F443481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 436 | 252 | 436 | 351 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100000004|Ga0070674_100000004115 |
| Length | 373 |
| Sequence | MVPFGTLILGMLRLNRASWCADELCETRSFPMQATKAHSNGKVKPESARQLDAKTKQAPGARLAAAFEAVEKFPVLMESRERVMDVGLAIAVLRFANRNVGSGGSIATIPEAVNLLKPSGLLAIAGTAPVFDFFEPNGGREMRPERIRVHALATQQAADEIGRAVGWEARDELAIATLLHDVGRLVISNLHPGDRSFFEAVAKTPEQRLKEERDRLGIDHALVGGVLARRWNMPQRIAVAIERHHAADAEDLAAMVGTADMVAHYAQGEAISAERLRAMALRCGLDGNGLREILYQLPYARSDGARISEPCPLSSRELDVLRHLSEGMVYKQIAGEMQLSVSTIRTHLHNVYGKIGAVDRAQAVLTARDRGWI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 135 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 138 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 203 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 204 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 205 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 206 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 207 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 210 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 248 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 249 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 250 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 251 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 11.01 |
| Rhizosphere | 84.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000221 | 3300001977 | Bacteria | 7803 |
| 2 | JGI24740J21852_10005107 | 3300001979 | Bacteria | 5572 |
| 3 | JGI24748J21848_1000672 | 3300002074 | Bacteria | 3678 |
| 4 | JGI24034J26672_10000173 | 3300002239 | Bacteria | 8909 |
| 5 | JGI25404J52841_10010398 | 3300003659 | Bacteria | 2001 |
| 6 | Ga0070683_100005906 | 3300005329 | Bacteria | 10246 |
| 7 | Ga0070683_100027390 | 3300005329 | Bacteria | 5140 |
| 8 | Ga0070677_10000868 | 3300005333 | Bacteria | 9957 |
| 9 | Ga0070666_10084268 | 3300005335 | Bacteria | 2175 |
| 10 | Ga0070682_100000030 | 3300005337 | Bacteria | 182768 |
| 11 | Ga0070682_100000171 | 3300005337 | Bacteria | 48470 |
| 12 | Ga0070682_100067812 | 3300005337 | Bacteria | 2273 |
| 13 | Ga0068868_100000225 | 3300005338 | Bacteria | 38457 |
| 14 | Ga0068868_100000520 | 3300005338 | Bacteria | 25795 |
| 15 | Ga0070689_100058585 | 3300005340 | Bacteria | 2991 |
| 16 | Ga0070691_10000018 | 3300005341 | Bacteria | 47284 |
| 17 | Ga0070691_10018518 | 3300005341 | Unclassified | 3211 |
| 18 | Ga0070661_100000035 | 3300005344 | Bacteria | 111363 |
| 19 | Ga0070675_100000370 | 3300005354 | Bacteria | 30370 |
| 20 | Ga0070674_100000004 | 3300005356 | Bacteria | 169446 |
| 21 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 22 | Ga0070673_100005029 | 3300005364 | Bacteria | 8437 |
| 23 | Ga0070688_100001268 | 3300005365 | Bacteria | 12586 |
| 24 | Ga0070688_100008127 | 3300005365 | Bacteria | 5685 |
| 25 | Ga0070659_100005337 | 3300005366 | Bacteria | 9220 |
| 26 | Ga0070659_100030791 | 3300005366 | Bacteria | 4153 |
| 27 | Ga0070714_100032012 | 3300005435 | Bacteria | 4391 |
| 28 | Ga0070713_100000010 | 3300005436 | Bacteria | 151790 |
| 29 | Ga0070713_100025217 | 3300005436 | Bacteria | 4645 |
| 30 | Ga0070711_100001178 | 3300005439 | Bacteria | 14082 |
| 31 | Ga0070663_100000956 | 3300005455 | Bacteria | 15676 |
| 32 | Ga0070678_100000345 | 3300005456 | Bacteria | 21680 |
| 33 | Ga0070662_100000006 | 3300005457 | Bacteria | 169366 |
| 34 | Ga0068867_100000295 | 3300005459 | Bacteria | 32708 |
| 35 | Ga0070685_10001413 | 3300005466 | Bacteria | 12586 |
| 36 | Ga0070685_10001687 | 3300005466 | Bacteria | 11606 |
| 37 | Ga0070679_100000225 | 3300005530 | Bacteria | 46317 |
| 38 | Ga0070679_100001408 | 3300005530 | Bacteria | 21242 |
| 39 | Ga0070684_100003342 | 3300005535 | Bacteria | 12013 |
| 40 | Ga0070684_100047427 | 3300005535 | Bacteria | 3723 |
| 41 | Ga0070684_100054366 | 3300005535 | Bacteria | 3489 |
| 42 | Ga0070684_100145570 | 3300005535 | Bacteria | 2144 |
| 43 | Ga0068853_100024630 | 3300005539 | Bacteria | 5048 |
| 44 | Ga0068853_100265224 | 3300005539 | Bacteria | 1580 |
| 45 | Ga0070672_100000006 | 3300005543 | Bacteria | 117060 |
| 46 | Ga0070695_100210940 | 3300005545 | Bacteria | 1394 |
| 47 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 48 | Ga0070665_100008395 | 3300005548 | Bacteria | 10448 |
| 49 | Ga0070665_100046548 | 3300005548 | Bacteria | 4357 |
| 50 | Ga0068854_100000237 | 3300005578 | Bacteria | 37524 |
| 51 | Ga0068856_100008825 | 3300005614 | Bacteria | 9808 |
| 52 | Ga0068856_100029013 | 3300005614 | Bacteria | 5406 |
| 53 | Ga0068856_100205891 | 3300005614 | Bacteria | 1982 |
| 54 | Ga0068852_100000170 | 3300005616 | Bacteria | 43748 |
| 55 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 56 | Ga0068866_10000004 | 3300005718 | Bacteria | 202810 |
| 57 | Ga0068866_10001671 | 3300005718 | Bacteria | 9349 |
| 58 | Ga0068866_10004889 | 3300005718 | Bacteria | 5505 |
| 59 | Ga0068851_10001578 | 3300005834 | Bacteria | 10004 |
| 60 | Ga0068851_10009301 | 3300005834 | Bacteria | 4563 |
| 61 | Ga0068863_100000107 | 3300005841 | Bacteria | 88879 |
| 62 | Ga0068863_100124472 | 3300005841 | Bacteria | 2460 |
| 63 | Ga0068858_100000075 | 3300005842 | Bacteria | 104349 |
| 64 | Ga0068858_100000319 | 3300005842 | Bacteria | 51080 |
| 65 | Ga0068858_100194838 | 3300005842 | Bacteria | 1915 |
| 66 | Ga0068860_100014544 | 3300005843 | Bacteria | 7701 |
| 67 | Ga0068860_100276950 | 3300005843 | Bacteria | 1639 |
| 68 | Ga0068862_100033642 | 3300005844 | Bacteria | 4335 |
| 69 | Ga0081455_10007388 | 3300005937 | Bacteria | 11579 |
| 70 | Ga0081455_10140326 | 3300005937 | Bacteria | 1878 |
| 71 | Ga0081540_1000063 | 3300005983 | Bacteria | 119510 |
| 72 | Ga0081539_10002638 | 3300005985 | Bacteria | 24507 |
| 73 | Ga0081539_10023698 | 3300005985 | Bacteria | 4011 |
| 74 | Ga0070715_10000014 | 3300006163 | Bacteria | 154272 |
| 75 | Ga0070716_100077104 | 3300006173 | Bacteria | 1977 |
| 76 | Ga0070712_100000353 | 3300006175 | Bacteria | 26043 |
| 77 | Ga0075430_100011782 | 3300006846 | Bacteria | 7443 |
| 78 | Ga0075431_100077064 | 3300006847 | Bacteria | 3441 |
| 79 | Ga0075433_10001022 | 3300006852 | Bacteria | 19936 |
| 80 | Ga0075433_10001612 | 3300006852 | Bacteria | 16741 |
| 81 | Ga0068865_100000140 | 3300006881 | Bacteria | 38055 |
| 82 | Ga0075435_100058432 | 3300007076 | Bacteria | 3124 |
| 83 | Ga0105245_10000116 | 3300009098 | Bacteria | 77303 |
| 84 | Ga0105245_10000212 | 3300009098 | Bacteria | 55133 |
| 85 | Ga0105245_10001002 | 3300009098 | Bacteria | 25634 |
| 86 | Ga0105245_10007310 | 3300009098 | Bacteria | 9669 |
| 87 | Ga0105247_10000955 | 3300009101 | Bacteria | 21799 |
| 88 | Ga0105242_10000375 | 3300009176 | Bacteria | 35458 |
| 89 | Ga0105242_10002124 | 3300009176 | Bacteria | 15632 |
| 90 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 91 | Ga0105238_10000048 | 3300009551 | Bacteria | 146322 |
| 92 | Ga0105249_10000070 | 3300009553 | Bacteria | 147277 |
| 93 | Ga0105249_10004349 | 3300009553 | Bacteria | 12251 |
| 94 | Ga0105249_10046590 | 3300009553 | Bacteria | 3946 |
| 95 | Ga0105239_10115492 | 3300010375 | Bacteria | 2978 |
| 96 | Ga0157371_10005511 | 3300013102 | Bacteria | 10656 |
| 97 | Ga0157370_10040175 | 3300013104 | Bacteria | 4517 |
| 98 | Ga0157370_10107046 | 3300013104 | Bacteria | 2616 |
| 99 | Ga0157369_10000078 | 3300013105 | Bacteria | 135173 |
| 100 | Ga0157374_10000686 | 3300013296 | Bacteria | 29832 |
| 101 | Ga0157378_10007104 | 3300013297 | Bacteria | 9776 |
| 102 | Ga0157378_10086456 | 3300013297 | Bacteria | 2843 |
| 103 | Ga0157378_10151852 | 3300013297 | Bacteria | 2159 |
| 104 | Ga0163162_10089692 | 3300013306 | Bacteria | 3156 |
| 105 | Ga0157372_10004870 | 3300013307 | Bacteria | 14268 |
| 106 | Ga0157375_10000130 | 3300013308 | Bacteria | 74968 |
| 107 | Ga0157375_10003947 | 3300013308 | Bacteria | 12860 |
| 108 | Ga0157375_10214789 | 3300013308 | Bacteria | 2081 |
| 109 | Ga0163163_10390863 | 3300014325 | Bacteria | 1449 |
| 110 | Ga0157380_10000149 | 3300014326 | Bacteria | 39858 |
| 111 | Ga0157380_10000261 | 3300014326 | Bacteria | 31504 |
| 112 | Ga0157380_10086326 | 3300014326 | Bacteria | 2578 |
| 113 | Ga0157379_10007056 | 3300014968 | Bacteria | 9711 |
| 114 | Ga0157379_10036079 | 3300014968 | Bacteria | 4409 |
| 115 | Ga0157376_10011312 | 3300014969 | Bacteria | 6572 |
| 116 | Ga0163161_10301140 | 3300017792 | Unclassified | 1263 |
| 117 | Ga0206356_11658876 | 3300020070 | Bacteria | 4945 |
| 118 | Ga0207656_10002200 | 3300025321 | Bacteria | 6527 |
| 119 | Ga0207656_10005231 | 3300025321 | Bacteria | 4569 |
| 120 | Ga0207682_10000180 | 3300025893 | Bacteria | 28686 |
| 121 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 122 | Ga0207642_10000872 | 3300025899 | Bacteria | 9428 |
| 123 | Ga0207710_10000543 | 3300025900 | Bacteria | 22684 |
| 124 | Ga0207680_10003250 | 3300025903 | Bacteria | 7653 |
| 125 | Ga0207685_10000025 | 3300025905 | Bacteria | 110358 |
| 126 | Ga0207693_10006121 | 3300025915 | Bacteria | 9974 |
| 127 | Ga0207663_10001389 | 3300025916 | Bacteria | 11242 |
| 128 | Ga0207660_10039147 | 3300025917 | Bacteria | 3313 |
| 129 | Ga0207649_10000028 | 3300025920 | Bacteria | 161482 |
| 130 | Ga0207652_10000309 | 3300025921 | Bacteria | 50266 |
| 131 | Ga0207652_10004337 | 3300025921 | Bacteria | 11559 |
| 132 | Ga0207694_10000056 | 3300025924 | Bacteria | 146908 |
| 133 | Ga0207650_10078773 | 3300025925 | Bacteria | 2494 |
| 134 | Ga0207659_10000022 | 3300025926 | Bacteria | 143432 |
| 135 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 136 | Ga0207687_10000031 | 3300025927 | Bacteria | 150246 |
| 137 | Ga0207687_10000079 | 3300025927 | Bacteria | 70683 |
| 138 | Ga0207687_10004101 | 3300025927 | Bacteria | 9763 |
| 139 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 140 | Ga0207700_10062273 | 3300025928 | Bacteria | 2833 |
| 141 | Ga0207664_10021131 | 3300025929 | Bacteria | 4835 |
| 142 | Ga0207690_10003023 | 3300025932 | Bacteria | 10121 |
| 143 | Ga0207690_10019048 | 3300025932 | Bacteria | 4217 |
| 144 | Ga0207706_10000017 | 3300025933 | Bacteria | 169589 |
| 145 | Ga0207686_10000061 | 3300025934 | Bacteria | 97978 |
| 146 | Ga0207686_10000356 | 3300025934 | Bacteria | 32614 |
| 147 | Ga0207686_10006267 | 3300025934 | Bacteria | 6398 |
| 148 | Ga0207709_10020598 | 3300025935 | Bacteria | 3723 |
| 149 | Ga0207670_10063341 | 3300025936 | Bacteria | 2530 |
| 150 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 151 | Ga0207669_10000195 | 3300025937 | Bacteria | 27661 |
| 152 | Ga0207704_10000360 | 3300025938 | Bacteria | 21224 |
| 153 | Ga0207665_10101451 | 3300025939 | Bacteria | 2009 |
| 154 | Ga0207691_10000025 | 3300025940 | Bacteria | 129424 |
| 155 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 156 | Ga0207661_10002602 | 3300025944 | Bacteria | 12416 |
| 157 | Ga0207661_10013737 | 3300025944 | Bacteria | 5914 |
| 158 | Ga0207661_10099821 | 3300025944 | Unclassified | 2435 |
| 159 | Ga0207661_10148530 | 3300025944 | Bacteria | 2024 |
| 160 | Ga0207661_10157146 | 3300025944 | Bacteria | 1970 |
| 161 | Ga0207679_10082582 | 3300025945 | Bacteria | 2461 |
| 162 | Ga0207651_10002519 | 3300025960 | Bacteria | 8744 |
| 163 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 164 | Ga0207712_10026642 | 3300025961 | Bacteria | 3854 |
| 165 | Ga0207712_10044699 | 3300025961 | Bacteria | 3062 |
| 166 | Ga0207668_10006016 | 3300025972 | Bacteria | 7154 |
| 167 | Ga0207668_10039542 | 3300025972 | Bacteria | 3176 |
| 168 | Ga0207640_10000248 | 3300025981 | Bacteria | 36585 |
| 169 | Ga0207640_10017114 | 3300025981 | Bacteria | 4234 |
| 170 | Ga0207658_10003673 | 3300025986 | Bacteria | 10820 |
| 171 | Ga0207658_10082904 | 3300025986 | Bacteria | 2463 |
| 172 | Ga0207658_10091414 | 3300025986 | Bacteria | 2361 |
| 173 | Ga0207677_10000508 | 3300026023 | Bacteria | 25092 |
| 174 | Ga0207677_10000588 | 3300026023 | Bacteria | 22552 |
| 175 | Ga0207703_10000088 | 3300026035 | Bacteria | 106080 |
| 176 | Ga0207703_10000166 | 3300026035 | Bacteria | 76553 |
| 177 | Ga0207703_10079201 | 3300026035 | Bacteria | 2733 |
| 178 | Ga0207639_10053131 | 3300026041 | Bacteria | 3090 |
| 179 | Ga0207639_10128239 | 3300026041 | Bacteria | 2096 |
| 180 | Ga0207678_10005666 | 3300026067 | Bacteria | 11162 |
| 181 | Ga0207678_10173766 | 3300026067 | Bacteria | 1839 |
| 182 | Ga0207678_10288095 | 3300026067 | Bacteria | 1410 |
| 183 | Ga0207702_10000242 | 3300026078 | Bacteria | 63808 |
| 184 | Ga0207702_10009047 | 3300026078 | Bacteria | 8385 |
| 185 | Ga0207702_10020977 | 3300026078 | Bacteria | 5406 |
| 186 | Ga0207641_10000077 | 3300026088 | Bacteria | 144978 |
| 187 | Ga0207648_10002595 | 3300026089 | Bacteria | 19350 |
| 188 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 189 | Ga0207674_10336353 | 3300026116 | Bacteria | 1460 |
| 190 | Ga0207683_10001994 | 3300026121 | Bacteria | 18063 |
| 191 | Ga0207698_10000042 | 3300026142 | Bacteria | 97349 |
| 192 | Ga0207698_10059961 | 3300026142 | Bacteria | 2957 |
| 193 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 194 | Ga0268266_10001339 | 3300028379 | Bacteria | 29819 |
| 195 | Ga0268266_10014906 | 3300028379 | Bacteria | 6675 |
| 196 | Ga0268266_10016916 | 3300028379 | Bacteria | 6231 |
| 197 | Ga0268264_10008972 | 3300028381 | Bacteria | 8298 |
| 198 | Ga0268264_10129064 | 3300028381 | Bacteria | 2238 |
| 199 | Ga0265337_1003867 | 3300028556 | Bacteria | 6357 |
| 200 | Ga0265326_10000229 | 3300028558 | Bacteria | 26997 |
| 201 | Ga0265319_1000110 | 3300028563 | Bacteria | 63277 |
| 202 | Ga0265322_10000020 | 3300028654 | Bacteria | 108805 |
| 203 | Ga0265338_10000578 | 3300028800 | Bacteria | 64450 |
| 204 | Ga0265324_10000360 | 3300029957 | Bacteria | 33003 |
| 205 | Ga0265324_10059787 | 3300029957 | Bacteria | 1303 |
| 206 | Ga0265328_10062997 | 3300031239 | Bacteria | 1362 |
| 207 | Ga0265320_10000035 | 3300031240 | Bacteria | 137855 |
| 208 | Ga0265331_10003031 | 3300031250 | Bacteria | 11023 |
| 209 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 210 | Ga0265314_10002307 | 3300031711 | Bacteria | 19713 |
| 211 | Ga0307415_100000494 | 3300032126 | Bacteria | 17107 |
| 212 | Ga0451853_0309797 | 3300041512 | Bacteria | 1846 |
| 213 | Ga0466963_0000289 | 3300044694 | Bacteria | 22666 |
| 214 | Ga0466957_0020175 | 3300044842 | Bacteria | 3921 |
| 215 | Ga0466967_0000017 | 3300045976 | Bacteria | 89904 |
| 216 | Ga0495592_0000318 | 3300046454 | Bacteria | 40338 |
| 217 | Ga0495592_0086563 | 3300046454 | Bacteria | 2256 |
| 218 | Ga0495603_0000020 | 3300046455 | Bacteria | 64469 |
| 219 | Ga0495603_0000711 | 3300046455 | Bacteria | 18835 |
| 220 | Ga0495603_0020677 | 3300046455 | Bacteria | 3986 |
| 221 | Ga0495629_0003726 | 3300046459 | Bacteria | 11487 |
| 222 | Ga0495629_0015448 | 3300046459 | Bacteria | 5482 |
| 223 | Ga0495629_0021138 | 3300046459 | Plasmid | 4644 |
| 224 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 225 | Ga0495641_0017264 | 3300046461 | Bacteria | 3765 |
| 226 | Ga0495641_0025027 | 3300046461 | Bacteria | 2934 |
| 227 | Ga0495651_0063378 | 3300046462 | Bacteria | 2826 |
| 228 | Ga0495651_0146562 | 3300046462 | Bacteria | 1706 |
| 229 | Ga0495653_0049927 | 3300046463 | Bacteria | 3220 |
| 230 | Ga0495653_0228740 | 3300046463 | Bacteria | 1246 |
| 231 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 232 | Ga0495662_0001700 | 3300046476 | Bacteria | 10995 |
| 233 | Ga0495662_0004716 | 3300046476 | Bacteria | 6828 |
| 234 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 235 | Ga0495606_0000108 | 3300046507 | Bacteria | 140473 |
| 236 | Ga0495608_0000036 | 3300046511 | Bacteria | 129609 |
| 237 | Ga0495608_0000183 | 3300046511 | Bacteria | 44585 |
| 238 | Ga0495608_0003132 | 3300046511 | Bacteria | 11815 |
| 239 | Ga0495608_0069207 | 3300046511 | Bacteria | 2306 |
| 240 | Ga0495618_0000144 | 3300046514 | Bacteria | 50904 |
| 241 | Ga0495620_0000797 | 3300046515 | Bacteria | 19341 |
| 242 | Ga0495628_0001454 | 3300046516 | Bacteria | 21724 |
| 243 | Ga0495628_0001544 | 3300046516 | Bacteria | 21069 |
| 244 | Ga0495628_0017394 | 3300046516 | Bacteria | 5988 |
| 245 | Ga0495628_0021870 | 3300046516 | Bacteria | 5257 |
| 246 | Ga0495628_0046561 | 3300046516 | Bacteria | 3444 |
| 247 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 248 | Ga0495630_0000175 | 3300046517 | Bacteria | 49924 |
| 249 | Ga0495630_0000555 | 3300046517 | Bacteria | 27256 |
| 250 | Ga0495630_0095391 | 3300046517 | Unclassified | 2249 |
| 251 | Ga0495632_0043599 | 3300046519 | Bacteria | 2241 |
| 252 | Ga0495644_0000625 | 3300046523 | Bacteria | 14803 |
| 253 | Ga0495652_0000023 | 3300046529 | Bacteria | 168049 |
| 254 | Ga0495640_0043718 | 3300046533 | Bacteria | 3118 |
| 255 | Ga0495640_0045501 | 3300046533 | Bacteria | 3045 |
| 256 | Ga0495586_0048284 | 3300046535 | Bacteria | 2299 |
| 257 | Ga0495598_0022753 | 3300046537 | Bacteria | 1680 |
| 258 | Ga0495645_0025391 | 3300046543 | Bacteria | 4299 |
| 259 | Ga0495645_0036952 | 3300046543 | Bacteria | 3559 |
| 260 | Ga0495622_0000021 | 3300046557 | Bacteria | 162267 |
| 261 | Ga0495667_0000034 | 3300046559 | Bacteria | 141464 |
| 262 | Ga0495656_0001116 | 3300046615 | Bacteria | 8735 |
| 263 | Ga0495634_0000028 | 3300046642 | Bacteria | 114075 |
| 264 | Ga0495634_0002025 | 3300046642 | Bacteria | 17228 |
| 265 | Ga0495634_0098765 | 3300046642 | Bacteria | 1888 |
| 266 | Ga0495625_0000453 | 3300046660 | Bacteria | 61379 |
| 267 | Ga0495635_0000005 | 3300046663 | Bacteria | 302178 |
| 268 | Ga0495635_0098640 | 3300046663 | Bacteria | 1997 |
| 269 | Ga0495635_0144191 | 3300046663 | Bacteria | 1622 |
| 270 | Ga0495588_0000149 | 3300046674 | Bacteria | 100598 |
| 271 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 272 | Ga0495657_0002724 | 3300046675 | Bacteria | 14752 |
| 273 | Ga0495599_0007290 | 3300046678 | Bacteria | 6698 |
| 274 | Ga0495647_0000009 | 3300046681 | Bacteria | 94874 |
| 275 | Ga0495647_0000047 | 3300046681 | Bacteria | 35186 |
| 276 | Ga0495658_0000306 | 3300046683 | Bacteria | 27840 |
| 277 | Ga0495658_0001601 | 3300046683 | Bacteria | 11790 |
| 278 | Ga0495669_0000635 | 3300046684 | Bacteria | 15272 |
| 279 | Ga0495613_0000321 | 3300046689 | Bacteria | 43464 |
| 280 | Ga0495613_0000481 | 3300046689 | Bacteria | 34000 |
| 281 | Ga0495613_0036319 | 3300046689 | Bacteria | 3654 |
| 282 | Ga0495613_0066878 | 3300046689 | Unclassified | 2623 |
| 283 | Ga0495624_0000038 | 3300046690 | Bacteria | 83368 |
| 284 | Ga0495624_0000414 | 3300046690 | Bacteria | 33832 |
| 285 | Ga0495624_0005038 | 3300046690 | Bacteria | 9563 |
| 286 | Ga0495670_0012288 | 3300046691 | Bacteria | 4208 |
| 287 | Ga0495649_0001181 | 3300046694 | Bacteria | 20231 |
| 288 | Ga0495600_0037837 | 3300046809 | Bacteria | 3138 |
| 289 | Ga0495600_0214128 | 3300046809 | Bacteria | 1234 |
| 290 | Ga0495604_0000122 | 3300047317 | Bacteria | 65938 |
| 291 | Ga0495604_0000317 | 3300047317 | Bacteria | 43411 |
| 292 | Ga0495604_0017335 | 3300047317 | Bacteria | 5764 |
| 293 | Ga0495604_0055428 | 3300047317 | Bacteria | 3055 |
| 294 | Ga0495674_0000019 | 3300047319 | Bacteria | 185107 |
| 295 | Ga0495676_0002025 | 3300047321 | Bacteria | 17856 |
| 296 | Ga0495676_0002391 | 3300047321 | Bacteria | 16661 |
| 297 | Ga0495676_0087108 | 3300047321 | Bacteria | 2348 |
| 298 | Ga0495680_0000193 | 3300047322 | Bacteria | 65567 |
| 299 | Ga0495680_0005747 | 3300047322 | Bacteria | 11610 |
| 300 | Ga0495680_0039353 | 3300047322 | Bacteria | 3773 |
| 301 | Ga0495680_0058143 | 3300047322 | Bacteria | 2989 |
| 302 | Ga0495680_0152101 | 3300047322 | Bacteria | 1686 |
| 303 | Ga0495675_0000037 | 3300047444 | Bacteria | 91283 |
| 304 | Ga0495679_012527 | 3300047446 | Bacteria | 3222 |
| 305 | Ga0495686_0074785 | 3300047472 | Bacteria | 2078 |
| 306 | Ga0495686_0108144 | 3300047472 | Bacteria | 1671 |
| 307 | Ga0495593_0012869 | 3300047673 | Bacteria | 4780 |
| 308 | Ga0495602_0000166 | 3300048088 | Bacteria | 61220 |
| 309 | Ga0495602_0005378 | 3300048088 | Bacteria | 13433 |
| 310 | Ga0495602_0038462 | 3300048088 | Bacteria | 4423 |
| 311 | Ga0495602_0095387 | 3300048088 | Bacteria | 2456 |
| 312 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 313 | Ga0496100_0000014 | 3300048903 | Bacteria | 174991 |
| 314 | Ga0496101_0000022 | 3300048904 | Bacteria | 216728 |
| 315 | Ga0496101_0000036 | 3300048904 | Bacteria | 175595 |
| 316 | Ga0496102_0000081 | 3300048905 | Bacteria | 139266 |
| 317 | Ga0496103_0000031 | 3300048906 | Bacteria | 204016 |
| 318 | Ga0496103_0036386 | 3300048906 | Bacteria | 3015 |
| 319 | Ga0496103_0081446 | 3300048906 | Bacteria | 2036 |
| 320 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 321 | Ga0496104_0000077 | 3300048907 | Bacteria | 100848 |
| 322 | Ga0496104_0005387 | 3300048907 | Bacteria | 11200 |
| 323 | Ga0496104_0044152 | 3300048907 | Bacteria | 4188 |
| 324 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 325 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 326 | Ga0496105_0000098 | 3300048908 | Bacteria | 59301 |
| 327 | Ga0496105_0001296 | 3300048908 | Bacteria | 17493 |
| 328 | Ga0496106_0000043 | 3300048909 | Bacteria | 105477 |
| 329 | Ga0496106_0000087 | 3300048909 | Bacteria | 73787 |
| 330 | Ga0496106_0000213 | 3300048909 | Bacteria | 40340 |
| 331 | Ga0496107_0000022 | 3300048910 | Bacteria | 128991 |
| 332 | Ga0496107_0000046 | 3300048910 | Bacteria | 67209 |
| 333 | Ga0496107_0079494 | 3300048910 | Bacteria | 2390 |
| 334 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 335 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 336 | Ga0496108_0000365 | 3300048911 | Bacteria | 38077 |
| 337 | Ga0496108_0011523 | 3300048911 | Bacteria | 7187 |
| 338 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 339 | Ga0496109_0000095 | 3300048912 | Bacteria | 91702 |
| 340 | Ga0496109_0000174 | 3300048912 | Bacteria | 63794 |
| 341 | Ga0496109_0000628 | 3300048912 | Bacteria | 29413 |
| 342 | Ga0496110_0000011 | 3300048913 | Bacteria | 97293 |
| 343 | Ga0496110_0057974 | 3300048913 | Bacteria | 3411 |
| 344 | Ga0496110_0082715 | 3300048913 | Bacteria | 2863 |
| 345 | Ga0496110_0172628 | 3300048913 | Bacteria | 1962 |
| 346 | Ga0496110_0178352 | 3300048913 | Bacteria | 1929 |
| 347 | Ga0496111_0000170 | 3300048914 | Bacteria | 29627 |
| 348 | Ga0496111_0012939 | 3300048914 | Bacteria | 5662 |
| 349 | Ga0496111_0429560 | 3300048914 | Bacteria | 976 |
| 350 | Ga0496112_0000085 | 3300048915 | Bacteria | 61255 |
| 351 | Ga0496112_0020305 | 3300048915 | Bacteria | 6294 |
| 352 | Ga0496113_0000202 | 3300048916 | Bacteria | 27530 |
| 353 | Ga0496113_0030971 | 3300048916 | Bacteria | 3877 |
| 354 | Ga0496114_0000054 | 3300048917 | Bacteria | 98328 |
| 355 | Ga0496114_0004552 | 3300048917 | Bacteria | 10766 |
| 356 | Ga0496114_0088287 | 3300048917 | Bacteria | 2630 |
| 357 | Ga0496115_0000010 | 3300048918 | Bacteria | 227112 |
| 358 | Ga0496115_0000334 | 3300048918 | Bacteria | 40085 |
| 359 | Ga0496115_0017924 | 3300048918 | Bacteria | 5424 |
| 360 | Ga0496116_0000519 | 3300048919 | Bacteria | 51925 |
| 361 | Ga0496117_0047585 | 3300048920 | Bacteria | 3073 |
| 362 | Ga0496118_0001908 | 3300048921 | Bacteria | 29656 |
| 363 | Ga0496118_0075638 | 3300048921 | Bacteria | 2400 |
| 364 | Ga0496118_0078581 | 3300048921 | Bacteria | 2334 |
| 365 | Ga0496119_0002641 | 3300048922 | Bacteria | 19419 |
| 366 | Ga0496119_0015645 | 3300048922 | Bacteria | 5822 |
| 367 | Ga0496119_0026593 | 3300048922 | Bacteria | 4007 |
| 368 | Ga0496120_0003219 | 3300048923 | Bacteria | 15156 |
| 369 | Ga0496121_0081636 | 3300048924 | Bacteria | 2558 |
| 370 | Ga0496121_0127773 | 3300048924 | Bacteria | 1908 |
| 371 | Ga0496124_0026294 | 3300048927 | Bacteria | 5250 |
| 372 | Ga0496126_0014886 | 3300048929 | Bacteria | 7845 |
| 373 | Ga0496126_0070035 | 3300048929 | Bacteria | 3126 |
| 374 | Ga0496126_0103470 | 3300048929 | Bacteria | 2488 |
| 375 | Ga0501031_0002856 | 3300049568 | Bacteria | 11032 |
| 376 | Ga0501032_0000297 | 3300049569 | Bacteria | 41782 |
| 377 | Ga0501033_0001109 | 3300049570 | Bacteria | 24436 |
| 378 | Ga0501034_0038342 | 3300049571 | Bacteria | 4852 |
| 379 | Ga0501034_0078775 | 3300049571 | Bacteria | 3299 |
| 380 | Ga0501036_0024005 | 3300049572 | Bacteria | 5139 |
| 381 | Ga0501037_0000452 | 3300049573 | Bacteria | 33455 |
| 382 | Ga0501038_0001076 | 3300049574 | Bacteria | 24669 |
| 383 | Ga0501039_0018657 | 3300049575 | Bacteria | 5326 |
| 384 | Ga0501040_0085880 | 3300049576 | Bacteria | 2184 |
| 385 | Ga0501042_0010425 | 3300049578 | Bacteria | 6233 |
| 386 | Ga0501042_0014050 | 3300049578 | Bacteria | 5460 |
| 387 | Ga0501042_0073647 | 3300049578 | Bacteria | 2443 |
| 388 | Ga0501043_0001014 | 3300049579 | Bacteria | 24659 |
| 389 | Ga0501046_0001243 | 3300049580 | Bacteria | 24668 |
| 390 | Ga0501047_0000513 | 3300049581 | Bacteria | 41790 |
| 391 | Ga0501047_0009245 | 3300049581 | Bacteria | 9306 |
| 392 | Ga0501048_0019240 | 3300049582 | Bacteria | 5013 |
| 393 | Ga0501067_0052350 | 3300049583 | Bacteria | 2262 |
| 394 | Ga0501068_0018844 | 3300049584 | Bacteria | 3999 |
| 395 | Ga0501068_0071366 | 3300049584 | Bacteria | 2120 |
| 396 | Ga0501069_0120141 | 3300049585 | Bacteria | 1500 |
| 397 | Ga0501070_0000351 | 3300049586 | Bacteria | 41785 |
| 398 | Ga0501070_0161104 | 3300049586 | Bacteria | 1849 |
| 399 | Ga0501071_0042658 | 3300049587 | Bacteria | 3251 |
| 400 | Ga0501072_0029142 | 3300049588 | Bacteria | 4310 |
| 401 | Ga0501073_0007102 | 3300049589 | Bacteria | 8338 |
| 402 | Ga0501074_0036177 | 3300049590 | Bacteria | 3577 |
| 403 | Ga0501079_0004712 | 3300049741 | Bacteria | 10093 |
| 404 | Ga0501080_0216167 | 3300049742 | Bacteria | 1755 |
| 405 | Ga0501081_0031413 | 3300049743 | Bacteria | 3599 |
| 406 | Ga0501083_0005854 | 3300049744 | Bacteria | 8703 |
| 407 | Ga0501035_0003467 | 3300049822 | Bacteria | 15104 |
| 408 | Ga0501044_0001061 | 3300049823 | Bacteria | 33060 |
| 409 | Ga0501044_0333351 | 3300049823 | Bacteria | 1439 |
| 410 | Ga0501045_0037662 | 3300049824 | Bacteria | 3516 |
| 411 | nmdc:mga06r32_88700_c1 | 3300050510 | Bacteria | 3019 |
| 412 | nmdc:mga0rr50_18549_c1 | 3300050513 | Bacteria | 4676 |
| 413 | nmdc:mga0a205_45_c1 | 3300050515 | Bacteria | 68070 |
| 414 | nmdc:mga0a205_934_c1 | 3300050515 | Bacteria | 16438 |
| 415 | Ga0495601_0000034 | 3300053077 | Bacteria | 93719 |
| 416 | Ga0495601_0000104 | 3300053077 | Bacteria | 46045 |
| 417 | Ga0495601_0011008 | 3300053077 | Bacteria | 5404 |
| 418 | Ga0495612_0000024 | 3300053078 | Bacteria | 115718 |
| 419 | Ga0495612_0003818 | 3300053078 | Bacteria | 6261 |
| 420 | Ga0495655_0000006 | 3300053083 | Bacteria | 201200 |
| 421 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 422 | Ga0495595_0000121 | 3300053084 | Bacteria | 33439 |
| 423 | Ga0495595_0002896 | 3300053084 | Bacteria | 6763 |
| 424 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 425 | Ga0495619_0000037 | 3300053085 | Bacteria | 124007 |
| 426 | Ga0495619_0000541 | 3300053085 | Bacteria | 24974 |
| 427 | Ga0495619_0000769 | 3300053085 | Bacteria | 20942 |
| 428 | Ga0495619_0001172 | 3300053085 | Bacteria | 17234 |
| 429 | Ga0495619_0002019 | 3300053085 | Bacteria | 13492 |
| 430 | Ga0495619_0002670 | 3300053085 | Bacteria | 11667 |
| 431 | Ga0500566_0000850 | 3300053094 | Bacteria | 17428 |
| 432 | Ga0500641_0028656 | 3300053096 | Bacteria | 2176 |
| 433 | Ga0500614_000259 | 3300053123 | Bacteria | 13708 |
| 434 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 435 | Ga0500568_0034097 | 3300053139 | Bacteria | 2084 |
| 436 | Ga0501082_0066066 | 3300060353 | Bacteria | 3114 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046462 | Ga0495651_0063378 | Ga0495651_0063378_23_952 | 292 |
| 2 | 3300046463 | Ga0495653_0049927 | Ga0495653_0049927_25_954 | 292 |
| 3 | 3300048914 | Ga0496111_0429560 | Ga0496111_0429560_26_955 | 292 |
| 4 | 3300005985 | Ga0081539_10002638 | Ga0081539_1000263812 | 295 |
| 5 | 3300046459 | Ga0495629_0021138 | Ga0495629_0021138_3390_4514 | 295 |
| 6 | 3300053094 | Ga0500566_0000850 | Ga0500566_0000850_7845_8969 | 295 |
| 7 | 3300046459 | Ga0495629_0015448 | Ga0495629_0015448_2367_3503 | 297 |
| 8 | 3300009176 | Ga0105242_10002124 | Ga0105242_1000212414 | 298 |
| 9 | 3300025934 | Ga0207686_10000061 | Ga0207686_10000061101 | 298 |
| 10 | 3300048905 | Ga0496102_0000081 | Ga0496102_0000081_74282_75397 | 298 |
| 11 | 3300048906 | Ga0496103_0000031 | Ga0496103_0000031_62947_64062 | 298 |
| 12 | 3300013104 | Ga0157370_10040175 | Ga0157370_100401756 | 306 |
| 13 | 3300006852 | Ga0075433_10001612 | Ga0075433_100016127 | 307 |
| 14 | 3300046507 | Ga0495606_0000108 | Ga0495606_0000108_93585_94670 | 307 |
| 15 | 3300049743 | Ga0501081_0031413 | Ga0501081_0031413_1035_2120 | 307 |
| 16 | 3300050515 | nmdc:mga0a205_934_c1 | nmdc:mga0a205_934_c1_6173_7255 | 307 |
| 17 | 3300047322 | Ga0495680_0039353 | Ga0495680_0039353_1653_2774 | 308 |
| 18 | 3300048917 | Ga0496114_0000054 | Ga0496114_0000054_66244_67356 | 308 |
| 19 | 3300048918 | Ga0496115_0000334 | Ga0496115_0000334_30973_32085 | 308 |
| 20 | 3300028379 | Ga0268266_10016916 | Ga0268266_100169165 | 309 |
| 21 | 3300046516 | Ga0495628_0001454 | Ga0495628_0001454_5547_6638 | 310 |
| 22 | 3300048088 | Ga0495602_0005378 | Ga0495602_0005378_8938_10029 | 310 |
| 23 | 3300020070 | Ga0206356_11658876 | Ga0206356_116588762 | 320 |
| 24 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015244 | 322 |
| 25 | 3300026095 | Ga0207676_10000018 | Ga0207676_1000001856 | 322 |
| 26 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_55379_56542 | 324 |
| 27 | 3300048904 | Ga0496101_0000022 | Ga0496101_0000022_185144_186307 | 324 |
| 28 | 3300048907 | Ga0496104_0000077 | Ga0496104_0000077_63899_64954 | 324 |
| 29 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_35895_36950 | 324 |
| 30 | 3300048909 | Ga0496106_0000087 | Ga0496106_0000087_59659_60822 | 324 |
| 31 | 3300048910 | Ga0496107_0000046 | Ga0496107_0000046_53701_54864 | 324 |
| 32 | 3300048922 | Ga0496119_0026593 | Ga0496119_0026593_1849_2904 | 324 |
| 33 | 3300053083 | Ga0495655_0000006 | Ga0495655_0000006_175679_176794 | 324 |
| 34 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_467507_468622 | 324 |
| 35 | 3300048915 | Ga0496112_0000085 | Ga0496112_0000085_56880_57983 | 326 |
| 36 | 3300048924 | Ga0496121_0127773 | Ga0496121_0127773_533_1573 | 326 |
| 37 | 3300053139 | Ga0500568_0034097 | Ga0500568_0034097_335_1375 | 326 |
| 38 | 3300048929 | Ga0496126_0070035 | Ga0496126_0070035_1060_2145 | 327 |
| 39 | 3300005341 | Ga0070691_10000018 | Ga0070691_1000001816 | 328 |
| 40 | 3300005457 | Ga0070662_100000006 | Ga0070662_100000006119 | 328 |
| 41 | 3300025933 | Ga0207706_10000017 | Ga0207706_10000017119 | 328 |
| 42 | 3300053096 | Ga0500641_0028656 | Ga0500641_0028656_822_1940 | 328 |
| 43 | 3300005338 | Ga0068868_100000225 | Ga0068868_10000022524 | 330 |
| 44 | 3300005338 | Ga0068868_100000520 | Ga0068868_10000052017 | 330 |
| 45 | 3300009176 | Ga0105242_10000375 | Ga0105242_1000037528 | 330 |
| 46 | 3300026023 | Ga0207677_10000508 | Ga0207677_1000050820 | 330 |
| 47 | 3300026023 | Ga0207677_10000588 | Ga0207677_100005887 | 330 |
| 48 | 3300046691 | Ga0495670_0012288 | Ga0495670_0012288_2972_4102 | 330 |
| 49 | 3300049586 | Ga0501070_0161104 | Ga0501070_0161104_203_1303 | 330 |
| 50 | 3300005366 | Ga0070659_100030791 | Ga0070659_1000307912 | 331 |
| 51 | 3300025932 | Ga0207690_10019048 | Ga0207690_100190484 | 331 |
| 52 | 3300048911 | Ga0496108_0000365 | Ga0496108_0000365_10684_11760 | 331 |
| 53 | 3300048912 | Ga0496109_0000174 | Ga0496109_0000174_21457_22533 | 331 |
| 54 | 3300046523 | Ga0495644_0000625 | Ga0495644_0000625_751_1878 | 332 |
| 55 | 3300048908 | Ga0496105_0001296 | Ga0496105_0001296_6336_7457 | 332 |
| 56 | 3300005439 | Ga0070711_100001178 | Ga0070711_1000011787 | 333 |
| 57 | 3300005543 | Ga0070672_100000006 | Ga0070672_10000000671 | 333 |
| 58 | 3300005718 | Ga0068866_10004889 | Ga0068866_100048894 | 333 |
| 59 | 3300013297 | Ga0157378_10007104 | Ga0157378_100071042 | 333 |
| 60 | 3300017792 | Ga0163161_10301140 | Ga0163161_103011401 | 333 |
| 61 | 3300025916 | Ga0207663_10001389 | Ga0207663_100013897 | 333 |
| 62 | 3300025940 | Ga0207691_10000025 | Ga0207691_1000002553 | 333 |
| 63 | 3300048927 | Ga0496124_0026294 | Ga0496124_0026294_123_1211 | 333 |
| 64 | 3300047321 | Ga0495676_0087108 | Ga0495676_0087108_258_1280 | 334 |
| 65 | 3300002074 | JGI24748J21848_1000672 | JGI24748J21848_10006724 | 335 |
| 66 | 3300002239 | JGI24034J26672_10000173 | JGI24034J26672_100001739 | 335 |
| 67 | 3300005335 | Ga0070666_10084268 | Ga0070666_100842681 | 335 |
| 68 | 3300025903 | Ga0207680_10003250 | Ga0207680_100032507 | 335 |
| 69 | 3300028563 | Ga0265319_1000110 | Ga0265319_10001103 | 335 |
| 70 | 3300028800 | Ga0265338_10000578 | Ga0265338_100005784 | 335 |
| 71 | 3300047472 | Ga0495686_0074785 | Ga0495686_0074785_225_1319 | 335 |
| 72 | 3300049578 | Ga0501042_0014050 | Ga0501042_0014050_1502_2650 | 335 |
| 73 | 3300001979 | JGI24740J21852_10005107 | JGI24740J21852_100051073 | 336 |
| 74 | 3300005365 | Ga0070688_100001268 | Ga0070688_1000012686 | 336 |
| 75 | 3300005466 | Ga0070685_10001413 | Ga0070685_100014138 | 336 |
| 76 | 3300006846 | Ga0075430_100011782 | Ga0075430_1000117825 | 336 |
| 77 | 3300014326 | Ga0157380_10000261 | Ga0157380_1000026113 | 336 |
| 78 | 3300046511 | Ga0495608_0003132 | Ga0495608_0003132_7091_8167 | 336 |
| 79 | 3300048916 | Ga0496113_0030971 | Ga0496113_0030971_2701_3810 | 336 |
| 80 | 3300048929 | Ga0496126_0103470 | Ga0496126_0103470_1169_2257 | 336 |
| 81 | 3300049588 | Ga0501072_0029142 | Ga0501072_0029142_750_1820 | 336 |
| 82 | 3300005329 | Ga0070683_100005906 | Ga0070683_1000059063 | 337 |
| 83 | 3300005341 | Ga0070691_10018518 | Ga0070691_100185182 | 337 |
| 84 | 3300005344 | Ga0070661_100000035 | Ga0070661_10000003558 | 337 |
| 85 | 3300005535 | Ga0070684_100054366 | Ga0070684_1000543662 | 337 |
| 86 | 3300005535 | Ga0070684_100145570 | Ga0070684_1001455701 | 337 |
| 87 | 3300006173 | Ga0070716_100077104 | Ga0070716_1000771042 | 337 |
| 88 | 3300006175 | Ga0070712_100000353 | Ga0070712_10000035312 | 337 |
| 89 | 3300013308 | Ga0157375_10003947 | Ga0157375_1000394710 | 337 |
| 90 | 3300025915 | Ga0207693_10006121 | Ga0207693_100061217 | 337 |
| 91 | 3300025920 | Ga0207649_10000028 | Ga0207649_10000028104 | 337 |
| 92 | 3300025939 | Ga0207665_10101451 | Ga0207665_101014512 | 337 |
| 93 | 3300025944 | Ga0207661_10157146 | Ga0207661_101571462 | 337 |
| 94 | 3300026116 | Ga0207674_10336353 | Ga0207674_103363531 | 337 |
| 95 | 3300046455 | Ga0495603_0000020 | Ga0495603_0000020_152_1243 | 337 |
| 96 | 3300046516 | Ga0495628_0021870 | Ga0495628_0021870_2770_3843 | 337 |
| 97 | 3300046533 | Ga0495640_0045501 | Ga0495640_0045501_1951_3024 | 337 |
| 98 | 3300046615 | Ga0495656_0001116 | Ga0495656_0001116_173_1249 | 337 |
| 99 | 3300046689 | Ga0495613_0066878 | Ga0495613_0066878_552_1634 | 337 |
| 100 | 3300046809 | Ga0495600_0214128 | Ga0495600_0214128_84_1157 | 337 |
| 101 | 3300048913 | Ga0496110_0082715 | Ga0496110_0082715_184_1257 | 337 |
| 102 | 3300048914 | Ga0496111_0012939 | Ga0496111_0012939_234_1307 | 337 |
| 103 | 3300048918 | Ga0496115_0017924 | Ga0496115_0017924_1899_3002 | 337 |
| 104 | 3300053078 | Ga0495612_0000024 | Ga0495612_0000024_108160_109233 | 337 |
| 105 | 3300053085 | Ga0495619_0002019 | Ga0495619_0002019_123_1205 | 337 |
| 106 | 3300005329 | Ga0070683_100027390 | Ga0070683_1000273905 | 338 |
| 107 | 3300005337 | Ga0070682_100000171 | Ga0070682_10000017143 | 338 |
| 108 | 3300005356 | Ga0070674_100000004 | Ga0070674_100000004115 | 338 |
| 109 | 3300005356 | Ga0070674_100000012 | Ga0070674_10000001274 | 338 |
| 110 | 3300005459 | Ga0068867_100000295 | Ga0068867_10000029511 | 338 |
| 111 | 3300005535 | Ga0070684_100003342 | Ga0070684_10000334218 | 338 |
| 112 | 3300005548 | Ga0070665_100046548 | Ga0070665_1000465483 | 338 |
| 113 | 3300005578 | Ga0068854_100000237 | Ga0068854_10000023723 | 338 |
| 114 | 3300005718 | Ga0068866_10000004 | Ga0068866_10000004152 | 338 |
| 115 | 3300005718 | Ga0068866_10001671 | Ga0068866_100016716 | 338 |
| 116 | 3300005834 | Ga0068851_10001578 | Ga0068851_1000157811 | 338 |
| 117 | 3300005843 | Ga0068860_100014544 | Ga0068860_1000145441 | 338 |
| 118 | 3300006163 | Ga0070715_10000014 | Ga0070715_10000014113 | 338 |
| 119 | 3300006881 | Ga0068865_100000140 | Ga0068865_1000001403 | 338 |
| 120 | 3300009098 | Ga0105245_10007310 | Ga0105245_100073104 | 338 |
| 121 | 3300009101 | Ga0105247_10000955 | Ga0105247_100009556 | 338 |
| 122 | 3300013297 | Ga0157378_10151852 | Ga0157378_101518522 | 338 |
| 123 | 3300013307 | Ga0157372_10004870 | Ga0157372_100048708 | 338 |
| 124 | 3300025321 | Ga0207656_10002200 | Ga0207656_100022008 | 338 |
| 125 | 3300025899 | Ga0207642_10000005 | Ga0207642_1000000555 | 338 |
| 126 | 3300025899 | Ga0207642_10000872 | Ga0207642_100008726 | 338 |
| 127 | 3300025900 | Ga0207710_10000543 | Ga0207710_100005439 | 338 |
| 128 | 3300025905 | Ga0207685_10000025 | Ga0207685_1000002553 | 338 |
| 129 | 3300025927 | Ga0207687_10004101 | Ga0207687_100041017 | 338 |
| 130 | 3300025934 | Ga0207686_10006267 | Ga0207686_100062675 | 338 |
| 131 | 3300025935 | Ga0207709_10020598 | Ga0207709_100205983 | 338 |
| 132 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001759 | 338 |
| 133 | 3300025937 | Ga0207669_10000195 | Ga0207669_1000019523 | 338 |
| 134 | 3300025938 | Ga0207704_10000360 | Ga0207704_1000036019 | 338 |
| 135 | 3300025944 | Ga0207661_10099821 | Ga0207661_100998212 | 338 |
| 136 | 3300025972 | Ga0207668_10039542 | Ga0207668_100395422 | 338 |
| 137 | 3300025981 | Ga0207640_10000248 | Ga0207640_100002487 | 338 |
| 138 | 3300026067 | Ga0207678_10288095 | Ga0207678_102880952 | 338 |
| 139 | 3300026089 | Ga0207648_10002595 | Ga0207648_1000259513 | 338 |
| 140 | 3300028379 | Ga0268266_10014906 | Ga0268266_100149068 | 338 |
| 141 | 3300028381 | Ga0268264_10008972 | Ga0268264_100089726 | 338 |
| 142 | 3300032126 | Ga0307415_100000494 | Ga0307415_1000004946 | 338 |
| 143 | 3300044842 | Ga0466957_0020175 | Ga0466957_0020175_628_1710 | 338 |
| 144 | 3300045976 | Ga0466967_0000017 | Ga0466967_0000017_40590_41672 | 338 |
| 145 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_242715_243827 | 338 |
| 146 | 3300046476 | Ga0495662_0001700 | Ga0495662_0001700_2446_3531 | 338 |
| 147 | 3300046660 | Ga0495625_0000453 | Ga0495625_0000453_13588_14727 | 338 |
| 148 | 3300046683 | Ga0495658_0000306 | Ga0495658_0000306_8595_9707 | 338 |
| 149 | 3300048911 | Ga0496108_0011523 | Ga0496108_0011523_3047_4135 | 338 |
| 150 | 3300048912 | Ga0496109_0000628 | Ga0496109_0000628_28201_29283 | 338 |
| 151 | 3300048913 | Ga0496110_0000011 | Ga0496110_0000011_61500_62582 | 338 |
| 152 | 3300048914 | Ga0496111_0000170 | Ga0496111_0000170_24835_25917 | 338 |
| 153 | 3300048915 | Ga0496112_0020305 | Ga0496112_0020305_2789_3871 | 338 |
| 154 | 3300048916 | Ga0496113_0000202 | Ga0496113_0000202_23850_24932 | 338 |
| 155 | 3300053085 | Ga0495619_0000037 | Ga0495619_0000037_22204_23286 | 338 |
| 156 | 3300053085 | Ga0495619_0001172 | Ga0495619_0001172_15308_16420 | 338 |
| 157 | 3300005333 | Ga0070677_10000868 | Ga0070677_100008683 | 339 |
| 158 | 3300005337 | Ga0070682_100067812 | Ga0070682_1000678123 | 339 |
| 159 | 3300005340 | Ga0070689_100058585 | Ga0070689_1000585851 | 339 |
| 160 | 3300005354 | Ga0070675_100000370 | Ga0070675_1000003706 | 339 |
| 161 | 3300005365 | Ga0070688_100008127 | Ga0070688_1000081275 | 339 |
| 162 | 3300005366 | Ga0070659_100005337 | Ga0070659_1000053375 | 339 |
| 163 | 3300005436 | Ga0070713_100000010 | Ga0070713_1000000106 | 339 |
| 164 | 3300005436 | Ga0070713_100025217 | Ga0070713_1000252175 | 339 |
| 165 | 3300005455 | Ga0070663_100000956 | Ga0070663_1000009569 | 339 |
| 166 | 3300005456 | Ga0070678_100000345 | Ga0070678_1000003458 | 339 |
| 167 | 3300005466 | Ga0070685_10001687 | Ga0070685_100016876 | 339 |
| 168 | 3300005530 | Ga0070679_100001408 | Ga0070679_1000014084 | 339 |
| 169 | 3300005535 | Ga0070684_100047427 | Ga0070684_1000474272 | 339 |
| 170 | 3300005539 | Ga0068853_100265224 | Ga0068853_1002652242 | 339 |
| 171 | 3300005545 | Ga0070695_100210940 | Ga0070695_1002109401 | 339 |
| 172 | 3300005548 | Ga0070665_100008395 | Ga0070665_1000083954 | 339 |
| 173 | 3300005614 | Ga0068856_100008825 | Ga0068856_1000088259 | 339 |
| 174 | 3300005614 | Ga0068856_100205891 | Ga0068856_1002058913 | 339 |
| 175 | 3300005616 | Ga0068852_100000170 | Ga0068852_10000017033 | 339 |
| 176 | 3300005834 | Ga0068851_10009301 | Ga0068851_100093012 | 339 |
| 177 | 3300005841 | Ga0068863_100000107 | Ga0068863_10000010746 | 339 |
| 178 | 3300005841 | Ga0068863_100124472 | Ga0068863_1001244722 | 339 |
| 179 | 3300005842 | Ga0068858_100194838 | Ga0068858_1001948382 | 339 |
| 180 | 3300005843 | Ga0068860_100276950 | Ga0068860_1002769502 | 339 |
| 181 | 3300005844 | Ga0068862_100033642 | Ga0068862_1000336424 | 339 |
| 182 | 3300005937 | Ga0081455_10007388 | Ga0081455_100073884 | 339 |
| 183 | 3300005985 | Ga0081539_10023698 | Ga0081539_100236984 | 339 |
| 184 | 3300007076 | Ga0075435_100058432 | Ga0075435_1000584322 | 339 |
| 185 | 3300009098 | Ga0105245_10000116 | Ga0105245_1000011620 | 339 |
| 186 | 3300009098 | Ga0105245_10000212 | Ga0105245_100002128 | 339 |
| 187 | 3300009177 | Ga0105248_10000008 | Ga0105248_1000000831 | 339 |
| 188 | 3300009551 | Ga0105238_10000048 | Ga0105238_1000004888 | 339 |
| 189 | 3300009553 | Ga0105249_10000070 | Ga0105249_1000007063 | 339 |
| 190 | 3300009553 | Ga0105249_10004349 | Ga0105249_100043498 | 339 |
| 191 | 3300013102 | Ga0157371_10005511 | Ga0157371_100055113 | 339 |
| 192 | 3300013105 | Ga0157369_10000078 | Ga0157369_1000007882 | 339 |
| 193 | 3300013297 | Ga0157378_10086456 | Ga0157378_100864562 | 339 |
| 194 | 3300013306 | Ga0163162_10089692 | Ga0163162_100896922 | 339 |
| 195 | 3300013308 | Ga0157375_10214789 | Ga0157375_102147891 | 339 |
| 196 | 3300014325 | Ga0163163_10390863 | Ga0163163_103908632 | 339 |
| 197 | 3300014326 | Ga0157380_10000149 | Ga0157380_1000014935 | 339 |
| 198 | 3300014326 | Ga0157380_10086326 | Ga0157380_100863262 | 339 |
| 199 | 3300014968 | Ga0157379_10007056 | Ga0157379_100070569 | 339 |
| 200 | 3300014968 | Ga0157379_10036079 | Ga0157379_100360794 | 339 |
| 201 | 3300014969 | Ga0157376_10011312 | Ga0157376_100113123 | 339 |
| 202 | 3300025321 | Ga0207656_10005231 | Ga0207656_100052312 | 339 |
| 203 | 3300025893 | Ga0207682_10000180 | Ga0207682_100001808 | 339 |
| 204 | 3300025921 | Ga0207652_10004337 | Ga0207652_1000433712 | 339 |
| 205 | 3300025924 | Ga0207694_10000056 | Ga0207694_1000005688 | 339 |
| 206 | 3300025925 | Ga0207650_10078773 | Ga0207650_100787733 | 339 |
| 207 | 3300025926 | Ga0207659_10000022 | Ga0207659_10000022125 | 339 |
| 208 | 3300025927 | Ga0207687_10000020 | Ga0207687_1000002061 | 339 |
| 209 | 3300025927 | Ga0207687_10000031 | Ga0207687_1000003199 | 339 |
| 210 | 3300025928 | Ga0207700_10000007 | Ga0207700_10000007207 | 339 |
| 211 | 3300025928 | Ga0207700_10062273 | Ga0207700_100622734 | 339 |
| 212 | 3300025932 | Ga0207690_10003023 | Ga0207690_100030233 | 339 |
| 213 | 3300025934 | Ga0207686_10000356 | Ga0207686_100003566 | 339 |
| 214 | 3300025936 | Ga0207670_10063341 | Ga0207670_100633411 | 339 |
| 215 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006428 | 339 |
| 216 | 3300025944 | Ga0207661_10002602 | Ga0207661_100026026 | 339 |
| 217 | 3300025944 | Ga0207661_10148530 | Ga0207661_101485302 | 339 |
| 218 | 3300025961 | Ga0207712_10000019 | Ga0207712_10000019248 | 339 |
| 219 | 3300025961 | Ga0207712_10026642 | Ga0207712_100266422 | 339 |
| 220 | 3300025972 | Ga0207668_10006016 | Ga0207668_100060165 | 339 |
| 221 | 3300025981 | Ga0207640_10017114 | Ga0207640_100171142 | 339 |
| 222 | 3300025986 | Ga0207658_10003673 | Ga0207658_100036734 | 339 |
| 223 | 3300025986 | Ga0207658_10091414 | Ga0207658_100914142 | 339 |
| 224 | 3300026035 | Ga0207703_10079201 | Ga0207703_100792012 | 339 |
| 225 | 3300026041 | Ga0207639_10128239 | Ga0207639_101282392 | 339 |
| 226 | 3300026067 | Ga0207678_10005666 | Ga0207678_100056664 | 339 |
| 227 | 3300026067 | Ga0207678_10173766 | Ga0207678_101737662 | 339 |
| 228 | 3300026078 | Ga0207702_10000242 | Ga0207702_100002424 | 339 |
| 229 | 3300026078 | Ga0207702_10009047 | Ga0207702_100090478 | 339 |
| 230 | 3300026088 | Ga0207641_10000077 | Ga0207641_1000007773 | 339 |
| 231 | 3300026121 | Ga0207683_10001994 | Ga0207683_1000199414 | 339 |
| 232 | 3300026142 | Ga0207698_10000042 | Ga0207698_1000004265 | 339 |
| 233 | 3300026142 | Ga0207698_10059961 | Ga0207698_100599612 | 339 |
| 234 | 3300028379 | Ga0268266_10001339 | Ga0268266_1000133927 | 339 |
| 235 | 3300028381 | Ga0268264_10129064 | Ga0268264_101290642 | 339 |
| 236 | 3300044694 | Ga0466963_0000289 | Ga0466963_0000289_9069_10151 | 339 |
| 237 | 3300046455 | Ga0495603_0020677 | Ga0495603_0020677_1298_2404 | 339 |
| 238 | 3300046459 | Ga0495629_0003726 | Ga0495629_0003726_2398_3483 | 339 |
| 239 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_116806_117885 | 339 |
| 240 | 3300046461 | Ga0495641_0017264 | Ga0495641_0017264_2373_3458 | 339 |
| 241 | 3300046463 | Ga0495653_0228740 | Ga0495653_0228740_64_1143 | 339 |
| 242 | 3300046511 | Ga0495608_0000036 | Ga0495608_0000036_70515_71600 | 339 |
| 243 | 3300046511 | Ga0495608_0069207 | Ga0495608_0069207_953_2032 | 339 |
| 244 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_179121_180206 | 339 |
| 245 | 3300046674 | Ga0495588_0000149 | Ga0495588_0000149_18386_19471 | 339 |
| 246 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_70515_71600 | 339 |
| 247 | 3300046681 | Ga0495647_0000047 | Ga0495647_0000047_23240_24325 | 339 |
| 248 | 3300046683 | Ga0495658_0001601 | Ga0495658_0001601_6647_7732 | 339 |
| 249 | 3300046684 | Ga0495669_0000635 | Ga0495669_0000635_4954_6033 | 339 |
| 250 | 3300046689 | Ga0495613_0000481 | Ga0495613_0000481_8002_9087 | 339 |
| 251 | 3300046690 | Ga0495624_0000038 | Ga0495624_0000038_66816_67901 | 339 |
| 252 | 3300046809 | Ga0495600_0037837 | Ga0495600_0037837_922_2007 | 339 |
| 253 | 3300047317 | Ga0495604_0000122 | Ga0495604_0000122_58504_59589 | 339 |
| 254 | 3300047317 | Ga0495604_0017335 | Ga0495604_0017335_578_1663 | 339 |
| 255 | 3300047317 | Ga0495604_0055428 | Ga0495604_0055428_1500_2579 | 339 |
| 256 | 3300047444 | Ga0495675_0000037 | Ga0495675_0000037_57329_58414 | 339 |
| 257 | 3300047673 | Ga0495593_0012869 | Ga0495593_0012869_2384_3466 | 339 |
| 258 | 3300048088 | Ga0495602_0000166 | Ga0495602_0000166_57710_58795 | 339 |
| 259 | 3300048088 | Ga0495602_0038462 | Ga0495602_0038462_1642_2718 | 339 |
| 260 | 3300048088 | Ga0495602_0095387 | Ga0495602_0095387_338_1423 | 339 |
| 261 | 3300048903 | Ga0496100_0000014 | Ga0496100_0000014_64764_65843 | 339 |
| 262 | 3300048904 | Ga0496101_0000036 | Ga0496101_0000036_65368_66447 | 339 |
| 263 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_64272_65351 | 339 |
| 264 | 3300048907 | Ga0496104_0044152 | Ga0496104_0044152_462_1547 | 339 |
| 265 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_164563_165642 | 339 |
| 266 | 3300048909 | Ga0496106_0000043 | Ga0496106_0000043_43588_44667 | 339 |
| 267 | 3300048909 | Ga0496106_0000213 | Ga0496106_0000213_39230_40306 | 339 |
| 268 | 3300048910 | Ga0496107_0000022 | Ga0496107_0000022_18764_19843 | 339 |
| 269 | 3300048910 | Ga0496107_0079494 | Ga0496107_0079494_166_1242 | 339 |
| 270 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_18613_19698 | 339 |
| 271 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_168392_169471 | 339 |
| 272 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_341135_342214 | 339 |
| 273 | 3300048912 | Ga0496109_0000095 | Ga0496109_0000095_18559_19644 | 339 |
| 274 | 3300048913 | Ga0496110_0057974 | Ga0496110_0057974_155_1240 | 339 |
| 275 | 3300048929 | Ga0496126_0014886 | Ga0496126_0014886_5011_6096 | 339 |
| 276 | 3300049584 | Ga0501068_0071366 | Ga0501068_0071366_500_1585 | 339 |
| 277 | 3300050513 | nmdc:mga0rr50_18549_c1 | nmdc:mga0rr50_18549_c1_2473_3552 | 339 |
| 278 | 3300053077 | Ga0495601_0000034 | Ga0495601_0000034_25320_26405 | 339 |
| 279 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_374042_375127 | 339 |
| 280 | 3300053084 | Ga0495595_0002896 | Ga0495595_0002896_3593_4678 | 339 |
| 281 | 3300053085 | Ga0495619_0000541 | Ga0495619_0000541_2478_3563 | 339 |
| 282 | 3300053123 | Ga0500614_000259 | Ga0500614_000259_655_1734 | 339 |
| 283 | 3300005337 | Ga0070682_100000030 | Ga0070682_100000030116 | 340 |
| 284 | 3300005530 | Ga0070679_100000225 | Ga0070679_10000022524 | 340 |
| 285 | 3300005539 | Ga0068853_100024630 | Ga0068853_1000246304 | 340 |
| 286 | 3300005548 | Ga0070665_100000040 | Ga0070665_10000004061 | 340 |
| 287 | 3300005614 | Ga0068856_100029013 | Ga0068856_1000290132 | 340 |
| 288 | 3300005842 | Ga0068858_100000075 | Ga0068858_10000007545 | 340 |
| 289 | 3300005842 | Ga0068858_100000319 | Ga0068858_10000031917 | 340 |
| 290 | 3300005937 | Ga0081455_10140326 | Ga0081455_101403261 | 340 |
| 291 | 3300006847 | Ga0075431_100077064 | Ga0075431_1000770641 | 340 |
| 292 | 3300009098 | Ga0105245_10001002 | Ga0105245_100010025 | 340 |
| 293 | 3300009553 | Ga0105249_10046590 | Ga0105249_100465902 | 340 |
| 294 | 3300010375 | Ga0105239_10115492 | Ga0105239_101154923 | 340 |
| 295 | 3300013104 | Ga0157370_10107046 | Ga0157370_101070464 | 340 |
| 296 | 3300013296 | Ga0157374_10000686 | Ga0157374_100006867 | 340 |
| 297 | 3300013308 | Ga0157375_10000130 | Ga0157375_1000013015 | 340 |
| 298 | 3300025917 | Ga0207660_10039147 | Ga0207660_100391473 | 340 |
| 299 | 3300025921 | Ga0207652_10000309 | Ga0207652_1000030929 | 340 |
| 300 | 3300025927 | Ga0207687_10000079 | Ga0207687_1000007966 | 340 |
| 301 | 3300025944 | Ga0207661_10013737 | Ga0207661_100137374 | 340 |
| 302 | 3300025961 | Ga0207712_10044699 | Ga0207712_100446991 | 340 |
| 303 | 3300026035 | Ga0207703_10000088 | Ga0207703_1000008845 | 340 |
| 304 | 3300026035 | Ga0207703_10000166 | Ga0207703_1000016617 | 340 |
| 305 | 3300026041 | Ga0207639_10053131 | Ga0207639_100531313 | 340 |
| 306 | 3300026078 | Ga0207702_10020977 | Ga0207702_100209776 | 340 |
| 307 | 3300028379 | Ga0268266_10000045 | Ga0268266_1000004564 | 340 |
| 308 | 3300028556 | Ga0265337_1003867 | Ga0265337_10038671 | 340 |
| 309 | 3300028558 | Ga0265326_10000229 | Ga0265326_1000022914 | 340 |
| 310 | 3300028654 | Ga0265322_10000020 | Ga0265322_1000002065 | 340 |
| 311 | 3300029957 | Ga0265324_10000360 | Ga0265324_1000036019 | 340 |
| 312 | 3300029957 | Ga0265324_10059787 | Ga0265324_100597872 | 340 |
| 313 | 3300031239 | Ga0265328_10062997 | Ga0265328_100629971 | 340 |
| 314 | 3300031240 | Ga0265320_10000035 | Ga0265320_1000003565 | 340 |
| 315 | 3300031250 | Ga0265331_10003031 | Ga0265331_100030314 | 340 |
| 316 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015433 | 340 |
| 317 | 3300031711 | Ga0265314_10002307 | Ga0265314_1000230719 | 340 |
| 318 | 3300041512 | Ga0451853_0309797 | Ga0451853_0309797_75_1154 | 340 |
| 319 | 3300046454 | Ga0495592_0086563 | Ga0495592_0086563_429_1517 | 340 |
| 320 | 3300046462 | Ga0495651_0146562 | Ga0495651_0146562_24_1100 | 340 |
| 321 | 3300046499 | Ga0495594_0000011 | Ga0495594_0000011_3833_4927 | 340 |
| 322 | 3300046515 | Ga0495620_0000797 | Ga0495620_0000797_4946_6028 | 340 |
| 323 | 3300046516 | Ga0495628_0046561 | Ga0495628_0046561_2218_3294 | 340 |
| 324 | 3300046519 | Ga0495632_0043599 | Ga0495632_0043599_66_1169 | 340 |
| 325 | 3300046529 | Ga0495652_0000023 | Ga0495652_0000023_102558_103646 | 340 |
| 326 | 3300046557 | Ga0495622_0000021 | Ga0495622_0000021_68635_69729 | 340 |
| 327 | 3300046642 | Ga0495634_0000028 | Ga0495634_0000028_53785_54867 | 340 |
| 328 | 3300046678 | Ga0495599_0007290 | Ga0495599_0007290_4408_5490 | 340 |
| 329 | 3300046681 | Ga0495647_0000009 | Ga0495647_0000009_24383_25465 | 340 |
| 330 | 3300046689 | Ga0495613_0036319 | Ga0495613_0036319_77_1159 | 340 |
| 331 | 3300046690 | Ga0495624_0000414 | Ga0495624_0000414_27793_28875 | 340 |
| 332 | 3300046694 | Ga0495649_0001181 | Ga0495649_0001181_14077_15159 | 340 |
| 333 | 3300047321 | Ga0495676_0002391 | Ga0495676_0002391_5883_6965 | 340 |
| 334 | 3300047322 | Ga0495680_0005747 | Ga0495680_0005747_1655_2737 | 340 |
| 335 | 3300047446 | Ga0495679_012527 | Ga0495679_012527_1549_2631 | 340 |
| 336 | 3300047472 | Ga0495686_0108144 | Ga0495686_0108144_394_1494 | 340 |
| 337 | 3300048906 | Ga0496103_0081446 | Ga0496103_0081446_831_1934 | 340 |
| 338 | 3300048917 | Ga0496114_0004552 | Ga0496114_0004552_5409_6491 | 340 |
| 339 | 3300048919 | Ga0496116_0000519 | Ga0496116_0000519_27433_28536 | 340 |
| 340 | 3300048920 | Ga0496117_0047585 | Ga0496117_0047585_1707_2810 | 340 |
| 341 | 3300048921 | Ga0496118_0001908 | Ga0496118_0001908_9884_10987 | 340 |
| 342 | 3300048921 | Ga0496118_0075638 | Ga0496118_0075638_532_1623 | 340 |
| 343 | 3300048921 | Ga0496118_0078581 | Ga0496118_0078581_130_1233 | 340 |
| 344 | 3300048922 | Ga0496119_0002641 | Ga0496119_0002641_12655_13758 | 340 |
| 345 | 3300048922 | Ga0496119_0015645 | Ga0496119_0015645_3595_4683 | 340 |
| 346 | 3300048923 | Ga0496120_0003219 | Ga0496120_0003219_8203_9294 | 340 |
| 347 | 3300048924 | Ga0496121_0081636 | Ga0496121_0081636_1299_2390 | 340 |
| 348 | 3300049568 | Ga0501031_0002856 | Ga0501031_0002856_9594_10682 | 340 |
| 349 | 3300049569 | Ga0501032_0000297 | Ga0501032_0000297_40344_41432 | 340 |
| 350 | 3300049570 | Ga0501033_0001109 | Ga0501033_0001109_23000_24088 | 340 |
| 351 | 3300049571 | Ga0501034_0038342 | Ga0501034_0038342_349_1437 | 340 |
| 352 | 3300049571 | Ga0501034_0078775 | Ga0501034_0078775_971_2059 | 340 |
| 353 | 3300049572 | Ga0501036_0024005 | Ga0501036_0024005_321_1409 | 340 |
| 354 | 3300049573 | Ga0501037_0000452 | Ga0501037_0000452_349_1437 | 340 |
| 355 | 3300049574 | Ga0501038_0001076 | Ga0501038_0001076_351_1439 | 340 |
| 356 | 3300049575 | Ga0501039_0018657 | Ga0501039_0018657_1695_2783 | 340 |
| 357 | 3300049576 | Ga0501040_0085880 | Ga0501040_0085880_970_2058 | 340 |
| 358 | 3300049578 | Ga0501042_0010425 | Ga0501042_0010425_1968_3062 | 340 |
| 359 | 3300049578 | Ga0501042_0073647 | Ga0501042_0073647_1068_2156 | 340 |
| 360 | 3300049579 | Ga0501043_0001014 | Ga0501043_0001014_349_1437 | 340 |
| 361 | 3300049580 | Ga0501046_0001243 | Ga0501046_0001243_351_1439 | 340 |
| 362 | 3300049581 | Ga0501047_0000513 | Ga0501047_0000513_351_1439 | 340 |
| 363 | 3300049581 | Ga0501047_0009245 | Ga0501047_0009245_2454_3554 | 340 |
| 364 | 3300049582 | Ga0501048_0019240 | Ga0501048_0019240_1680_2768 | 340 |
| 365 | 3300049583 | Ga0501067_0052350 | Ga0501067_0052350_1066_2154 | 340 |
| 366 | 3300049584 | Ga0501068_0018844 | Ga0501068_0018844_323_1411 | 340 |
| 367 | 3300049585 | Ga0501069_0120141 | Ga0501069_0120141_44_1132 | 340 |
| 368 | 3300049586 | Ga0501070_0000351 | Ga0501070_0000351_40349_41437 | 340 |
| 369 | 3300049587 | Ga0501071_0042658 | Ga0501071_0042658_377_1465 | 340 |
| 370 | 3300049589 | Ga0501073_0007102 | Ga0501073_0007102_331_1419 | 340 |
| 371 | 3300049590 | Ga0501074_0036177 | Ga0501074_0036177_92_1180 | 340 |
| 372 | 3300049741 | Ga0501079_0004712 | Ga0501079_0004712_1816_2904 | 340 |
| 373 | 3300049742 | Ga0501080_0216167 | Ga0501080_0216167_639_1727 | 340 |
| 374 | 3300049744 | Ga0501083_0005854 | Ga0501083_0005854_335_1423 | 340 |
| 375 | 3300049822 | Ga0501035_0003467 | Ga0501035_0003467_13668_14756 | 340 |
| 376 | 3300049823 | Ga0501044_0001061 | Ga0501044_0001061_31624_32712 | 340 |
| 377 | 3300049823 | Ga0501044_0333351 | Ga0501044_0333351_60_1148 | 340 |
| 378 | 3300049824 | Ga0501045_0037662 | Ga0501045_0037662_1823_2911 | 340 |
| 379 | 3300053077 | Ga0495601_0000104 | Ga0495601_0000104_8819_9901 | 340 |
| 380 | 3300053078 | Ga0495612_0003818 | Ga0495612_0003818_954_2036 | 340 |
| 381 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_237334_238410 | 340 |
| 382 | 3300060353 | Ga0501082_0066066 | Ga0501082_0066066_1682_2770 | 340 |
| 383 | 3300003659 | JGI25404J52841_10010398 | JGI25404J52841_100103981 | 341 |
| 384 | 3300005364 | Ga0070673_100005029 | Ga0070673_1000050294 | 341 |
| 385 | 3300005435 | Ga0070714_100032012 | Ga0070714_1000320122 | 341 |
| 386 | 3300005983 | Ga0081540_1000063 | Ga0081540_100006331 | 341 |
| 387 | 3300006852 | Ga0075433_10001022 | Ga0075433_100010229 | 341 |
| 388 | 3300025929 | Ga0207664_10021131 | Ga0207664_100211312 | 341 |
| 389 | 3300025945 | Ga0207679_10082582 | Ga0207679_100825822 | 341 |
| 390 | 3300025960 | Ga0207651_10002519 | Ga0207651_100025194 | 341 |
| 391 | 3300025986 | Ga0207658_10082904 | Ga0207658_100829042 | 341 |
| 392 | 3300046454 | Ga0495592_0000318 | Ga0495592_0000318_14946_16031 | 341 |
| 393 | 3300046455 | Ga0495603_0000711 | Ga0495603_0000711_7421_8530 | 341 |
| 394 | 3300046461 | Ga0495641_0025027 | Ga0495641_0025027_817_1896 | 341 |
| 395 | 3300046476 | Ga0495662_0004716 | Ga0495662_0004716_5636_6721 | 341 |
| 396 | 3300046511 | Ga0495608_0000183 | Ga0495608_0000183_26458_27570 | 341 |
| 397 | 3300046514 | Ga0495618_0000144 | Ga0495618_0000144_46922_48007 | 341 |
| 398 | 3300046516 | Ga0495628_0001544 | Ga0495628_0001544_5988_7073 | 341 |
| 399 | 3300046516 | Ga0495628_0017394 | Ga0495628_0017394_2468_3580 | 341 |
| 400 | 3300046517 | Ga0495630_0000175 | Ga0495630_0000175_24079_25161 | 341 |
| 401 | 3300046517 | Ga0495630_0000555 | Ga0495630_0000555_15023_16108 | 341 |
| 402 | 3300046517 | Ga0495630_0095391 | Ga0495630_0095391_683_1765 | 341 |
| 403 | 3300046533 | Ga0495640_0043718 | Ga0495640_0043718_240_1325 | 341 |
| 404 | 3300046535 | Ga0495586_0048284 | Ga0495586_0048284_599_1687 | 341 |
| 405 | 3300046537 | Ga0495598_0022753 | Ga0495598_0022753_480_1580 | 341 |
| 406 | 3300046543 | Ga0495645_0025391 | Ga0495645_0025391_1295_2377 | 341 |
| 407 | 3300046543 | Ga0495645_0036952 | Ga0495645_0036952_2315_3400 | 341 |
| 408 | 3300046559 | Ga0495667_0000034 | Ga0495667_0000034_76547_77638 | 341 |
| 409 | 3300046642 | Ga0495634_0002025 | Ga0495634_0002025_12886_13968 | 341 |
| 410 | 3300046642 | Ga0495634_0098765 | Ga0495634_0098765_265_1344 | 341 |
| 411 | 3300046663 | Ga0495635_0000005 | Ga0495635_0000005_244935_246020 | 341 |
| 412 | 3300046663 | Ga0495635_0098640 | Ga0495635_0098640_474_1556 | 341 |
| 413 | 3300046663 | Ga0495635_0144191 | Ga0495635_0144191_341_1423 | 341 |
| 414 | 3300046675 | Ga0495657_0002724 | Ga0495657_0002724_12099_13211 | 341 |
| 415 | 3300046689 | Ga0495613_0000321 | Ga0495613_0000321_11889_13001 | 341 |
| 416 | 3300046690 | Ga0495624_0005038 | Ga0495624_0005038_432_1544 | 341 |
| 417 | 3300047317 | Ga0495604_0000317 | Ga0495604_0000317_34683_35768 | 341 |
| 418 | 3300047319 | Ga0495674_0000019 | Ga0495674_0000019_150197_151291 | 341 |
| 419 | 3300047321 | Ga0495676_0002025 | Ga0495676_0002025_12385_13548 | 341 |
| 420 | 3300047322 | Ga0495680_0000193 | Ga0495680_0000193_55655_56767 | 341 |
| 421 | 3300047322 | Ga0495680_0058143 | Ga0495680_0058143_1372_2457 | 341 |
| 422 | 3300047322 | Ga0495680_0152101 | Ga0495680_0152101_312_1403 | 341 |
| 423 | 3300048906 | Ga0496103_0036386 | Ga0496103_0036386_1846_2940 | 341 |
| 424 | 3300048907 | Ga0496104_0005387 | Ga0496104_0005387_4617_5717 | 341 |
| 425 | 3300048908 | Ga0496105_0000098 | Ga0496105_0000098_6391_7491 | 341 |
| 426 | 3300048913 | Ga0496110_0172628 | Ga0496110_0172628_50_1129 | 341 |
| 427 | 3300048917 | Ga0496114_0088287 | Ga0496114_0088287_148_1239 | 341 |
| 428 | 3300048918 | Ga0496115_0000010 | Ga0496115_0000010_170576_171667 | 341 |
| 429 | 3300050515 | nmdc:mga0a205_45_c1 | nmdc:mga0a205_45_c1_57081_58163 | 341 |
| 430 | 3300053077 | Ga0495601_0011008 | Ga0495601_0011008_2315_3397 | 341 |
| 431 | 3300053084 | Ga0495595_0000121 | Ga0495595_0000121_7624_8736 | 341 |
| 432 | 3300053085 | Ga0495619_0000769 | Ga0495619_0000769_18837_19919 | 341 |
| 433 | 3300053085 | Ga0495619_0002670 | Ga0495619_0002670_5411_6493 | 341 |
| 434 | 3300001977 | JGI24746J21847_1000221 | JGI24746J21847_10002212 | 343 |
| 435 | 3300048913 | Ga0496110_0178352 | Ga0496110_0178352_810_1901 | 343 |
| 436 | 3300050510 | nmdc:mga06r32_88700_c1 | nmdc:mga06r32_88700_c1_94_1185 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3clo-assembly2.cif.gz_C-2 | crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution | 0.9704 | 283 | 324 |
| 3clo-assembly1.cif.gz_B | crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution | 0.9687 | 283 | 324 |
| 6zj2-assembly3.cif.gz_L | structure of rcsb from salmonella enterica serovar typhimurium bound to promoter rpra in the presence of phosphomimetic bef3- | 0.9432 | 283 | 326 |
| 8hno-assembly1.cif.gz_B | archaeal transcription factor wild type | 0.9423 | 283 | 334 |
| 5f64-assembly2.cif.gz_C | putative positive transcription regulator (sensor evgs) from shigella flexneri | 0.9388 | 282 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cloC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9647 | 283 | 326 | 1.10.10.10 |
| 3p7nB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9524 | 282 | 326 | 1.10.10.10 |
| 3p7nA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9454 | 283 | 326 | 1.10.10.10 |
| af_Q2G2N6_1_70_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9248 | 284 | 328 | 1.10.10.10 |
| 5f64B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9241 | 282 | 326 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1D8K9J0-F1-model_v4 | HDOD domain-containing protein | 0.7975 | 124 | 266 |
|
| AF-A0A354A4L1-F1-model_v4 | HDOD domain-containing protein | 0.7722 | 115 | 267 |
|
| AF-A0A351BLY0-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.7647 | 104 | 265 |
GO:0000155
|
| AF-A0A838JK57-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.7536 | 108 | 267 |
GO:0000155
|
| AF-A0A3D3NJC7-F1-model_v4 | Histidine kinase | 0.7533 | 107 | 279 |
GO:0016301
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar