | 3300020082 | Bacteria | 899 |
| 143 | Ga0207697_10229015 | 3300025315 | Bacteria | 820 |
| 144 | Ga0207653_10116753 | 3300025885 | Bacteria | 957 |
| 145 | Ga0207692_10060640 | 3300025898 | Bacteria | 1957 |
| 146 | Ga0207642_10090037 | 3300025899 | Bacteria | 1513 |
| 147 | Ga0207710_10090045 | 3300025900 | Bacteria | 1434 |
| 148 | Ga0207680_10489803 | 3300025903 | Bacteria | 875 |
| 149 | Ga0207685_10111695 | 3300025905 | Bacteria | 1186 |
| 150 | Ga0207699_10060098 | 3300025906 | Bacteria | 2280 |
| 151 | Ga0207699_10224455 | 3300025906 | Bacteria | 1284 |
| 152 | Ga0207645_10092283 | 3300025907 | Bacteria | 1948 |
| 153 | Ga0207643_10006027 | 3300025908 | Bacteria | 6479 |
| 154 | Ga0207684_10020450 | 3300025910 | Bacteria | 5656 |
| 155 | Ga0207684_10066700 | 3300025910 | Bacteria | 3057 |
| 156 | Ga0207684_10504423 | 3300025910 | Bacteria | 1037 |
| 157 | Ga0207693_10019920 | 3300025915 | Bacteria | 5335 |
| 158 | Ga0207693_10125669 | 3300025915 | Bacteria | 2016 |
| 159 | Ga0207693_10174023 | 3300025915 | Bacteria | 1694 |
| 160 | Ga0207693_10328579 | 3300025915 | Bacteria | 1197 |
| 161 | Ga0207663_10043034 | 3300025916 | Bacteria | 2763 |
| 162 | Ga0207662_10061263 | 3300025918 | Bacteria | 2259 |
| 163 | Ga0207657_10066131 | 3300025919 | Bacteria | 3078 |
| 164 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 165 | Ga0207646_10087251 | 3300025922 | Bacteria | 2792 |
| 166 | Ga0207646_10307515 | 3300025922 | Bacteria | 1432 |
| 167 | Ga0207646_10393407 | 3300025922 | Bacteria | 1252 |
| 168 | Ga0207646_10864069 | 3300025922 | Bacteria | 804 |
| 169 | Ga0207681_10506860 | 3300025923 | Bacteria | 989 |
| 170 | Ga0207694_10352564 | 3300025924 | Bacteria | 1218 |
| 171 | Ga0207659_10727722 | 3300025926 | Bacteria | 850 |
| 172 | Ga0207687_10258800 | 3300025927 | Bacteria | 1387 |
| 173 | Ga0207700_10019614 | 3300025928 | Bacteria | 4569 |
| 174 | Ga0207700_10020832 | 3300025928 | Bacteria | 4463 |
| 175 | Ga0207700_10651174 | 3300025928 | Bacteria | 939 |
| 176 | Ga0207700_11402348 | 3300025928 | Bacteria | 621 |
| 177 | Ga0207664_10020229 | 3300025929 | Bacteria | 4930 |
| 178 | Ga0207664_10070181 | 3300025929 | Bacteria | 2819 |
| 179 | Ga0207664_10454488 | 3300025929 | Bacteria | 1143 |
| 180 | Ga0207664_10852627 | 3300025929 | Bacteria | 819 |
| 181 | Ga0207664_10986321 | 3300025929 | Bacteria | 755 |
| 182 | Ga0207690_10210462 | 3300025932 | Bacteria | 1482 |
| 183 | Ga0207706_10033370 | 3300025933 | Bacteria | 4583 |
| 184 | Ga0207709_10089976 | 3300025935 | Bacteria | 2003 |
| 185 | Ga0207665_10008206 | 3300025939 | Bacteria | 6896 |
| 186 | Ga0207665_10048695 | 3300025939 | Bacteria | 2846 |
| 187 | Ga0207711_10024043 | 3300025941 | Bacteria | 5100 |
| 188 | Ga0207711_10105243 | 3300025941 | Bacteria | 2502 |
| 189 | Ga0207711_10714530 | 3300025941 | Bacteria | 934 |
| 190 | Ga0207689_10030711 | 3300025942 | Bacteria | 4477 |
| 191 | Ga0207661_10653501 | 3300025944 | Bacteria | 966 |
| 192 | Ga0207679_10371806 | 3300025945 | Bacteria | 1251 |
| 193 | Ga0207667_11478036 | 3300025949 | Bacteria | 651 |
| 194 | Ga0207712_10417116 | 3300025961 | Bacteria | 1131 |
| 195 | Ga0207640_10106804 | 3300025981 | Bacteria | 1975 |
| 196 | Ga0207658_10704854 | 3300025986 | Bacteria | 912 |
| 197 | Ga0207677_10345206 | 3300026023 | Bacteria | 1245 |
| 198 | Ga0207703_10000048 | 3300026035 | Bacteria | 151143 |
| 199 | Ga0207703_11111196 | 3300026035 | Bacteria | 759 |
| 200 | Ga0207639_10307405 | 3300026041 | Bacteria | 1403 |
| 201 | Ga0207678_10003453 | 3300026067 | Bacteria | 14241 |
| 202 | Ga0207702_10019227 | 3300026078 | Bacteria | 5650 |
| 203 | Ga0207702_10494398 | 3300026078 | Bacteria | 1192 |
| 204 | Ga0207648_10032654 | 3300026089 | Bacteria | 4594 |
| 205 | Ga0207676_10000239 | 3300026095 | Bacteria | 47772 |
| 206 | Ga0207676_11273851 | 3300026095 | Bacteria | 729 |
| 207 | Ga0207674_10005432 | 3300026116 | Bacteria | 15141 |
| 208 | Ga0207675_100213941 | 3300026118 | Bacteria | 1855 |
| 209 | Ga0207675_100275646 | 3300026118 | Bacteria | 1633 |
| 210 | Ga0207683_10370663 | 3300026121 | Bacteria | 1315 |
| 211 | Ga0207683_10708299 | 3300026121 | Bacteria | 933 |
| 212 | Ga0268266_10015036 | 3300028379 | Bacteria | 6644 |
| 213 | Ga0268266_10503641 | 3300028379 | Bacteria | 1156 |
| 214 | Ga0265763_1040003 | 3300030763 | Bacteria | 562 |
| 215 | Ga0265770_1128721 | 3300030878 | Bacteria | 539 |
| 216 | Ga0265760_10049146 | 3300031090 | Bacteria | 1268 |
| 217 | Ga0307408_101027728 | 3300031548 | Bacteria | 761 |
| 218 | Ga0307415_101094575 | 3300032126 | Bacteria | 746 |
| 219 | Ga0307415_101187188 | 3300032126 | Bacteria | 718 |
| 220 | Ga0373948_0032555 | 3300034817 | Bacteria | 1058 |
| 221 | Ga0373958_0025175 | 3300034819 | Bacteria | 1131 |
| 222 | Ga0373926_0000761 | 3300035083 | Bacteria | 9026 |
| 223 | Ga0373928_0016884 | 3300035084 | Bacteria | 1497 |
| 224 | Ga0373934_0004895 | 3300035086 | Bacteria | 4955 |
| 225 | Ga0373940_0337212 | 3300035088 | Bacteria | 526 |
| 226 | Ga0373944_0001900 | 3300035089 | Bacteria | 5280 |
| 227 | Ga0373949_0012054 | 3300035090 | Bacteria | 1909 |
| 228 | Ga0373952_0022850 | 3300035092 | Bacteria | 1332 |
| 229 | Ga0373923_0000124 | 3300035111 | Bacteria | 14180 |
| 230 | Ga0373932_0004292 | 3300035112 | Bacteria | 3383 |
| 231 | Ga0373936_0000187 | 3300035113 | Bacteria | 20656 |
| 232 | Ga0373936_0119002 | 3300035113 | Bacteria | 1127 |
| 233 | Ga0373941_0038482 | 3300035115 | Bacteria | 1465 |
| 234 | Ga0373945_0001244 | 3300035116 | Bacteria | 7743 |
| 235 | Ga0373953_0001294 | 3300035117 | Bacteria | 7174 |
| 236 | Ga0373954_0028107 | 3300035118 | Bacteria | 2583 |
| 237 | Ga0373956_0022847 | 3300035119 | Bacteria | 2679 |
| 238 | Ga0373957_0047911 | 3300035120 | Bacteria | 1627 |
| 239 | Ga0373957_0173952 | 3300035120 | Bacteria | 890 |
| 240 | Ga0373943_0016225 | 3300035170 | Bacteria | 3394 |
| 241 | Ga0373943_0287043 | 3300035170 | Bacteria | 932 |
| 242 | Ga0373946_0000543 | 3300035171 | Bacteria | 12518 |
| 243 | Ga0373955_0007724 | 3300035172 | Bacteria | 4954 |
| 244 | Ga0373955_0079343 | 3300035172 | Bacteria | 1851 |
| 245 | Ga0373962_0008870 | 3300035242 | Bacteria | 2483 |
| 246 | Ga0373924_0001045 | 3300035410 | Bacteria | 8804 |
| 247 | Ga0373935_0009226 | 3300035692 | Bacteria | 5903 |
| 248 | Ga0373935_0207937 | 3300035692 | Bacteria | 1355 |
| 249 | Ga0373935_0502415 | 3300035692 | Bacteria | 880 |
| 250 | Ga0373927_0009479 | 3300035695 | Bacteria | 6528 |
| 251 | Ga0373933_0012809 | 3300035724 | Bacteria | 4637 |
| 252 | Ga0373933_0593034 | 3300035724 | Bacteria | 727 |
| 253 | Ga0373947_0003228 | 3300035725 | Bacteria | 9674 |
| 254 | Ga0373937_0006504 | 3300036401 | Bacteria | 10085 |
| 255 | Ga0373937_0020351 | 3300036401 | Bacteria | 5949 |
| 256 | Ga0373937_0104952 | 3300036401 | Bacteria | 2625 |
| 257 | Ga0373925_0000710 | 3300037068 | Bacteria | 31112 |
| 258 | Ga0395900_0048005 | 3300037418 | Bacteria | 4397 |
| 259 | Ga0395900_0255462 | 3300037418 | Bacteria | 1752 |
| 260 | Ga0395898_0011357 | 3300037466 | Bacteria | 9254 |
| 261 | Ga0395898_0368604 | 3300037466 | Bacteria | 1370 |
| 262 | Ga0395905_0125588 | 3300037471 | Bacteria | 2412 |
| 263 | Ga0436364_0695951 | 3300037853 | Bacteria | 3878 |
| 264 | Ga0436364_1517018 | 3300037853 | Bacteria | 10872 |
| 265 | Ga0436365_1458933 | 3300039437 | Bacteria | 617 |
| 266 | Ga0436360_0489904 | 3300039438 | Bacteria | 724 |
| 267 | Ga0436363_0688255 | 3300039450 | Bacteria | 501 |
| 268 | Ga0436363_1003852 | 3300039450 | Unclassified | 540 |
| 269 | Ga0436362_0954635 | 3300039453 | Bacteria | 1351 |
| 270 | Ga0451793_0703339 | 3300041452 | Bacteria | 643 |
| 271 | Ga0451797_0165164 | 3300041453 | Bacteria | 1184 |
| 272 | Ga0451802_1302443 | 3300041460 | Bacteria | 978 |
| 273 | Ga0451802_1596096 | 3300041460 | Bacteria | 1235 |
| 274 | Ga0451849_0616188 | 3300041505 | Bacteria | 848 |
| 275 | Ga0466963_0260446 | 3300044694 | Bacteria | 1218 |
| 276 | Ga0451576_1335649 | 3300045051 | Bacteria | 747 |
| 277 | Ga0466967_0427866 | 3300045976 | Bacteria | 1291 |
| 278 | Ga0495592_0023412 | 3300046454 | Bacteria | 4696 |
| 279 | Ga0495592_0065640 | 3300046454 | Bacteria | 2656 |
| 280 | Ga0495592_0465575 | 3300046454 | Bacteria | 790 |
| 281 | Ga0495603_0020816 | 3300046455 | Bacteria | 3971 |
| 282 | Ga0495629_0012759 | 3300046459 | Bacteria | 6081 |
| 283 | Ga0495641_0007073 | 3300046461 | Bacteria | 7103 |
| 284 | Ga0495651_0000444 | 3300046462 | Bacteria | 31916 |
| 285 | Ga0495651_0026443 | 3300046462 | Bacteria | 4520 |
| 286 | Ga0495651_0326814 | 3300046462 | Bacteria | 1020 |
| 287 | Ga0495653_0015420 | 3300046463 | Bacteria | 6229 |
| 288 | Ga0495653_0253337 | 3300046463 | Bacteria | 1167 |
| 289 | Ga0495653_0385864 | 3300046463 | Bacteria | 893 |
| 290 | Ga0495580_0037558 | 3300046472 | Bacteria | 3474 |
| 291 | Ga0495582_0002868 | 3300046473 | Bacteria | 9640 |
| 292 | Ga0495639_0003241 | 3300046475 | Bacteria | 7069 |
| 293 | Ga0495662_0001521 | 3300046476 | Bacteria | 11507 |
| 294 | Ga0495662_0018551 | 3300046476 | Bacteria | 3368 |
| 295 | Ga0495664_0013136 | 3300046477 | Bacteria | 4696 |
| 296 | Ga0495594_0035660 | 3300046499 | Bacteria | 2710 |
| 297 | Ga0495608_0003665 | 3300046511 | Bacteria | 11045 |
| 298 | Ga0495608_0020366 | 3300046511 | Bacteria | 4558 |
| 299 | Ga0495608_0038902 | 3300046511 | Bacteria | 3191 |
| 300 | Ga0495618_0075937 | 3300046514 | Bacteria | 2140 |
| 301 | Ga0495618_0085937 | 3300046514 | Bacteria | 2011 |
| 302 | Ga0495618_0089274 | 3300046514 | Bacteria | 1971 |
| 303 | Ga0495618_0499387 | 3300046514 | Bacteria | 733 |
| 304 | Ga0495628_0015357 | 3300046516 | Bacteria | 6395 |
| 305 | Ga0495628_0029822 | 3300046516 | Bacteria | 4420 |
| 306 | Ga0495628_0144589 | 3300046516 | Bacteria | 1813 |
| 307 | Ga0495630_0000690 | 3300046517 | Bacteria | 24225 |
| 308 | Ga0495630_0149773 | 3300046517 | Bacteria | 1775 |
| 309 | Ga0495630_0221868 | 3300046517 | Bacteria | 1443 |
| 310 | Ga0495630_0536557 | 3300046517 | Bacteria | 897 |
| 311 | Ga0495631_0459569 | 3300046518 | Bacteria | 542 |
| 312 | Ga0495666_0003593 | 3300046526 | Bacteria | 7842 |
| 313 | Ga0495652_0000159 | 3300046529 | Bacteria | 77012 |
| 314 | Ga0495652_0153299 | 3300046529 | Bacteria | 1797 |
| 315 | Ga0495652_0236815 | 3300046529 | Bacteria | 1361 |
| 316 | Ga0495652_0270754 | 3300046529 | Bacteria | 1248 |
| 317 | Ga0495652_0362971 | 3300046529 | Bacteria | 1034 |
| 318 | Ga0495654_0373327 | 3300046530 | Bacteria | 570 |
| 319 | Ga0495665_0000714 | 3300046531 | Bacteria | 17144 |
| 320 | Ga0495665_0504657 | 3300046531 | Bacteria | 609 |
| 321 | Ga0495640_0001225 | 3300046533 | Bacteria | 20089 |
| 322 | Ga0495640_0013988 | 3300046533 | Bacteria | 6089 |
| 323 | Ga0495586_0015134 | 3300046535 | Bacteria | 4104 |
| 324 | Ga0495587_0000767 | 3300046536 | Bacteria | 21413 |
| 325 | Ga0495587_0014787 | 3300046536 | Bacteria | 4885 |
| 326 | Ga0495587_0027124 | 3300046536 | Bacteria | 3488 |
| 327 | Ga0495645_0004159 | 3300046543 | Bacteria | 9889 |
| 328 | Ga0495645_0011888 | 3300046543 | Bacteria | 6135 |
| 329 | Ga0495645_0042349 | 3300046543 | Bacteria | 3320 |
| 330 | Ga0495645_0168814 | 3300046543 | Bacteria | 1507 |
| 331 | Ga0495622_0046284 | 3300046557 | Bacteria | 2021 |
| 332 | Ga0495622_0420692 | 3300046557 | Bacteria | 574 |
| 333 | Ga0495667_0003094 | 3300046559 | Bacteria | 11158 |
| 334 | Ga0495667_0213948 | 3300046559 | Bacteria | 1231 |
| 335 | Ga0495634_0007638 | 3300046642 | Bacteria | 8099 |
| 336 | Ga0495634_0052373 | 3300046642 | Bacteria | 2736 |
| 337 | Ga0495634_0119674 | 3300046642 | Bacteria | 1687 |
| 338 | Ga0495634_0171996 | 3300046642 | Bacteria | 1361 |
| 339 | Ga0495635_0006316 | 3300046663 | Bacteria | 8257 |
| 340 | Ga0495635_0114915 | 3300046663 | Bacteria | 1837 |
| 341 | Ga0495635_0160669 | 3300046663 | Bacteria | 1529 |
| 342 | Ga0495635_0451855 | 3300046663 | Bacteria | 849 |
| 343 | Ga0495635_0706746 | 3300046663 | Bacteria | 653 |
| 344 | Ga0495588_0171712 | 3300046674 | Bacteria | 1146 |
| 345 | Ga0495657_0001225 | 3300046675 | Bacteria | 22494 |
| 346 | Ga0495657_0050279 | 3300046675 | Bacteria | 2802 |
| 347 | Ga0495657_0191611 | 3300046675 | Bacteria | 1249 |
| 348 | Ga0495599_0002030 | 3300046678 | Bacteria | 11712 |
| 349 | Ga0495599_0025867 | 3300046678 | Bacteria | 3676 |
| 350 | Ga0495599_0084249 | 3300046678 | Bacteria | 1985 |
| 351 | Ga0495599_0211532 | 3300046678 | Bacteria | 1189 |
| 352 | Ga0495623_0011352 | 3300046679 | Bacteria | 5763 |
| 353 | Ga0495623_0042520 | 3300046679 | Bacteria | 2894 |
| 354 | Ga0495623_0115561 | 3300046679 | Bacteria | 1622 |
| 355 | Ga0495623_0144047 | 3300046679 | Bacteria | 1415 |
| 356 | Ga0495646_0005348 | 3300046680 | Bacteria | 8103 |
| 357 | Ga0495646_0124457 | 3300046680 | Bacteria | 1456 |
| 358 | Ga0495646_0204415 | 3300046680 | Bacteria | 1074 |
| 359 | Ga0495647_0006478 | 3300046681 | Bacteria | 3880 |
| 360 | Ga0495658_0002793 | 3300046683 | Bacteria | 8773 |
| 361 | Ga0495613_0074586 | 3300046689 | Bacteria | 2470 |
| 362 | Ga0495624_0000780 | 3300046690 | Bacteria | 25115 |
| 363 | Ga0495600_0001844 | 3300046809 | Bacteria | 11873 |
| 364 | Ga0495600_0060682 | 3300046809 | Bacteria | 2469 |
| 365 | Ga0495600_0075974 | 3300046809 | Bacteria | 2193 |
| 366 | Ga0495581_0002815 | 3300047315 | Bacteria | 9932 |
| 367 | Ga0495604_0002683 | 3300047317 | Bacteria | 14270 |
| 368 | Ga0495604_0032412 | 3300047317 | Bacteria | 4141 |
| 369 | Ga0495604_0550870 | 3300047317 | Bacteria | 744 |
| 370 | Ga0495674_0002259 | 3300047319 | Bacteria | 18936 |
| 371 | Ga0495674_0007120 | 3300047319 | Bacteria | 10702 |
| 372 | Ga0495674_0028879 | 3300047319 | Bacteria | 5052 |
| 373 | Ga0495674_0091121 | 3300047319 | Bacteria | 2604 |
| 374 | Ga0495674_0183878 | 3300047319 | Bacteria | 1739 |
| 375 | Ga0495676_0003733 | 3300047321 | Bacteria | 13830 |
| 376 | Ga0495680_0007702 | 3300047322 | Bacteria | 9830 |
| 377 | Ga0495680_0016971 | 3300047322 | Bacteria | 6233 |
| 378 | Ga0495680_0245117 | 3300047322 | Bacteria | 1271 |
| 379 | Ga0495680_0393776 | 3300047322 | Bacteria | 957 |
| 380 | Ga0495675_0013866 | 3300047444 | Bacteria | 5095 |
| 381 | Ga0495675_0031547 | 3300047444 | Bacteria | 3383 |
| 382 | Ga0495675_0641016 | 3300047444 | Bacteria | 599 |
| 383 | Ga0495684_0002248 | 3300047471 | Bacteria | 15460 |
| 384 | Ga0495684_0013779 | 3300047471 | Bacteria | 6222 |
| 385 | Ga0495593_0000853 | 3300047673 | Bacteria | 17662 |
| 386 | Ga0495602_0001444 | 3300048088 | Bacteria | 23598 |
| 387 | Ga0495602_0166285 | 3300048088 | Bacteria | 1716 |
| 388 | Ga0495602_0278661 | 3300048088 | Bacteria | 1233 |
| 389 | Ga0495602_0390602 | 3300048088 | Bacteria | 994 |
| 390 | Ga0495614_0017054 | 3300048089 | Bacteria | 3156 |
| 391 | Ga0496100_0005711 | 3300048903 | Bacteria | 6729 |
| 392 | Ga0496100_0024230 | 3300048903 | Bacteria | 3698 |
| 393 | Ga0496101_0278221 | 3300048904 | Bacteria | 1307 |
| 394 | Ga0496102_0601258 | 3300048905 | Bacteria | 1023 |
| 395 | Ga0496102_0968639 | 3300048905 | Bacteria | 771 |
| 396 | Ga0496103_0151906 | 3300048906 | Bacteria | 1483 |
| 397 | Ga0496103_0287379 | 3300048906 | Bacteria | 1058 |
| 398 | Ga0496104_0285310 | 3300048907 | Bacteria | 1564 |
| 399 | Ga0496105_0069021 | 3300048908 | Bacteria | 2920 |
| 400 | Ga0496105_0093654 | 3300048908 | Bacteria | 2481 |
| 401 | Ga0496106_0510873 | 3300048909 | Bacteria | 965 |
| 402 | Ga0496106_0783549 | 3300048909 | Bacteria | 757 |
| 403 | Ga0496107_0062422 | 3300048910 | Bacteria | 2699 |
| 404 | Ga0496107_0500321 | 3300048910 | Bacteria | 901 |
| 405 | Ga0496108_0168421 | 3300048911 | Bacteria | 1894 |
| 406 | Ga0496109_0966333 | 3300048912 | Bacteria | 789 |
| 407 | Ga0496110_0066763 | 3300048913 | Bacteria | 3181 |
| 408 | Ga0496111_0094497 | 3300048914 | Bacteria | 2192 |
| 409 | Ga0496112_0069726 | 3300048915 | Bacteria | 3472 |
| 410 | Ga0496113_0019253 | 3300048916 | Bacteria | 4771 |
| 411 | Ga0496113_0099644 | 3300048916 | Bacteria | 2250 |
| 412 | Ga0496113_0977337 | 3300048916 | Bacteria | 667 |
| 413 | Ga0496114_0171962 | 3300048917 | Bacteria | 1888 |
| 414 | Ga0496115_0039617 | 3300048918 | Bacteria | 3743 |
| 415 | Ga0496115_0131433 | 3300048918 | Bacteria | 2063 |
| 416 | Ga0496121_0417048 | 3300048924 | Bacteria | 875 |
| 417 | Ga0496125_0412360 | 3300048928 | Bacteria | 786 |
| 418 | Ga0496126_0089979 | 3300048929 | Bacteria | 2701 |
| 419 | nmdc:mga07m45_1083_c1 | 3300050496 | Bacteria | 12127 |
| 420 | nmdc:mga05p37_55289_c1 | 3300050507 | Unclassified | 4884 |
| 421 | nmdc:mga09592_734007_c1 | 3300050508 | Bacteria | 839 |
| 422 | nmdc:mga08y16_240787_c1 | 3300050511 | Unclassified | 1870 |
| 423 | nmdc:mga0n895_29353_c1 | 3300050512 | Bacteria | 5244 |
| 424 | nmdc:mga0rr50_181201_c1 | 3300050513 | Bacteria | 1722 |
| 425 | nmdc:mga0rr50_447327_c1 | 3300050513 | Bacteria | 1095 |
| 426 | nmdc:mga0a205_59911_c1 | 3300050515 | Unclassified | 3677 |
| 427 | Ga0495601_0003542 | 3300053077 | Bacteria | 8975 |
| 428 | Ga0495601_0473573 | 3300053077 | Bacteria | 809 |
| 429 | Ga0495612_0000732 | 3300053078 | Bacteria | 13334 |
| 430 | Ga0495595_0003218 | 3300053084 | Bacteria | 6482 |
| 431 | Ga0495595_0459159 | 3300053084 | Bacteria | 648 |
| 432 | Ga0495619_0006860 | 3300053085 | Bacteria | 7202 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_101080464 | Ga0075434_1010804641 | 124 |
| 2 | 3300012507 | Ga0157342_1055254 | Ga0157342_10552541 | 124 |
| 3 | iso_pu_bacteria | 2728369276 | 2729908223 | 131 |
| 4 | 3300005355 | Ga0070671_100442462 | Ga0070671_1004424622 | 132 |
| 5 | 3300011119 | Ga0105246_11729748 | Ga0105246_117297481 | 132 |
| 6 | 3300013296 | Ga0157374_11682334 | Ga0157374_116823341 | 132 |
| 7 | 3300025986 | Ga0207658_10704854 | Ga0207658_107048542 | 133 |
| 8 | 3300048928 | Ga0496125_0412360 | Ga0496125_0412360_176_583 | 133 |
| 9 | 3300006353 | Ga0075370_10055587 | Ga0075370_100555874 | 134 |
| 10 | 3300050496 | nmdc:mga07m45_1083_c1 | nmdc:mga07m45_1083_c1_10848_11258 | 134 |
| 11 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004143 | 135 |
| 12 | 3300012495 | Ga0157323_1028930 | Ga0157323_10289301 | 135 |
| 13 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003116 | 135 |
| 14 | 3300039450 | Ga0436363_0688255 | Ga0436363_0688255_33_443 | 135 |
| 15 | 3300048924 | Ga0496121_0417048 | Ga0496121_0417048_307_714 | 135 |
| 16 | 3300005347 | Ga0070668_100701183 | Ga0070668_1007011832 | 136 |
| 17 | 3300005366 | Ga0070659_101587161 | Ga0070659_1015871611 | 136 |
| 18 | 3300005718 | Ga0068866_11038032 | Ga0068866_110380321 | 136 |
| 19 | 3300026121 | Ga0207683_10370663 | Ga0207683_103706632 | 136 |
| 20 | 3300032126 | Ga0307415_101094575 | Ga0307415_1010945752 | 136 |
| 21 | 3300037418 | Ga0395900_0048005 | Ga0395900_0048005_629_1048 | 136 |
| 22 | 3300037466 | Ga0395898_0368604 | Ga0395898_0368604_565_984 | 136 |
| 23 | 3300041452 | Ga0451793_0703339 | Ga0451793_0703339_149_568 | 136 |
| 24 | 3300048907 | Ga0496104_0285310 | Ga0496104_0285310_57_479 | 136 |
| 25 | 3300048908 | Ga0496105_0093654 | Ga0496105_0093654_1847_2269 | 136 |
| 26 | iso_pu_bacteria | 2643221961 | 2645720558 | 136 |
| 27 | 3300037466 | Ga0395898_0011357 | Ga0395898_0011357_3956_4372 | 137 |
| 28 | iso_pu_bacteria | 2808606371 | 2808896642 | 137 |
| 29 | 3300005355 | Ga0070671_100849874 | Ga0070671_1008498742 | 138 |
| 30 | 3300005436 | Ga0070713_100146682 | Ga0070713_1001466822 | 138 |
| 31 | 3300005616 | Ga0068852_100062567 | Ga0068852_1000625672 | 138 |
| 32 | 3300025928 | Ga0207700_10020832 | Ga0207700_100208323 | 138 |
| 33 | 3300046518 | Ga0495631_0459569 | Ga0495631_0459569_15_452 | 138 |
| 34 | 3300048929 | Ga0496126_0089979 | Ga0496126_0089979_497_919 | 138 |
| 35 | 3300005366 | Ga0070659_101073337 | Ga0070659_1010733371 | 139 |
| 36 | 3300005367 | Ga0070667_100878689 | Ga0070667_1008786892 | 139 |
| 37 | 3300005618 | Ga0068864_100000930 | Ga0068864_10000093014 | 139 |
| 38 | 3300005719 | Ga0068861_100093032 | Ga0068861_1000930323 | 139 |
| 39 | 3300005842 | Ga0068858_100000022 | Ga0068858_100000022105 | 139 |
| 40 | 3300006358 | Ga0068871_100268847 | Ga0068871_1002688473 | 139 |
| 41 | 3300006847 | Ga0075431_101506105 | Ga0075431_1015061051 | 139 |
| 42 | 3300006880 | Ga0075429_100800526 | Ga0075429_1008005262 | 139 |
| 43 | 3300007076 | Ga0075435_100460345 | Ga0075435_1004603452 | 139 |
| 44 | 3300009094 | Ga0111539_10086651 | Ga0111539_100866516 | 139 |
| 45 | 3300009101 | Ga0105247_10041186 | Ga0105247_100411862 | 139 |
| 46 | 3300009147 | Ga0114129_10006106 | Ga0114129_100061063 | 139 |
| 47 | 3300009148 | Ga0105243_10116052 | Ga0105243_101160522 | 139 |
| 48 | 3300009177 | Ga0105248_10072238 | Ga0105248_100722384 | 139 |
| 49 | 3300009177 | Ga0105248_10116473 | Ga0105248_101164735 | 139 |
| 50 | 3300013306 | Ga0163162_10024602 | Ga0163162_100246026 | 139 |
| 51 | 3300025315 | Ga0207697_10229015 | Ga0207697_102290152 | 139 |
| 52 | 3300025900 | Ga0207710_10090045 | Ga0207710_100900452 | 139 |
| 53 | 3300025941 | Ga0207711_10024043 | Ga0207711_100240434 | 139 |
| 54 | 3300025941 | Ga0207711_10105243 | Ga0207711_101052433 | 139 |
| 55 | 3300025961 | Ga0207712_10417116 | Ga0207712_104171162 | 139 |
| 56 | 3300026035 | Ga0207703_10000048 | Ga0207703_10000048106 | 139 |
| 57 | 3300026095 | Ga0207676_10000239 | Ga0207676_1000023921 | 139 |
| 58 | 3300026118 | Ga0207675_100213941 | Ga0207675_1002139412 | 139 |
| 59 | 3300031548 | Ga0307408_101027728 | Ga0307408_1010277281 | 139 |
| 60 | 3300032126 | Ga0307415_101187188 | Ga0307415_1011871881 | 139 |
| 61 | 3300037418 | Ga0395900_0255462 | Ga0395900_0255462_230_673 | 139 |
| 62 | 3300037471 | Ga0395905_0125588 | Ga0395905_0125588_573_1016 | 139 |
| 63 | 3300041453 | Ga0451797_0165164 | Ga0451797_0165164_588_1007 | 139 |
| 64 | 3300041460 | Ga0451802_1596096 | Ga0451802_1596096_745_1164 | 139 |
| 65 | 3300041505 | Ga0451849_0616188 | Ga0451849_0616188_234_653 | 139 |
| 66 | 3300045051 | Ga0451576_1335649 | Ga0451576_1335649_54_473 | 139 |
| 67 | 3300048088 | Ga0495602_0278661 | Ga0495602_0278661_517_1017 | 139 |
| 68 | 3300048903 | Ga0496100_0005711 | Ga0496100_0005711_1127_1558 | 139 |
| 69 | 3300048906 | Ga0496103_0287379 | Ga0496103_0287379_567_1004 | 139 |
| 70 | 3300048909 | Ga0496106_0510873 | Ga0496106_0510873_157_588 | 139 |
| 71 | 3300048910 | Ga0496107_0500321 | Ga0496107_0500321_180_611 | 139 |
| 72 | 3300048918 | Ga0496115_0039617 | Ga0496115_0039617_368_799 | 139 |
| 73 | 3300050507 | nmdc:mga05p37_55289_c1 | nmdc:mga05p37_55289_c1_3936_4364 | 139 |
| 74 | 3300050508 | nmdc:mga09592_734007_c1 | nmdc:mga09592_734007_c1_167_595 | 139 |
| 75 | 3300050511 | nmdc:mga08y16_240787_c1 | nmdc:mga08y16_240787_c1_753_1181 | 139 |
| 76 | 3300050512 | nmdc:mga0n895_29353_c1 | nmdc:mga0n895_29353_c1_917_1345 | 139 |
| 77 | 3300050513 | nmdc:mga0rr50_181201_c1 | nmdc:mga0rr50_181201_c1_245_673 | 139 |
| 78 | 3300050515 | nmdc:mga0a205_59911_c1 | nmdc:mga0a205_59911_c1_1676_2104 | 139 |
| 79 | 3300005330 | Ga0070690_100018149 | Ga0070690_1000181495 | 140 |
| 80 | 3300005334 | Ga0068869_100254215 | Ga0068869_1002542152 | 140 |
| 81 | 3300005337 | Ga0070682_100092387 | Ga0070682_1000923873 | 140 |
| 82 | 3300005337 | Ga0070682_100150913 | Ga0070682_1001509132 | 140 |
| 83 | 3300005338 | Ga0068868_100125376 | Ga0068868_1001253763 | 140 |
| 84 | 3300005339 | Ga0070660_100503604 | Ga0070660_1005036041 | 140 |
| 85 | 3300005340 | Ga0070689_100082073 | Ga0070689_1000820732 | 140 |
| 86 | 3300005341 | Ga0070691_10036635 | Ga0070691_100366353 | 140 |
| 87 | 3300005345 | Ga0070692_10469580 | Ga0070692_104695802 | 140 |
| 88 | 3300005353 | Ga0070669_100151741 | Ga0070669_1001517411 | 140 |
| 89 | 3300005354 | Ga0070675_100077815 | Ga0070675_1000778153 | 140 |
| 90 | 3300005354 | Ga0070675_100675738 | Ga0070675_1006757382 | 140 |
| 91 | 3300005365 | Ga0070688_100911818 | Ga0070688_1009118181 | 140 |
| 92 | 3300005366 | Ga0070659_100090917 | Ga0070659_1000909172 | 140 |
| 93 | 3300005367 | Ga0070667_100640910 | Ga0070667_1006409101 | 140 |
| 94 | 3300005406 | Ga0070703_10114108 | Ga0070703_101141082 | 140 |
| 95 | 3300005434 | Ga0070709_10047343 | Ga0070709_100473433 | 140 |
| 96 | 3300005434 | Ga0070709_10594231 | Ga0070709_105942311 | 140 |
| 97 | 3300005435 | Ga0070714_100883473 | Ga0070714_1008834731 | 140 |
| 98 | 3300005436 | Ga0070713_100132747 | Ga0070713_1001327472 | 140 |
| 99 | 3300005436 | Ga0070713_101494139 | Ga0070713_1014941391 | 140 |
| 100 | 3300005437 | Ga0070710_10087914 | Ga0070710_100879143 | 140 |
| 101 | 3300005437 | Ga0070710_10089460 | Ga0070710_100894602 | 140 |
| 102 | 3300005439 | Ga0070711_100114807 | Ga0070711_1001148072 | 140 |
| 103 | 3300005440 | Ga0070705_100049256 | Ga0070705_1000492562 | 140 |
| 104 | 3300005445 | Ga0070708_100096284 | Ga0070708_1000962845 | 140 |
| 105 | 3300005456 | Ga0070678_100190154 | Ga0070678_1001901541 | 140 |
| 106 | 3300005457 | Ga0070662_100027960 | Ga0070662_1000279602 | 140 |
| 107 | 3300005458 | Ga0070681_10933609 | Ga0070681_109336092 | 140 |
| 108 | 3300005467 | Ga0070706_100009266 | Ga0070706_1000092663 | 140 |
| 109 | 3300005467 | Ga0070706_100207120 | Ga0070706_1002071202 | 140 |
| 110 | 3300005467 | Ga0070706_100424716 | Ga0070706_1004247162 | 140 |
| 111 | 3300005468 | Ga0070707_100004246 | Ga0070707_1000042467 | 140 |
| 112 | 3300005468 | Ga0070707_100231668 | Ga0070707_1002316683 | 140 |
| 113 | 3300005468 | Ga0070707_100502870 | Ga0070707_1005028702 | 140 |
| 114 | 3300005468 | Ga0070707_100677797 | Ga0070707_1006777972 | 140 |
| 115 | 3300005468 | Ga0070707_100725789 | Ga0070707_1007257892 | 140 |
| 116 | 3300005471 | Ga0070698_100100562 | Ga0070698_1001005622 | 140 |
| 117 | 3300005471 | Ga0070698_100593653 | Ga0070698_1005936532 | 140 |
| 118 | 3300005518 | Ga0070699_100000682 | Ga0070699_1000006829 | 140 |
| 119 | 3300005530 | Ga0070679_100233514 | Ga0070679_1002335142 | 140 |
| 120 | 3300005535 | Ga0070684_100367912 | Ga0070684_1003679122 | 140 |
| 121 | 3300005536 | Ga0070697_100322157 | Ga0070697_1003221571 | 140 |
| 122 | 3300005536 | Ga0070697_101113632 | Ga0070697_1011136321 | 140 |
| 123 | 3300005539 | Ga0068853_100087600 | Ga0068853_1000876002 | 140 |
| 124 | 3300005544 | Ga0070686_100276412 | Ga0070686_1002764122 | 140 |
| 125 | 3300005547 | Ga0070693_100083501 | Ga0070693_1000835012 | 140 |
| 126 | 3300005548 | Ga0070665_100006013 | Ga0070665_10000601316 | 140 |
| 127 | 3300005548 | Ga0070665_100122260 | Ga0070665_1001222603 | 140 |
| 128 | 3300005549 | Ga0070704_100043041 | Ga0070704_1000430413 | 140 |
| 129 | 3300005563 | Ga0068855_100302884 | Ga0068855_1003028842 | 140 |
| 130 | 3300005564 | Ga0070664_100235104 | Ga0070664_1002351042 | 140 |
| 131 | 3300005577 | Ga0068857_100090744 | Ga0068857_1000907444 | 140 |
| 132 | 3300005577 | Ga0068857_100184058 | Ga0068857_1001840582 | 140 |
| 133 | 3300005578 | Ga0068854_100050416 | Ga0068854_1000504163 | 140 |
| 134 | 3300005718 | Ga0068866_10100658 | Ga0068866_101006581 | 140 |
| 135 | 3300005719 | Ga0068861_100110425 | Ga0068861_1001104252 | 140 |
| 136 | 3300005834 | Ga0068851_10131273 | Ga0068851_101312732 | 140 |
| 137 | 3300005840 | Ga0068870_10343292 | Ga0068870_103432921 | 140 |
| 138 | 3300005841 | Ga0068863_100098250 | Ga0068863_1000982502 | 140 |
| 139 | 3300005842 | Ga0068858_100154409 | Ga0068858_1001544092 | 140 |
| 140 | 3300005843 | Ga0068860_100110015 | Ga0068860_1001100154 | 140 |
| 141 | 3300005844 | Ga0068862_100399330 | Ga0068862_1003993302 | 140 |
| 142 | 3300005983 | Ga0081540_1000824 | Ga0081540_100082432 | 140 |
| 143 | 3300006028 | Ga0070717_10182437 | Ga0070717_101824372 | 140 |
| 144 | 3300006028 | Ga0070717_10433541 | Ga0070717_104335412 | 140 |
| 145 | 3300006028 | Ga0070717_10670561 | Ga0070717_106705612 | 140 |
| 146 | 3300006028 | Ga0070717_11402467 | Ga0070717_114024672 | 140 |
| 147 | 3300006173 | Ga0070716_100007263 | Ga0070716_1000072632 | 140 |
| 148 | 3300006173 | Ga0070716_100103755 | Ga0070716_1001037553 | 140 |
| 149 | 3300006175 | Ga0070712_100030396 | Ga0070712_1000303963 | 140 |
| 150 | 3300006175 | Ga0070712_100076212 | Ga0070712_1000762122 | 140 |
| 151 | 3300006175 | Ga0070712_100386258 | Ga0070712_1003862582 | 140 |
| 152 | 3300006237 | Ga0097621_100075052 | Ga0097621_1000750522 | 140 |
| 153 | 3300006358 | Ga0068871_100152049 | Ga0068871_1001520491 | 140 |
| 154 | 3300006871 | Ga0075434_101366421 | Ga0075434_1013664212 | 140 |
| 155 | 3300006881 | Ga0068865_101317074 | Ga0068865_1013170742 | 140 |
| 156 | 3300007788 | Ga0099795_10378047 | Ga0099795_103780471 | 140 |
| 157 | 3300009093 | Ga0105240_10195822 | Ga0105240_101958223 | 140 |
| 158 | 3300009098 | Ga0105245_10923840 | Ga0105245_109238402 | 140 |
| 159 | 3300009101 | Ga0105247_10141648 | Ga0105247_101416482 | 140 |
| 160 | 3300009101 | Ga0105247_10727071 | Ga0105247_107270712 | 140 |
| 161 | 3300009147 | Ga0114129_10292176 | Ga0114129_102921763 | 140 |
| 162 | 3300009148 | Ga0105243_11515557 | Ga0105243_115155571 | 140 |
| 163 | 3300009177 | Ga0105248_12231981 | Ga0105248_122319812 | 140 |
| 164 | 3300009545 | Ga0105237_10889639 | Ga0105237_108896392 | 140 |
| 165 | 3300009545 | Ga0105237_11944704 | Ga0105237_119447042 | 140 |
| 166 | 3300009545 | Ga0105237_12004525 | Ga0105237_120045251 | 140 |
| 167 | 3300010375 | Ga0105239_10526327 | Ga0105239_105263272 | 140 |
| 168 | 3300012500 | Ga0157314_1011178 | Ga0157314_10111781 | 140 |
| 169 | 3300012515 | Ga0157338_1056223 | Ga0157338_10562231 | 140 |
| 170 | 3300013100 | Ga0157373_10039780 | Ga0157373_100397804 | 140 |
| 171 | 3300013102 | Ga0157371_10032698 | Ga0157371_100326982 | 140 |
| 172 | 3300013104 | Ga0157370_10537820 | Ga0157370_105378202 | 140 |
| 173 | 3300013105 | Ga0157369_10613385 | Ga0157369_106133852 | 140 |
| 174 | 3300013105 | Ga0157369_10792223 | Ga0157369_107922232 | 140 |
| 175 | 3300013296 | Ga0157374_10488464 | Ga0157374_104884641 | 140 |
| 176 | 3300013296 | Ga0157374_11007131 | Ga0157374_110071312 | 140 |
| 177 | 3300013297 | Ga0157378_10847157 | Ga0157378_108471572 | 140 |
| 178 | 3300013307 | Ga0157372_10138057 | Ga0157372_101380572 | 140 |
| 179 | 3300013307 | Ga0157372_11088441 | Ga0157372_110884412 | 140 |
| 180 | 3300013308 | Ga0157375_10136034 | Ga0157375_101360342 | 140 |
| 181 | 3300014325 | Ga0163163_10254190 | Ga0163163_102541901 | 140 |
| 182 | 3300014325 | Ga0163163_10265264 | Ga0163163_102652641 | 140 |
| 183 | 3300014497 | Ga0182008_10067760 | Ga0182008_100677602 | 140 |
| 184 | 3300014497 | Ga0182008_10119499 | Ga0182008_101194991 | 140 |
| 185 | 3300014745 | Ga0157377_10033266 | Ga0157377_100332662 | 140 |
| 186 | 3300014968 | Ga0157379_10402583 | Ga0157379_104025831 | 140 |
| 187 | 3300015265 | Ga0182005_1040190 | Ga0182005_10401901 | 140 |
| 188 | 3300020082 | Ga0206353_10549335 | Ga0206353_105493352 | 140 |
| 189 | 3300025885 | Ga0207653_10116753 | Ga0207653_101167532 | 140 |
| 190 | 3300025898 | Ga0207692_10060640 | Ga0207692_100606402 | 140 |
| 191 | 3300025899 | Ga0207642_10090037 | Ga0207642_100900372 | 140 |
| 192 | 3300025903 | Ga0207680_10489803 | Ga0207680_104898031 | 140 |
| 193 | 3300025905 | Ga0207685_10111695 | Ga0207685_101116951 | 140 |
| 194 | 3300025906 | Ga0207699_10060098 | Ga0207699_100600983 | 140 |
| 195 | 3300025906 | Ga0207699_10224455 | Ga0207699_102244551 | 140 |
| 196 | 3300025907 | Ga0207645_10092283 | Ga0207645_100922832 | 140 |
| 197 | 3300025908 | Ga0207643_10006027 | Ga0207643_100060272 | 140 |
| 198 | 3300025910 | Ga0207684_10020450 | Ga0207684_100204507 | 140 |
| 199 | 3300025910 | Ga0207684_10066700 | Ga0207684_100667004 | 140 |
| 200 | 3300025910 | Ga0207684_10504423 | Ga0207684_105044232 | 140 |
| 201 | 3300025915 | Ga0207693_10019920 | Ga0207693_100199207 | 140 |
| 202 | 3300025915 | Ga0207693_10125669 | Ga0207693_101256693 | 140 |
| 203 | 3300025915 | Ga0207693_10174023 | Ga0207693_101740233 | 140 |
| 204 | 3300025915 | Ga0207693_10328579 | Ga0207693_103285792 | 140 |
| 205 | 3300025916 | Ga0207663_10043034 | Ga0207663_100430342 | 140 |
| 206 | 3300025918 | Ga0207662_10061263 | Ga0207662_100612632 | 140 |
| 207 | 3300025919 | Ga0207657_10066131 | Ga0207657_100661312 | 140 |
| 208 | 3300025922 | Ga0207646_10087251 | Ga0207646_100872514 | 140 |
| 209 | 3300025922 | Ga0207646_10307515 | Ga0207646_103075152 | 140 |
| 210 | 3300025922 | Ga0207646_10393407 | Ga0207646_103934072 | 140 |
| 211 | 3300025922 | Ga0207646_10864069 | Ga0207646_108640692 | 140 |
| 212 | 3300025923 | Ga0207681_10506860 | Ga0207681_105068602 | 140 |
| 213 | 3300025924 | Ga0207694_10352564 | Ga0207694_103525642 | 140 |
| 214 | 3300025926 | Ga0207659_10727722 | Ga0207659_107277221 | 140 |
| 215 | 3300025927 | Ga0207687_10258800 | Ga0207687_102588002 | 140 |
| 216 | 3300025928 | Ga0207700_10019614 | Ga0207700_100196142 | 140 |
| 217 | 3300025928 | Ga0207700_10651174 | Ga0207700_106511741 | 140 |
| 218 | 3300025928 | Ga0207700_11402348 | Ga0207700_114023481 | 140 |
| 219 | 3300025929 | Ga0207664_10020229 | Ga0207664_100202292 | 140 |
| 220 | 3300025929 | Ga0207664_10070181 | Ga0207664_100701814 | 140 |
| 221 | 3300025929 | Ga0207664_10454488 | Ga0207664_104544882 | 140 |
| 222 | 3300025929 | Ga0207664_10852627 | Ga0207664_108526272 | 140 |
| 223 | 3300025929 | Ga0207664_10986321 | Ga0207664_109863211 | 140 |
| 224 | 3300025932 | Ga0207690_10210462 | Ga0207690_102104622 | 140 |
| 225 | 3300025933 | Ga0207706_10033370 | Ga0207706_100333702 | 140 |
| 226 | 3300025935 | Ga0207709_10089976 | Ga0207709_100899762 | 140 |
| 227 | 3300025939 | Ga0207665_10008206 | Ga0207665_100082068 | 140 |
| 228 | 3300025939 | Ga0207665_10048695 | Ga0207665_100486952 | 140 |
| 229 | 3300025941 | Ga0207711_10714530 | Ga0207711_107145301 | 140 |
| 230 | 3300025942 | Ga0207689_10030711 | Ga0207689_100307114 | 140 |
| 231 | 3300025944 | Ga0207661_10653501 | Ga0207661_106535012 | 140 |
| 232 | 3300025945 | Ga0207679_10371806 | Ga0207679_103718061 | 140 |
| 233 | 3300025949 | Ga0207667_11478036 | Ga0207667_114780361 | 140 |
| 234 | 3300025981 | Ga0207640_10106804 | Ga0207640_101068043 | 140 |
| 235 | 3300026023 | Ga0207677_10345206 | Ga0207677_103452062 | 140 |
| 236 | 3300026035 | Ga0207703_11111196 | Ga0207703_111111961 | 140 |
| 237 | 3300026041 | Ga0207639_10307405 | Ga0207639_103074052 | 140 |
| 238 | 3300026067 | Ga0207678_10003453 | Ga0207678_1000345316 | 140 |
| 239 | 3300026078 | Ga0207702_10019227 | Ga0207702_100192272 | 140 |
| 240 | 3300026078 | Ga0207702_10494398 | Ga0207702_104943982 | 140 |
| 241 | 3300026089 | Ga0207648_10032654 | Ga0207648_100326541 | 140 |
| 242 | 3300026095 | Ga0207676_11273851 | Ga0207676_112738512 | 140 |
| 243 | 3300026116 | Ga0207674_10005432 | Ga0207674_100054322 | 140 |
| 244 | 3300026118 | Ga0207675_100275646 | Ga0207675_1002756463 | 140 |
| 245 | 3300026121 | Ga0207683_10708299 | Ga0207683_107082992 | 140 |
| 246 | 3300028379 | Ga0268266_10015036 | Ga0268266_100150366 | 140 |
| 247 | 3300028379 | Ga0268266_10503641 | Ga0268266_105036411 | 140 |
| 248 | 3300030763 | Ga0265763_1040003 | Ga0265763_10400032 | 140 |
| 249 | 3300030878 | Ga0265770_1128721 | Ga0265770_11287211 | 140 |
| 250 | 3300031090 | Ga0265760_10049146 | Ga0265760_100491462 | 140 |
| 251 | 3300034817 | Ga0373948_0032555 | Ga0373948_0032555_479_910 | 140 |
| 252 | 3300034819 | Ga0373958_0025175 | Ga0373958_0025175_566_997 | 140 |
| 253 | 3300035083 | Ga0373926_0000761 | Ga0373926_0000761_3648_4088 | 140 |
| 254 | 3300035084 | Ga0373928_0016884 | Ga0373928_0016884_731_1162 | 140 |
| 255 | 3300035086 | Ga0373934_0004895 | Ga0373934_0004895_2219_2659 | 140 |
| 256 | 3300035088 | Ga0373940_0337212 | Ga0373940_0337212_34_465 | 140 |
| 257 | 3300035089 | Ga0373944_0001900 | Ga0373944_0001900_4594_5034 | 140 |
| 258 | 3300035090 | Ga0373949_0012054 | Ga0373949_0012054_1153_1584 | 140 |
| 259 | 3300035092 | Ga0373952_0022850 | Ga0373952_0022850_327_758 | 140 |
| 260 | 3300035111 | Ga0373923_0000124 | Ga0373923_0000124_12816_13256 | 140 |
| 261 | 3300035112 | Ga0373932_0004292 | Ga0373932_0004292_1306_1737 | 140 |
| 262 | 3300035113 | Ga0373936_0000187 | Ga0373936_0000187_7656_8096 | 140 |
| 263 | 3300035113 | Ga0373936_0119002 | Ga0373936_0119002_337_768 | 140 |
| 264 | 3300035115 | Ga0373941_0038482 | Ga0373941_0038482_249_680 | 140 |
| 265 | 3300035116 | Ga0373945_0001244 | Ga0373945_0001244_2365_2805 | 140 |
| 266 | 3300035117 | Ga0373953_0001294 | Ga0373953_0001294_551_991 | 140 |
| 267 | 3300035118 | Ga0373954_0028107 | Ga0373954_0028107_1729_2169 | 140 |
| 268 | 3300035119 | Ga0373956_0022847 | Ga0373956_0022847_381_821 | 140 |
| 269 | 3300035120 | Ga0373957_0047911 | Ga0373957_0047911_798_1280 | 140 |
| 270 | 3300035120 | Ga0373957_0173952 | Ga0373957_0173952_238_678 | 140 |
| 271 | 3300035170 | Ga0373943_0016225 | Ga0373943_0016225_2113_2553 | 140 |
| 272 | 3300035170 | Ga0373943_0287043 | Ga0373943_0287043_419_850 | 140 |
| 273 | 3300035171 | Ga0373946_0000543 | Ga0373946_0000543_6743_7183 | 140 |
| 274 | 3300035172 | Ga0373955_0007724 | Ga0373955_0007724_3978_4418 | 140 |
| 275 | 3300035172 | Ga0373955_0079343 | Ga0373955_0079343_153_635 | 140 |
| 276 | 3300035242 | Ga0373962_0008870 | Ga0373962_0008870_1783_2214 | 140 |
| 277 | 3300035410 | Ga0373924_0001045 | Ga0373924_0001045_5523_5963 | 140 |
| 278 | 3300035692 | Ga0373935_0009226 | Ga0373935_0009226_653_1093 | 140 |
| 279 | 3300035692 | Ga0373935_0207937 | Ga0373935_0207937_451_933 | 140 |
| 280 | 3300035692 | Ga0373935_0502415 | Ga0373935_0502415_108_539 | 140 |
| 281 | 3300035695 | Ga0373927_0009479 | Ga0373927_0009479_324_764 | 140 |
| 282 | 3300035724 | Ga0373933_0012809 | Ga0373933_0012809_3517_3957 | 140 |
| 283 | 3300035724 | Ga0373933_0593034 | Ga0373933_0593034_50_481 | 140 |
| 284 | 3300035725 | Ga0373947_0003228 | Ga0373947_0003228_2492_2932 | 140 |
| 285 | 3300036401 | Ga0373937_0006504 | Ga0373937_0006504_8572_9054 | 140 |
| 286 | 3300036401 | Ga0373937_0020351 | Ga0373937_0020351_149_589 | 140 |
| 287 | 3300036401 | Ga0373937_0104952 | Ga0373937_0104952_194_625 | 140 |
| 288 | 3300037068 | Ga0373925_0000710 | Ga0373925_0000710_13845_14285 | 140 |
| 289 | 3300037853 | Ga0436364_0695951 | Ga0436364_0695951_904_1350 | 140 |
| 290 | 3300037853 | Ga0436364_1517018 | Ga0436364_1517018_8388_8864 | 140 |
| 291 | 3300039437 | Ga0436365_1458933 | Ga0436365_1458933_91_522 | 140 |
| 292 | 3300039438 | Ga0436360_0489904 | Ga0436360_0489904_81_512 | 140 |
| 293 | 3300039450 | Ga0436363_1003852 | Ga0436363_1003852_47_514 | 140 |
| 294 | 3300039453 | Ga0436362_0954635 | Ga0436362_0954635_717_1148 | 140 |
| 295 | 3300041460 | Ga0451802_1302443 | Ga0451802_1302443_482_916 | 140 |
| 296 | 3300044694 | Ga0466963_0260446 | Ga0466963_0260446_280_711 | 140 |
| 297 | 3300045976 | Ga0466967_0427866 | Ga0466967_0427866_490_921 | 140 |
| 298 | 3300046454 | Ga0495592_0023412 | Ga0495592_0023412_538_978 | 140 |
| 299 | 3300046454 | Ga0495592_0065640 | Ga0495592_0065640_1008_1490 | 140 |
| 300 | 3300046454 | Ga0495592_0465575 | Ga0495592_0465575_207_638 | 140 |
| 301 | 3300046455 | Ga0495603_0020816 | Ga0495603_0020816_2843_3283 | 140 |
| 302 | 3300046459 | Ga0495629_0012759 | Ga0495629_0012759_5332_5772 | 140 |
| 303 | 3300046461 | Ga0495641_0007073 | Ga0495641_0007073_6481_6921 | 140 |
| 304 | 3300046462 | Ga0495651_0000444 | Ga0495651_0000444_7244_7726 | 140 |
| 305 | 3300046462 | Ga0495651_0026443 | Ga0495651_0026443_2258_2689 | 140 |
| 306 | 3300046462 | Ga0495651_0326814 | Ga0495651_0326814_271_711 | 140 |
| 307 | 3300046463 | Ga0495653_0015420 | Ga0495653_0015420_4338_4820 | 140 |
| 308 | 3300046463 | Ga0495653_0253337 | Ga0495653_0253337_248_679 | 140 |
| 309 | 3300046463 | Ga0495653_0385864 | Ga0495653_0385864_271_711 | 140 |
| 310 | 3300046472 | Ga0495580_0037558 | Ga0495580_0037558_187_627 | 140 |
| 311 | 3300046473 | Ga0495582_0002868 | Ga0495582_0002868_4927_5367 | 140 |
| 312 | 3300046475 | Ga0495639_0003241 | Ga0495639_0003241_2084_2524 | 140 |
| 313 | 3300046476 | Ga0495662_0001521 | Ga0495662_0001521_6367_6807 | 140 |
| 314 | 3300046476 | Ga0495662_0018551 | Ga0495662_0018551_1822_2271 | 140 |
| 315 | 3300046477 | Ga0495664_0013136 | Ga0495664_0013136_538_978 | 140 |
| 316 | 3300046499 | Ga0495594_0035660 | Ga0495594_0035660_1492_1932 | 140 |
| 317 | 3300046511 | Ga0495608_0003665 | Ga0495608_0003665_5793_6275 | 140 |
| 318 | 3300046511 | Ga0495608_0020366 | Ga0495608_0020366_3936_4376 | 140 |
| 319 | 3300046511 | Ga0495608_0038902 | Ga0495608_0038902_904_1335 | 140 |
| 320 | 3300046514 | Ga0495618_0075937 | Ga0495618_0075937_938_1378 | 140 |
| 321 | 3300046514 | Ga0495618_0085937 | Ga0495618_0085937_1477_1908 | 140 |
| 322 | 3300046514 | Ga0495618_0089274 | Ga0495618_0089274_205_636 | 140 |
| 323 | 3300046514 | Ga0495618_0499387 | Ga0495618_0499387_91_522 | 140 |
| 324 | 3300046516 | Ga0495628_0015357 | Ga0495628_0015357_46_486 | 140 |
| 325 | 3300046516 | Ga0495628_0029822 | Ga0495628_0029822_173_613 | 140 |
| 326 | 3300046516 | Ga0495628_0144589 | Ga0495628_0144589_1304_1735 | 140 |
| 327 | 3300046517 | Ga0495630_0000690 | Ga0495630_0000690_13827_14267 | 140 |
| 328 | 3300046517 | Ga0495630_0149773 | Ga0495630_0149773_289_720 | 140 |
| 329 | 3300046517 | Ga0495630_0221868 | Ga0495630_0221868_401_850 | 140 |
| 330 | 3300046517 | Ga0495630_0536557 | Ga0495630_0536557_271_753 | 140 |
| 331 | 3300046526 | Ga0495666_0003593 | Ga0495666_0003593_4570_5010 | 140 |
| 332 | 3300046529 | Ga0495652_0000159 | Ga0495652_0000159_43489_43971 | 140 |
| 333 | 3300046529 | Ga0495652_0153299 | Ga0495652_0153299_1153_1584 | 140 |
| 334 | 3300046529 | Ga0495652_0236815 | Ga0495652_0236815_892_1341 | 140 |
| 335 | 3300046529 | Ga0495652_0270754 | Ga0495652_0270754_271_711 | 140 |
| 336 | 3300046529 | Ga0495652_0362971 | Ga0495652_0362971_48_479 | 140 |
| 337 | 3300046530 | Ga0495654_0373327 | Ga0495654_0373327_90_518 | 140 |
| 338 | 3300046531 | Ga0495665_0000714 | Ga0495665_0000714_12986_13426 | 140 |
| 339 | 3300046531 | Ga0495665_0504657 | Ga0495665_0504657_141_569 | 140 |
| 340 | 3300046533 | Ga0495640_0001225 | Ga0495640_0001225_13740_14180 | 140 |
| 341 | 3300046533 | Ga0495640_0013988 | Ga0495640_0013988_3742_4191 | 140 |
| 342 | 3300046535 | Ga0495586_0015134 | Ga0495586_0015134_3417_3857 | 140 |
| 343 | 3300046536 | Ga0495587_0000767 | Ga0495587_0000767_19423_19905 | 140 |
| 344 | 3300046536 | Ga0495587_0014787 | Ga0495587_0014787_199_639 | 140 |
| 345 | 3300046536 | Ga0495587_0027124 | Ga0495587_0027124_2849_3280 | 140 |
| 346 | 3300046543 | Ga0495645_0004159 | Ga0495645_0004159_3935_4375 | 140 |
| 347 | 3300046543 | Ga0495645_0011888 | Ga0495645_0011888_3261_3743 | 140 |
| 348 | 3300046543 | Ga0495645_0042349 | Ga0495645_0042349_2613_3044 | 140 |
| 349 | 3300046543 | Ga0495645_0168814 | Ga0495645_0168814_864_1313 | 140 |
| 350 | 3300046557 | Ga0495622_0046284 | Ga0495622_0046284_200_640 | 140 |
| 351 | 3300046557 | Ga0495622_0420692 | Ga0495622_0420692_117_545 | 140 |
| 352 | 3300046559 | Ga0495667_0003094 | Ga0495667_0003094_6872_7312 | 140 |
| 353 | 3300046559 | Ga0495667_0213948 | Ga0495667_0213948_208_639 | 140 |
| 354 | 3300046642 | Ga0495634_0007638 | Ga0495634_0007638_4940_5380 | 140 |
| 355 | 3300046642 | Ga0495634_0052373 | Ga0495634_0052373_1696_2178 | 140 |
| 356 | 3300046642 | Ga0495634_0119674 | Ga0495634_0119674_743_1174 | 140 |
| 357 | 3300046642 | Ga0495634_0171996 | Ga0495634_0171996_334_783 | 140 |
| 358 | 3300046663 | Ga0495635_0006316 | Ga0495635_0006316_5519_5959 | 140 |
| 359 | 3300046663 | Ga0495635_0114915 | Ga0495635_0114915_141_623 | 140 |
| 360 | 3300046663 | Ga0495635_0160669 | Ga0495635_0160669_1056_1505 | 140 |
| 361 | 3300046663 | Ga0495635_0451855 | Ga0495635_0451855_52_483 | 140 |
| 362 | 3300046663 | Ga0495635_0706746 | Ga0495635_0706746_12_443 | 140 |
| 363 | 3300046674 | Ga0495588_0171712 | Ga0495588_0171712_118_558 | 140 |
| 364 | 3300046675 | Ga0495657_0001225 | Ga0495657_0001225_17277_17759 | 140 |
| 365 | 3300046675 | Ga0495657_0050279 | Ga0495657_0050279_1825_2265 | 140 |
| 366 | 3300046675 | Ga0495657_0191611 | Ga0495657_0191611_425_856 | 140 |
| 367 | 3300046678 | Ga0495599_0002030 | Ga0495599_0002030_11115_11555 | 140 |
| 368 | 3300046678 | Ga0495599_0025867 | Ga0495599_0025867_2696_3178 | 140 |
| 369 | 3300046678 | Ga0495599_0084249 | Ga0495599_0084249_414_845 | 140 |
| 370 | 3300046678 | Ga0495599_0211532 | Ga0495599_0211532_705_1136 | 140 |
| 371 | 3300046679 | Ga0495623_0011352 | Ga0495623_0011352_4787_5227 | 140 |
| 372 | 3300046679 | Ga0495623_0042520 | Ga0495623_0042520_418_900 | 140 |
| 373 | 3300046679 | Ga0495623_0115561 | Ga0495623_0115561_12_455 | 140 |
| 374 | 3300046679 | Ga0495623_0144047 | Ga0495623_0144047_256_687 | 140 |
| 375 | 3300046680 | Ga0495646_0005348 | Ga0495646_0005348_930_1370 | 140 |
| 376 | 3300046680 | Ga0495646_0124457 | Ga0495646_0124457_128_610 | 140 |
| 377 | 3300046680 | Ga0495646_0204415 | Ga0495646_0204415_349_780 | 140 |
| 378 | 3300046681 | Ga0495647_0006478 | Ga0495647_0006478_249_689 | 140 |
| 379 | 3300046683 | Ga0495658_0002793 | Ga0495658_0002793_6036_6476 | 140 |
| 380 | 3300046689 | Ga0495613_0074586 | Ga0495613_0074586_206_646 | 140 |
| 381 | 3300046690 | Ga0495624_0000780 | Ga0495624_0000780_16693_17133 | 140 |
| 382 | 3300046809 | Ga0495600_0001844 | Ga0495600_0001844_10496_10978 | 140 |
| 383 | 3300046809 | Ga0495600_0060682 | Ga0495600_0060682_393_833 | 140 |
| 384 | 3300046809 | Ga0495600_0075974 | Ga0495600_0075974_523_954 | 140 |
| 385 | 3300047315 | Ga0495581_0002815 | Ga0495581_0002815_3978_4418 | 140 |
| 386 | 3300047317 | Ga0495604_0002683 | Ga0495604_0002683_9254_9736 | 140 |
| 387 | 3300047317 | Ga0495604_0032412 | Ga0495604_0032412_2139_2579 | 140 |
| 388 | 3300047317 | Ga0495604_0550870 | Ga0495604_0550870_43_474 | 140 |
| 389 | 3300047319 | Ga0495674_0002259 | Ga0495674_0002259_6058_6507 | 140 |
| 390 | 3300047319 | Ga0495674_0007120 | Ga0495674_0007120_5935_6417 | 140 |
| 391 | 3300047319 | Ga0495674_0028879 | Ga0495674_0028879_3978_4418 | 140 |
| 392 | 3300047319 | Ga0495674_0091121 | Ga0495674_0091121_1197_1628 | 140 |
| 393 | 3300047319 | Ga0495674_0183878 | Ga0495674_0183878_1279_1710 | 140 |
| 394 | 3300047321 | Ga0495676_0003733 | Ga0495676_0003733_6743_7183 | 140 |
| 395 | 3300047322 | Ga0495680_0007702 | Ga0495680_0007702_6671_7111 | 140 |
| 396 | 3300047322 | Ga0495680_0016971 | Ga0495680_0016971_3624_4106 | 140 |
| 397 | 3300047322 | Ga0495680_0245117 | Ga0495680_0245117_591_1022 | 140 |
| 398 | 3300047322 | Ga0495680_0393776 | Ga0495680_0393776_436_867 | 140 |
| 399 | 3300047444 | Ga0495675_0013866 | Ga0495675_0013866_4495_4935 | 140 |
| 400 | 3300047444 | Ga0495675_0031547 | Ga0495675_0031547_2267_2749 | 140 |
| 401 | 3300047444 | Ga0495675_0641016 | Ga0495675_0641016_49_480 | 140 |
| 402 | 3300047471 | Ga0495684_0002248 | Ga0495684_0002248_5866_6306 | 140 |
| 403 | 3300047471 | Ga0495684_0013779 | Ga0495684_0013779_982_1464 | 140 |
| 404 | 3300047673 | Ga0495593_0000853 | Ga0495593_0000853_4566_5006 | 140 |
| 405 | 3300048088 | Ga0495602_0001444 | Ga0495602_0001444_10206_10688 | 140 |
| 406 | 3300048088 | Ga0495602_0166285 | Ga0495602_0166285_740_1180 | 140 |
| 407 | 3300048088 | Ga0495602_0390602 | Ga0495602_0390602_38_469 | 140 |
| 408 | 3300048089 | Ga0495614_0017054 | Ga0495614_0017054_1955_2395 | 140 |
| 409 | 3300048903 | Ga0496100_0024230 | Ga0496100_0024230_1935_2366 | 140 |
| 410 | 3300048904 | Ga0496101_0278221 | Ga0496101_0278221_66_497 | 140 |
| 411 | 3300048905 | Ga0496102_0601258 | Ga0496102_0601258_529_960 | 140 |
| 412 | 3300048905 | Ga0496102_0968639 | Ga0496102_0968639_270_701 | 140 |
| 413 | 3300048906 | Ga0496103_0151906 | Ga0496103_0151906_82_513 | 140 |
| 414 | 3300048908 | Ga0496105_0069021 | Ga0496105_0069021_1018_1449 | 140 |
| 415 | 3300048909 | Ga0496106_0783549 | Ga0496106_0783549_312_743 | 140 |
| 416 | 3300048910 | Ga0496107_0062422 | Ga0496107_0062422_917_1348 | 140 |
| 417 | 3300048911 | Ga0496108_0168421 | Ga0496108_0168421_935_1366 | 140 |
| 418 | 3300048912 | Ga0496109_0966333 | Ga0496109_0966333_228_659 | 140 |
| 419 | 3300048913 | Ga0496110_0066763 | Ga0496110_0066763_917_1348 | 140 |
| 420 | 3300048914 | Ga0496111_0094497 | Ga0496111_0094497_960_1391 | 140 |
| 421 | 3300048915 | Ga0496112_0069726 | Ga0496112_0069726_1236_1667 | 140 |
| 422 | 3300048916 | Ga0496113_0019253 | Ga0496113_0019253_3242_3673 | 140 |
| 423 | 3300048916 | Ga0496113_0099644 | Ga0496113_0099644_653_1084 | 140 |
| 424 | 3300048916 | Ga0496113_0977337 | Ga0496113_0977337_213_644 | 140 |
| 425 | 3300048917 | Ga0496114_0171962 | Ga0496114_0171962_1202_1633 | 140 |
| 426 | 3300048918 | Ga0496115_0131433 | Ga0496115_0131433_529_960 | 140 |
| 427 | 3300050513 | nmdc:mga0rr50_447327_c1 | nmdc:mga0rr50_447327_c1_14_445 | 140 |
| 428 | 3300053077 | Ga0495601_0003542 | Ga0495601_0003542_4594_5034 | 140 |
| 429 | 3300053077 | Ga0495601_0473573 | Ga0495601_0473573_251_682 | 140 |
| 430 | 3300053078 | Ga0495612_0000732 | Ga0495612_0000732_5656_6087 | 140 |
| 431 | 3300053084 | Ga0495595_0003218 | Ga0495595_0003218_1504_1944 | 140 |
| 432 | 3300053084 | Ga0495595_0459159 | Ga0495595_0459159_74_556 | 140 |
| 433 | 3300053085 | Ga0495619_0006860 | Ga0495619_0006860_4547_4987 | 140 |
| 434 | iso_pu_bacteria | 8002060224 | 8002062210 | 140 |
| 435 | 2088090003 | LJN_F7QKVOU01DJH1A | LJN_01588140 | 141 |
| 436 | 3300017792 | Ga0163161_10426300 | Ga0163161_104263001 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jek-assembly1.cif.gz_A | crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a | 0.971 | 3 | 140 |
| 2jek-assembly1.cif.gz_A | crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a | 0.9439 | 3 | 140 |
| 4qjy-assembly1.cif.gz_B | crystal structure of native ara127n, a gh127 beta-l-arabinofuranosidase from geobacillus stearothermophilus t6 | 0.4845 | 3 | 130 |
| 1oxj-assembly1.cif.gz_A | crystal structure of the smaug rna binding domain | 0.4805 | 14 | 123 |
| 4qjy-assembly1.cif.gz_B | crystal structure of native ara127n, a gh127 beta-l-arabinofuranosidase from geobacillus stearothermophilus t6 | 0.4462 | 3 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jekA00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 | 0.971 | 3 | 140 | 1.25.40.380 |
| 2jekA00 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 | 0.9439 | 3 | 140 | 1.25.40.380 |
| af_Q54B61_245_442_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5593 | 1 | 125 | 1.25.10.10 |
| af_Q9W1C5_327_407_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5098 | 60 | 127 | 1.25.10.10 |
| af_Q54B61_245_442_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.5062 | 1 | 125 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519V3I3-F1-model_v4 | DUF1810 domain-containing protein | 0.9945 | 7 | 140 |
|
| AF-A0A7Y0BSW8-F1-model_v4 | DUF1810 domain-containing protein | 0.9934 | 4 | 141 |
|
| AF-A0A367AF78-F1-model_v4 | DUF1810 domain-containing protein | 0.9933 | 7 | 138 |
|
| AF-A0A4U1L5E1-F1-model_v4 | DUF1810 domain-containing protein | 0.993 | 7 | 141 |
|
| AF-A0A0K1PJM3-F1-model_v4 | NTP pyrophosphohydrolase | 0.9929 | 3 | 138 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar