F443481

General Info

Members Datasets Scaffolds Average Seq Length
436 252 436 351

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100000004|Ga0070674_100000004115
Length 373
Sequence MVPFGTLILGMLRLNRASWCADELCETRSFPMQATKAHSNGKVKPESARQLDAKTKQAPGARLAAAFEAVEKFPVLMESRERVMDVGLAIAVLRFANRNVGSGGSIATIPEAVNLLKPSGLLAIAGTAPVFDFFEPNGGREMRPERIRVHALATQQAADEIGRAVGWEARDELAIATLLHDVGRLVISNLHPGDRSFFEAVAKTPEQRLKEERDRLGIDHALVGGVLARRWNMPQRIAVAIERHHAADAEDLAAMVGTADMVAHYAQGEAISAERLRAMALRCGLDGNGLREILYQLPYARSDGARISEPCPLSSRELDVLRHLSEGMVYKQIAGEMQLSVSTIRTHLHNVYGKIGAVDRAQAVLTARDRGWI

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 11.01
Rhizosphere 84.17
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000221 3300001977 Bacteria 7803
2 JGI24740J21852_10005107 3300001979 Bacteria 5572
3 JGI24748J21848_1000672 3300002074 Bacteria 3678
4 JGI24034J26672_10000173 3300002239 Bacteria 8909
5 JGI25404J52841_10010398 3300003659 Bacteria 2001
6 Ga0070683_100005906 3300005329 Bacteria 10246
7 Ga0070683_100027390 3300005329 Bacteria 5140
8 Ga0070677_10000868 3300005333 Bacteria 9957
9 Ga0070666_10084268 3300005335 Bacteria 2175
10 Ga0070682_100000030 3300005337 Bacteria 182768
11 Ga0070682_100000171 3300005337 Bacteria 48470
12 Ga0070682_100067812 3300005337 Bacteria 2273
13 Ga0068868_100000225 3300005338 Bacteria 38457
14 Ga0068868_100000520 3300005338 Bacteria 25795
15 Ga0070689_100058585 3300005340 Bacteria 2991
16 Ga0070691_10000018 3300005341 Bacteria 47284
17 Ga0070691_10018518 3300005341 Unclassified 3211
18 Ga0070661_100000035 3300005344 Bacteria 111363
19 Ga0070675_100000370 3300005354 Bacteria 30370
20 Ga0070674_100000004 3300005356 Bacteria 169446
21 Ga0070674_100000012 3300005356 Bacteria 130773
22 Ga0070673_100005029 3300005364 Bacteria 8437
23 Ga0070688_100001268 3300005365 Bacteria 12586
24 Ga0070688_100008127 3300005365 Bacteria 5685
25 Ga0070659_100005337 3300005366 Bacteria 9220
26 Ga0070659_100030791 3300005366 Bacteria 4153
27 Ga0070714_100032012 3300005435 Bacteria 4391
28 Ga0070713_100000010 3300005436 Bacteria 151790
29 Ga0070713_100025217 3300005436 Bacteria 4645
30 Ga0070711_100001178 3300005439 Bacteria 14082
31 Ga0070663_100000956 3300005455 Bacteria 15676
32 Ga0070678_100000345 3300005456 Bacteria 21680
33 Ga0070662_100000006 3300005457 Bacteria 169366
34 Ga0068867_100000295 3300005459 Bacteria 32708
35 Ga0070685_10001413 3300005466 Bacteria 12586
36 Ga0070685_10001687 3300005466 Bacteria 11606
37 Ga0070679_100000225 3300005530 Bacteria 46317
38 Ga0070679_100001408 3300005530 Bacteria 21242
39 Ga0070684_100003342 3300005535 Bacteria 12013
40 Ga0070684_100047427 3300005535 Bacteria 3723
41 Ga0070684_100054366 3300005535 Bacteria 3489
42 Ga0070684_100145570 3300005535 Bacteria 2144
43 Ga0068853_100024630 3300005539 Bacteria 5048
44 Ga0068853_100265224 3300005539 Bacteria 1580
45 Ga0070672_100000006 3300005543 Bacteria 117060
46 Ga0070695_100210940 3300005545 Bacteria 1394
47 Ga0070665_100000040 3300005548 Bacteria 305480
48 Ga0070665_100008395 3300005548 Bacteria 10448
49 Ga0070665_100046548 3300005548 Bacteria 4357
50 Ga0068854_100000237 3300005578 Bacteria 37524
51 Ga0068856_100008825 3300005614 Bacteria 9808
52 Ga0068856_100029013 3300005614 Bacteria 5406
53 Ga0068856_100205891 3300005614 Bacteria 1982
54 Ga0068852_100000170 3300005616 Bacteria 43748
55 Ga0068864_100000015 3300005618 Bacteria 303368
56 Ga0068866_10000004 3300005718 Bacteria 202810
57 Ga0068866_10001671 3300005718 Bacteria 9349
58 Ga0068866_10004889 3300005718 Bacteria 5505
59 Ga0068851_10001578 3300005834 Bacteria 10004
60 Ga0068851_10009301 3300005834 Bacteria 4563
61 Ga0068863_100000107 3300005841 Bacteria 88879
62 Ga0068863_100124472 3300005841 Bacteria 2460
63 Ga0068858_100000075 3300005842 Bacteria 104349
64 Ga0068858_100000319 3300005842 Bacteria 51080
65 Ga0068858_100194838 3300005842 Bacteria 1915
66 Ga0068860_100014544 3300005843 Bacteria 7701
67 Ga0068860_100276950 3300005843 Bacteria 1639
68 Ga0068862_100033642 3300005844 Bacteria 4335
69 Ga0081455_10007388 3300005937 Bacteria 11579
70 Ga0081455_10140326 3300005937 Bacteria 1878
71 Ga0081540_1000063 3300005983 Bacteria 119510
72 Ga0081539_10002638 3300005985 Bacteria 24507
73 Ga0081539_10023698 3300005985 Bacteria 4011
74 Ga0070715_10000014 3300006163 Bacteria 154272
75 Ga0070716_100077104 3300006173 Bacteria 1977
76 Ga0070712_100000353 3300006175 Bacteria 26043
77 Ga0075430_100011782 3300006846 Bacteria 7443
78 Ga0075431_100077064 3300006847 Bacteria 3441
79 Ga0075433_10001022 3300006852 Bacteria 19936
80 Ga0075433_10001612 3300006852 Bacteria 16741
81 Ga0068865_100000140 3300006881 Bacteria 38055
82 Ga0075435_100058432 3300007076 Bacteria 3124
83 Ga0105245_10000116 3300009098 Bacteria 77303
84 Ga0105245_10000212 3300009098 Bacteria 55133
85 Ga0105245_10001002 3300009098 Bacteria 25634
86 Ga0105245_10007310 3300009098 Bacteria 9669
87 Ga0105247_10000955 3300009101 Bacteria 21799
88 Ga0105242_10000375 3300009176 Bacteria 35458
89 Ga0105242_10002124 3300009176 Bacteria 15632
90 Ga0105248_10000008 3300009177 Bacteria 403910
91 Ga0105238_10000048 3300009551 Bacteria 146322
92 Ga0105249_10000070 3300009553 Bacteria 147277
93 Ga0105249_10004349 3300009553 Bacteria 12251
94 Ga0105249_10046590 3300009553 Bacteria 3946
95 Ga0105239_10115492 3300010375 Bacteria 2978
96 Ga0157371_10005511 3300013102 Bacteria 10656
97 Ga0157370_10040175 3300013104 Bacteria 4517
98 Ga0157370_10107046 3300013104 Bacteria 2616
99 Ga0157369_10000078 3300013105 Bacteria 135173
100 Ga0157374_10000686 3300013296 Bacteria 29832
101 Ga0157378_10007104 3300013297 Bacteria 9776
102 Ga0157378_10086456 3300013297 Bacteria 2843
103 Ga0157378_10151852 3300013297 Bacteria 2159
104 Ga0163162_10089692 3300013306 Bacteria 3156
105 Ga0157372_10004870 3300013307 Bacteria 14268
106 Ga0157375_10000130 3300013308 Bacteria 74968
107 Ga0157375_10003947 3300013308 Bacteria 12860
108 Ga0157375_10214789 3300013308 Bacteria 2081
109 Ga0163163_10390863 3300014325 Bacteria 1449
110 Ga0157380_10000149 3300014326 Bacteria 39858
111 Ga0157380_10000261 3300014326 Bacteria 31504
112 Ga0157380_10086326 3300014326 Bacteria 2578
113 Ga0157379_10007056 3300014968 Bacteria 9711
114 Ga0157379_10036079 3300014968 Bacteria 4409
115 Ga0157376_10011312 3300014969 Bacteria 6572
116 Ga0163161_10301140 3300017792 Unclassified 1263
117 Ga0206356_11658876 3300020070 Bacteria 4945
118 Ga0207656_10002200 3300025321 Bacteria 6527
119 Ga0207656_10005231 3300025321 Bacteria 4569
120 Ga0207682_10000180 3300025893 Bacteria 28686
121 Ga0207642_10000005 3300025899 Bacteria 401934
122 Ga0207642_10000872 3300025899 Bacteria 9428
123 Ga0207710_10000543 3300025900 Bacteria 22684
124 Ga0207680_10003250 3300025903 Bacteria 7653
125 Ga0207685_10000025 3300025905 Bacteria 110358
126 Ga0207693_10006121 3300025915 Bacteria 9974
127 Ga0207663_10001389 3300025916 Bacteria 11242
128 Ga0207660_10039147 3300025917 Bacteria 3313
129 Ga0207649_10000028 3300025920 Bacteria 161482
130 Ga0207652_10000309 3300025921 Bacteria 50266
131 Ga0207652_10004337 3300025921 Bacteria 11559
132 Ga0207694_10000056 3300025924 Bacteria 146908
133 Ga0207650_10078773 3300025925 Bacteria 2494
134 Ga0207659_10000022 3300025926 Bacteria 143432
135 Ga0207687_10000020 3300025927 Bacteria 228407
136 Ga0207687_10000031 3300025927 Bacteria 150246
137 Ga0207687_10000079 3300025927 Bacteria 70683
138 Ga0207687_10004101 3300025927 Bacteria 9763
139 Ga0207700_10000007 3300025928 Bacteria 345720
140 Ga0207700_10062273 3300025928 Bacteria 2833
141 Ga0207664_10021131 3300025929 Bacteria 4835
142 Ga0207690_10003023 3300025932 Bacteria 10121
143 Ga0207690_10019048 3300025932 Bacteria 4217
144 Ga0207706_10000017 3300025933 Bacteria 169589
145 Ga0207686_10000061 3300025934 Bacteria 97978
146 Ga0207686_10000356 3300025934 Bacteria 32614
147 Ga0207686_10006267 3300025934 Bacteria 6398
148 Ga0207709_10020598 3300025935 Bacteria 3723
149 Ga0207670_10063341 3300025936 Bacteria 2530
150 Ga0207669_10000017 3300025937 Bacteria 119878
151 Ga0207669_10000195 3300025937 Bacteria 27661
152 Ga0207704_10000360 3300025938 Bacteria 21224
153 Ga0207665_10101451 3300025939 Bacteria 2009
154 Ga0207691_10000025 3300025940 Bacteria 129424
155 Ga0207711_10000006 3300025941 Bacteria 792692
156 Ga0207661_10002602 3300025944 Bacteria 12416
157 Ga0207661_10013737 3300025944 Bacteria 5914
158 Ga0207661_10099821 3300025944 Unclassified 2435
159 Ga0207661_10148530 3300025944 Bacteria 2024
160 Ga0207661_10157146 3300025944 Bacteria 1970
161 Ga0207679_10082582 3300025945 Bacteria 2461
162 Ga0207651_10002519 3300025960 Bacteria 8744
163 Ga0207712_10000019 3300025961 Bacteria 317060
164 Ga0207712_10026642 3300025961 Bacteria 3854
165 Ga0207712_10044699 3300025961 Bacteria 3062
166 Ga0207668_10006016 3300025972 Bacteria 7154
167 Ga0207668_10039542 3300025972 Bacteria 3176
168 Ga0207640_10000248 3300025981 Bacteria 36585
169 Ga0207640_10017114 3300025981 Bacteria 4234
170 Ga0207658_10003673 3300025986 Bacteria 10820
171 Ga0207658_10082904 3300025986 Bacteria 2463
172 Ga0207658_10091414 3300025986 Bacteria 2361
173 Ga0207677_10000508 3300026023 Bacteria 25092
174 Ga0207677_10000588 3300026023 Bacteria 22552
175 Ga0207703_10000088 3300026035 Bacteria 106080
176 Ga0207703_10000166 3300026035 Bacteria 76553
177 Ga0207703_10079201 3300026035 Bacteria 2733
178 Ga0207639_10053131 3300026041 Bacteria 3090
179 Ga0207639_10128239 3300026041 Bacteria 2096
180 Ga0207678_10005666 3300026067 Bacteria 11162
181 Ga0207678_10173766 3300026067 Bacteria 1839
182 Ga0207678_10288095 3300026067 Bacteria 1410
183 Ga0207702_10000242 3300026078 Bacteria 63808
184 Ga0207702_10009047 3300026078 Bacteria 8385
185 Ga0207702_10020977 3300026078 Bacteria 5406
186 Ga0207641_10000077 3300026088 Bacteria 144978
187 Ga0207648_10002595 3300026089 Bacteria 19350
188 Ga0207676_10000018 3300026095 Bacteria 306375
189 Ga0207674_10336353 3300026116 Bacteria 1460
190 Ga0207683_10001994 3300026121 Bacteria 18063
191 Ga0207698_10000042 3300026142 Bacteria 97349
192 Ga0207698_10059961 3300026142 Bacteria 2957
193 Ga0268266_10000045 3300028379 Bacteria 312955
194 Ga0268266_10001339 3300028379 Bacteria 29819
195 Ga0268266_10014906 3300028379 Bacteria 6675
196 Ga0268266_10016916 3300028379 Bacteria 6231
197 Ga0268264_10008972 3300028381 Bacteria 8298
198 Ga0268264_10129064 3300028381 Bacteria 2238
199 Ga0265337_1003867 3300028556 Bacteria 6357
200 Ga0265326_10000229 3300028558 Bacteria 26997
201 Ga0265319_1000110 3300028563 Bacteria 63277
202 Ga0265322_10000020 3300028654 Bacteria 108805
203 Ga0265338_10000578 3300028800 Bacteria 64450
204 Ga0265324_10000360 3300029957 Bacteria 33003
205 Ga0265324_10059787 3300029957 Bacteria 1303
206 Ga0265328_10062997 3300031239 Bacteria 1362
207 Ga0265320_10000035 3300031240 Bacteria 137855
208 Ga0265331_10003031 3300031250 Bacteria 11023
209 Ga0265327_10000015 3300031251 Bacteria 496677
210 Ga0265314_10002307 3300031711 Bacteria 19713
211 Ga0307415_100000494 3300032126 Bacteria 17107
212 Ga0451853_0309797 3300041512 Bacteria 1846
213 Ga0466963_0000289 3300044694 Bacteria 22666
214 Ga0466957_0020175 3300044842 Bacteria 3921
215 Ga0466967_0000017 3300045976 Bacteria 89904
216 Ga0495592_0000318 3300046454 Bacteria 40338
217 Ga0495592_0086563 3300046454 Bacteria 2256
218 Ga0495603_0000020 3300046455 Bacteria 64469
219 Ga0495603_0000711 3300046455 Bacteria 18835
220 Ga0495603_0020677 3300046455 Bacteria 3986
221 Ga0495629_0003726 3300046459 Bacteria 11487
222 Ga0495629_0015448 3300046459 Bacteria 5482
223 Ga0495629_0021138 3300046459 Plasmid 4644
224 Ga0495641_0000014 3300046461 Bacteria 140908
225 Ga0495641_0017264 3300046461 Bacteria 3765
226 Ga0495641_0025027 3300046461 Bacteria 2934
227 Ga0495651_0063378 3300046462 Bacteria 2826
228 Ga0495651_0146562 3300046462 Bacteria 1706
229 Ga0495653_0049927 3300046463 Bacteria 3220
230 Ga0495653_0228740 3300046463 Bacteria 1246
231 Ga0495582_0000001 3300046473 Bacteria 252434
232 Ga0495662_0001700 3300046476 Bacteria 10995
233 Ga0495662_0004716 3300046476 Bacteria 6828
234 Ga0495594_0000011 3300046499 Bacteria 118444
235 Ga0495606_0000108 3300046507 Bacteria 140473
236 Ga0495608_0000036 3300046511 Bacteria 129609
237 Ga0495608_0000183 3300046511 Bacteria 44585
238 Ga0495608_0003132 3300046511 Bacteria 11815
239 Ga0495608_0069207 3300046511 Bacteria 2306
240 Ga0495618_0000144 3300046514 Bacteria 50904
241 Ga0495620_0000797 3300046515 Bacteria 19341
242 Ga0495628_0001454 3300046516 Bacteria 21724
243 Ga0495628_0001544 3300046516 Bacteria 21069
244 Ga0495628_0017394 3300046516 Bacteria 5988
245 Ga0495628_0021870 3300046516 Bacteria 5257
246 Ga0495628_0046561 3300046516 Bacteria 3444
247 Ga0495630_0000012 3300046517 Bacteria 223330
248 Ga0495630_0000175 3300046517 Bacteria 49924
249 Ga0495630_0000555 3300046517 Bacteria 27256
250 Ga0495630_0095391 3300046517 Unclassified 2249
251 Ga0495632_0043599 3300046519 Bacteria 2241
252 Ga0495644_0000625 3300046523 Bacteria 14803
253 Ga0495652_0000023 3300046529 Bacteria 168049
254 Ga0495640_0043718 3300046533 Bacteria 3118
255 Ga0495640_0045501 3300046533 Bacteria 3045
256 Ga0495586_0048284 3300046535 Bacteria 2299
257 Ga0495598_0022753 3300046537 Bacteria 1680
258 Ga0495645_0025391 3300046543 Bacteria 4299
259 Ga0495645_0036952 3300046543 Bacteria 3559
260 Ga0495622_0000021 3300046557 Bacteria 162267
261 Ga0495667_0000034 3300046559 Bacteria 141464
262 Ga0495656_0001116 3300046615 Bacteria 8735
263 Ga0495634_0000028 3300046642 Bacteria 114075
264 Ga0495634_0002025 3300046642 Bacteria 17228
265 Ga0495634_0098765 3300046642 Bacteria 1888
266 Ga0495625_0000453 3300046660 Bacteria 61379
267 Ga0495635_0000005 3300046663 Bacteria 302178
268 Ga0495635_0098640 3300046663 Bacteria 1997
269 Ga0495635_0144191 3300046663 Bacteria 1622
270 Ga0495588_0000149 3300046674 Bacteria 100598
271 Ga0495657_0000001 3300046675 Bacteria 445641
272 Ga0495657_0002724 3300046675 Bacteria 14752
273 Ga0495599_0007290 3300046678 Bacteria 6698
274 Ga0495647_0000009 3300046681 Bacteria 94874
275 Ga0495647_0000047 3300046681 Bacteria 35186
276 Ga0495658_0000306 3300046683 Bacteria 27840
277 Ga0495658_0001601 3300046683 Bacteria 11790
278 Ga0495669_0000635 3300046684 Bacteria 15272
279 Ga0495613_0000321 3300046689 Bacteria 43464
280 Ga0495613_0000481 3300046689 Bacteria 34000
281 Ga0495613_0036319 3300046689 Bacteria 3654
282 Ga0495613_0066878 3300046689 Unclassified 2623
283 Ga0495624_0000038 3300046690 Bacteria 83368
284 Ga0495624_0000414 3300046690 Bacteria 33832
285 Ga0495624_0005038 3300046690 Bacteria 9563
286 Ga0495670_0012288 3300046691 Bacteria 4208
287 Ga0495649_0001181 3300046694 Bacteria 20231
288 Ga0495600_0037837 3300046809 Bacteria 3138
289 Ga0495600_0214128 3300046809 Bacteria 1234
290 Ga0495604_0000122 3300047317 Bacteria 65938
291 Ga0495604_0000317 3300047317 Bacteria 43411
292 Ga0495604_0017335 3300047317 Bacteria 5764
293 Ga0495604_0055428 3300047317 Bacteria 3055
294 Ga0495674_0000019 3300047319 Bacteria 185107
295 Ga0495676_0002025 3300047321 Bacteria 17856
296 Ga0495676_0002391 3300047321 Bacteria 16661
297 Ga0495676_0087108 3300047321 Bacteria 2348
298 Ga0495680_0000193 3300047322 Bacteria 65567
299 Ga0495680_0005747 3300047322 Bacteria 11610
300 Ga0495680_0039353 3300047322 Bacteria 3773
301 Ga0495680_0058143 3300047322 Bacteria 2989
302 Ga0495680_0152101 3300047322 Bacteria 1686
303 Ga0495675_0000037 3300047444 Bacteria 91283
304 Ga0495679_012527 3300047446 Bacteria 3222
305 Ga0495686_0074785 3300047472 Bacteria 2078
306 Ga0495686_0108144 3300047472 Bacteria 1671
307 Ga0495593_0012869 3300047673 Bacteria 4780
308 Ga0495602_0000166 3300048088 Bacteria 61220
309 Ga0495602_0005378 3300048088 Bacteria 13433
310 Ga0495602_0038462 3300048088 Bacteria 4423
311 Ga0495602_0095387 3300048088 Bacteria 2456
312 Ga0496100_0000005 3300048903 Bacteria 312112
313 Ga0496100_0000014 3300048903 Bacteria 174991
314 Ga0496101_0000022 3300048904 Bacteria 216728
315 Ga0496101_0000036 3300048904 Bacteria 175595
316 Ga0496102_0000081 3300048905 Bacteria 139266
317 Ga0496103_0000031 3300048906 Bacteria 204016
318 Ga0496103_0036386 3300048906 Bacteria 3015
319 Ga0496103_0081446 3300048906 Bacteria 2036
320 Ga0496104_0000024 3300048907 Bacteria 229913
321 Ga0496104_0000077 3300048907 Bacteria 100848
322 Ga0496104_0005387 3300048907 Bacteria 11200
323 Ga0496104_0044152 3300048907 Bacteria 4188
324 Ga0496105_0000004 3300048908 Bacteria 475798
325 Ga0496105_0000013 3300048908 Bacteria 229894
326 Ga0496105_0000098 3300048908 Bacteria 59301
327 Ga0496105_0001296 3300048908 Bacteria 17493
328 Ga0496106_0000043 3300048909 Bacteria 105477
329 Ga0496106_0000087 3300048909 Bacteria 73787
330 Ga0496106_0000213 3300048909 Bacteria 40340
331 Ga0496107_0000022 3300048910 Bacteria 128991
332 Ga0496107_0000046 3300048910 Bacteria 67209
333 Ga0496107_0079494 3300048910 Bacteria 2390
334 Ga0496108_0000005 3300048911 Bacteria 535059
335 Ga0496108_0000006 3300048911 Bacteria 469473
336 Ga0496108_0000365 3300048911 Bacteria 38077
337 Ga0496108_0011523 3300048911 Bacteria 7187
338 Ga0496109_0000004 3300048912 Bacteria 404818
339 Ga0496109_0000095 3300048912 Bacteria 91702
340 Ga0496109_0000174 3300048912 Bacteria 63794
341 Ga0496109_0000628 3300048912 Bacteria 29413
342 Ga0496110_0000011 3300048913 Bacteria 97293
343 Ga0496110_0057974 3300048913 Bacteria 3411
344 Ga0496110_0082715 3300048913 Bacteria 2863
345 Ga0496110_0172628 3300048913 Bacteria 1962
346 Ga0496110_0178352 3300048913 Bacteria 1929
347 Ga0496111_0000170 3300048914 Bacteria 29627
348 Ga0496111_0012939 3300048914 Bacteria 5662
349 Ga0496111_0429560 3300048914 Bacteria 976
350 Ga0496112_0000085 3300048915 Bacteria 61255
351 Ga0496112_0020305 3300048915 Bacteria 6294
352 Ga0496113_0000202 3300048916 Bacteria 27530
353 Ga0496113_0030971 3300048916 Bacteria 3877
354 Ga0496114_0000054 3300048917 Bacteria 98328
355 Ga0496114_0004552 3300048917 Bacteria 10766
356 Ga0496114_0088287 3300048917 Bacteria 2630
357 Ga0496115_0000010 3300048918 Bacteria 227112
358 Ga0496115_0000334 3300048918 Bacteria 40085
359 Ga0496115_0017924 3300048918 Bacteria 5424
360 Ga0496116_0000519 3300048919 Bacteria 51925
361 Ga0496117_0047585 3300048920 Bacteria 3073
362 Ga0496118_0001908 3300048921 Bacteria 29656
363 Ga0496118_0075638 3300048921 Bacteria 2400
364 Ga0496118_0078581 3300048921 Bacteria 2334
365 Ga0496119_0002641 3300048922 Bacteria 19419
366 Ga0496119_0015645 3300048922 Bacteria 5822
367 Ga0496119_0026593 3300048922 Bacteria 4007
368 Ga0496120_0003219 3300048923 Bacteria 15156
369 Ga0496121_0081636 3300048924 Bacteria 2558
370 Ga0496121_0127773 3300048924 Bacteria 1908
371 Ga0496124_0026294 3300048927 Bacteria 5250
372 Ga0496126_0014886 3300048929 Bacteria 7845
373 Ga0496126_0070035 3300048929 Bacteria 3126
374 Ga0496126_0103470 3300048929 Bacteria 2488
375 Ga0501031_0002856 3300049568 Bacteria 11032
376 Ga0501032_0000297 3300049569 Bacteria 41782
377 Ga0501033_0001109 3300049570 Bacteria 24436
378 Ga0501034_0038342 3300049571 Bacteria 4852
379 Ga0501034_0078775 3300049571 Bacteria 3299
380 Ga0501036_0024005 3300049572 Bacteria 5139
381 Ga0501037_0000452 3300049573 Bacteria 33455
382 Ga0501038_0001076 3300049574 Bacteria 24669
383 Ga0501039_0018657 3300049575 Bacteria 5326
384 Ga0501040_0085880 3300049576 Bacteria 2184
385 Ga0501042_0010425 3300049578 Bacteria 6233
386 Ga0501042_0014050 3300049578 Bacteria 5460
387 Ga0501042_0073647 3300049578 Bacteria 2443
388 Ga0501043_0001014 3300049579 Bacteria 24659
389 Ga0501046_0001243 3300049580 Bacteria 24668
390 Ga0501047_0000513 3300049581 Bacteria 41790
391 Ga0501047_0009245 3300049581 Bacteria 9306
392 Ga0501048_0019240 3300049582 Bacteria 5013
393 Ga0501067_0052350 3300049583 Bacteria 2262
394 Ga0501068_0018844 3300049584 Bacteria 3999
395 Ga0501068_0071366 3300049584 Bacteria 2120
396 Ga0501069_0120141 3300049585 Bacteria 1500
397 Ga0501070_0000351 3300049586 Bacteria 41785
398 Ga0501070_0161104 3300049586 Bacteria 1849
399 Ga0501071_0042658 3300049587 Bacteria 3251
400 Ga0501072_0029142 3300049588 Bacteria 4310
401 Ga0501073_0007102 3300049589 Bacteria 8338
402 Ga0501074_0036177 3300049590 Bacteria 3577
403 Ga0501079_0004712 3300049741 Bacteria 10093
404 Ga0501080_0216167 3300049742 Bacteria 1755
405 Ga0501081_0031413 3300049743 Bacteria 3599
406 Ga0501083_0005854 3300049744 Bacteria 8703
407 Ga0501035_0003467 3300049822 Bacteria 15104
408 Ga0501044_0001061 3300049823 Bacteria 33060
409 Ga0501044_0333351 3300049823 Bacteria 1439
410 Ga0501045_0037662 3300049824 Bacteria 3516
411 nmdc:mga06r32_88700_c1 3300050510 Bacteria 3019
412 nmdc:mga0rr50_18549_c1 3300050513 Bacteria 4676
413 nmdc:mga0a205_45_c1 3300050515 Bacteria 68070
414 nmdc:mga0a205_934_c1 3300050515 Bacteria 16438
415 Ga0495601_0000034 3300053077 Bacteria 93719
416 Ga0495601_0000104 3300053077 Bacteria 46045
417 Ga0495601_0011008 3300053077 Bacteria 5404
418 Ga0495612_0000024 3300053078 Bacteria 115718
419 Ga0495612_0003818 3300053078 Bacteria 6261
420 Ga0495655_0000006 3300053083 Bacteria 201200
421 Ga0495595_0000002 3300053084 Bacteria 445641
422 Ga0495595_0000121 3300053084 Bacteria 33439
423 Ga0495595_0002896 3300053084 Bacteria 6763
424 Ga0495619_0000008 3300053085 Bacteria 305999
425 Ga0495619_0000037 3300053085 Bacteria 124007
426 Ga0495619_0000541 3300053085 Bacteria 24974
427 Ga0495619_0000769 3300053085 Bacteria 20942
428 Ga0495619_0001172 3300053085 Bacteria 17234
429 Ga0495619_0002019 3300053085 Bacteria 13492
430 Ga0495619_0002670 3300053085 Bacteria 11667
431 Ga0500566_0000850 3300053094 Bacteria 17428
432 Ga0500641_0028656 3300053096 Bacteria 2176
433 Ga0500614_000259 3300053123 Bacteria 13708
434 Ga0500628_000001 3300053129 Bacteria 564074
435 Ga0500568_0034097 3300053139 Bacteria 2084
436 Ga0501082_0066066 3300060353 Bacteria 3114

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0063378 Ga0495651_0063378_23_952 292
2 3300046463 Ga0495653_0049927 Ga0495653_0049927_25_954 292
3 3300048914 Ga0496111_0429560 Ga0496111_0429560_26_955 292
4 3300005985 Ga0081539_10002638 Ga0081539_1000263812 295
5 3300046459 Ga0495629_0021138 Ga0495629_0021138_3390_4514 295
6 3300053094 Ga0500566_0000850 Ga0500566_0000850_7845_8969 295
7 3300046459 Ga0495629_0015448 Ga0495629_0015448_2367_3503 297
8 3300009176 Ga0105242_10002124 Ga0105242_1000212414 298
9 3300025934 Ga0207686_10000061 Ga0207686_10000061101 298
10 3300048905 Ga0496102_0000081 Ga0496102_0000081_74282_75397 298
11 3300048906 Ga0496103_0000031 Ga0496103_0000031_62947_64062 298
12 3300013104 Ga0157370_10040175 Ga0157370_100401756 306
13 3300006852 Ga0075433_10001612 Ga0075433_100016127 307
14 3300046507 Ga0495606_0000108 Ga0495606_0000108_93585_94670 307
15 3300049743 Ga0501081_0031413 Ga0501081_0031413_1035_2120 307
16 3300050515 nmdc:mga0a205_934_c1 nmdc:mga0a205_934_c1_6173_7255 307
17 3300047322 Ga0495680_0039353 Ga0495680_0039353_1653_2774 308
18 3300048917 Ga0496114_0000054 Ga0496114_0000054_66244_67356 308
19 3300048918 Ga0496115_0000334 Ga0496115_0000334_30973_32085 308
20 3300028379 Ga0268266_10016916 Ga0268266_100169165 309
21 3300046516 Ga0495628_0001454 Ga0495628_0001454_5547_6638 310
22 3300048088 Ga0495602_0005378 Ga0495602_0005378_8938_10029 310
23 3300020070 Ga0206356_11658876 Ga0206356_116588762 320
24 3300005618 Ga0068864_100000015 Ga0068864_100000015244 322
25 3300026095 Ga0207676_10000018 Ga0207676_1000001856 322
26 3300048903 Ga0496100_0000005 Ga0496100_0000005_55379_56542 324
27 3300048904 Ga0496101_0000022 Ga0496101_0000022_185144_186307 324
28 3300048907 Ga0496104_0000077 Ga0496104_0000077_63899_64954 324
29 3300048908 Ga0496105_0000004 Ga0496105_0000004_35895_36950 324
30 3300048909 Ga0496106_0000087 Ga0496106_0000087_59659_60822 324
31 3300048910 Ga0496107_0000046 Ga0496107_0000046_53701_54864 324
32 3300048922 Ga0496119_0026593 Ga0496119_0026593_1849_2904 324
33 3300053083 Ga0495655_0000006 Ga0495655_0000006_175679_176794 324
34 3300053129 Ga0500628_000001 Ga0500628_000001_467507_468622 324
35 3300048915 Ga0496112_0000085 Ga0496112_0000085_56880_57983 326
36 3300048924 Ga0496121_0127773 Ga0496121_0127773_533_1573 326
37 3300053139 Ga0500568_0034097 Ga0500568_0034097_335_1375 326
38 3300048929 Ga0496126_0070035 Ga0496126_0070035_1060_2145 327
39 3300005341 Ga0070691_10000018 Ga0070691_1000001816 328
40 3300005457 Ga0070662_100000006 Ga0070662_100000006119 328
41 3300025933 Ga0207706_10000017 Ga0207706_10000017119 328
42 3300053096 Ga0500641_0028656 Ga0500641_0028656_822_1940 328
43 3300005338 Ga0068868_100000225 Ga0068868_10000022524 330
44 3300005338 Ga0068868_100000520 Ga0068868_10000052017 330
45 3300009176 Ga0105242_10000375 Ga0105242_1000037528 330
46 3300026023 Ga0207677_10000508 Ga0207677_1000050820 330
47 3300026023 Ga0207677_10000588 Ga0207677_100005887 330
48 3300046691 Ga0495670_0012288 Ga0495670_0012288_2972_4102 330
49 3300049586 Ga0501070_0161104 Ga0501070_0161104_203_1303 330
50 3300005366 Ga0070659_100030791 Ga0070659_1000307912 331
51 3300025932 Ga0207690_10019048 Ga0207690_100190484 331
52 3300048911 Ga0496108_0000365 Ga0496108_0000365_10684_11760 331
53 3300048912 Ga0496109_0000174 Ga0496109_0000174_21457_22533 331
54 3300046523 Ga0495644_0000625 Ga0495644_0000625_751_1878 332
55 3300048908 Ga0496105_0001296 Ga0496105_0001296_6336_7457 332
56 3300005439 Ga0070711_100001178 Ga0070711_1000011787 333
57 3300005543 Ga0070672_100000006 Ga0070672_10000000671 333
58 3300005718 Ga0068866_10004889 Ga0068866_100048894 333
59 3300013297 Ga0157378_10007104 Ga0157378_100071042 333
60 3300017792 Ga0163161_10301140 Ga0163161_103011401 333
61 3300025916 Ga0207663_10001389 Ga0207663_100013897 333
62 3300025940 Ga0207691_10000025 Ga0207691_1000002553 333
63 3300048927 Ga0496124_0026294 Ga0496124_0026294_123_1211 333
64 3300047321 Ga0495676_0087108 Ga0495676_0087108_258_1280 334
65 3300002074 JGI24748J21848_1000672 JGI24748J21848_10006724 335
66 3300002239 JGI24034J26672_10000173 JGI24034J26672_100001739 335
67 3300005335 Ga0070666_10084268 Ga0070666_100842681 335
68 3300025903 Ga0207680_10003250 Ga0207680_100032507 335
69 3300028563 Ga0265319_1000110 Ga0265319_10001103 335
70 3300028800 Ga0265338_10000578 Ga0265338_100005784 335
71 3300047472 Ga0495686_0074785 Ga0495686_0074785_225_1319 335
72 3300049578 Ga0501042_0014050 Ga0501042_0014050_1502_2650 335
73 3300001979 JGI24740J21852_10005107 JGI24740J21852_100051073 336
74 3300005365 Ga0070688_100001268 Ga0070688_1000012686 336
75 3300005466 Ga0070685_10001413 Ga0070685_100014138 336
76 3300006846 Ga0075430_100011782 Ga0075430_1000117825 336
77 3300014326 Ga0157380_10000261 Ga0157380_1000026113 336
78 3300046511 Ga0495608_0003132 Ga0495608_0003132_7091_8167 336
79 3300048916 Ga0496113_0030971 Ga0496113_0030971_2701_3810 336
80 3300048929 Ga0496126_0103470 Ga0496126_0103470_1169_2257 336
81 3300049588 Ga0501072_0029142 Ga0501072_0029142_750_1820 336
82 3300005329 Ga0070683_100005906 Ga0070683_1000059063 337
83 3300005341 Ga0070691_10018518 Ga0070691_100185182 337
84 3300005344 Ga0070661_100000035 Ga0070661_10000003558 337
85 3300005535 Ga0070684_100054366 Ga0070684_1000543662 337
86 3300005535 Ga0070684_100145570 Ga0070684_1001455701 337
87 3300006173 Ga0070716_100077104 Ga0070716_1000771042 337
88 3300006175 Ga0070712_100000353 Ga0070712_10000035312 337
89 3300013308 Ga0157375_10003947 Ga0157375_1000394710 337
90 3300025915 Ga0207693_10006121 Ga0207693_100061217 337
91 3300025920 Ga0207649_10000028 Ga0207649_10000028104 337
92 3300025939 Ga0207665_10101451 Ga0207665_101014512 337
93 3300025944 Ga0207661_10157146 Ga0207661_101571462 337
94 3300026116 Ga0207674_10336353 Ga0207674_103363531 337
95 3300046455 Ga0495603_0000020 Ga0495603_0000020_152_1243 337
96 3300046516 Ga0495628_0021870 Ga0495628_0021870_2770_3843 337
97 3300046533 Ga0495640_0045501 Ga0495640_0045501_1951_3024 337
98 3300046615 Ga0495656_0001116 Ga0495656_0001116_173_1249 337
99 3300046689 Ga0495613_0066878 Ga0495613_0066878_552_1634 337
100 3300046809 Ga0495600_0214128 Ga0495600_0214128_84_1157 337
101 3300048913 Ga0496110_0082715 Ga0496110_0082715_184_1257 337
102 3300048914 Ga0496111_0012939 Ga0496111_0012939_234_1307 337
103 3300048918 Ga0496115_0017924 Ga0496115_0017924_1899_3002 337
104 3300053078 Ga0495612_0000024 Ga0495612_0000024_108160_109233 337
105 3300053085 Ga0495619_0002019 Ga0495619_0002019_123_1205 337
106 3300005329 Ga0070683_100027390 Ga0070683_1000273905 338
107 3300005337 Ga0070682_100000171 Ga0070682_10000017143 338
108 3300005356 Ga0070674_100000004 Ga0070674_100000004115 338
109 3300005356 Ga0070674_100000012 Ga0070674_10000001274 338
110 3300005459 Ga0068867_100000295 Ga0068867_10000029511 338
111 3300005535 Ga0070684_100003342 Ga0070684_10000334218 338
112 3300005548 Ga0070665_100046548 Ga0070665_1000465483 338
113 3300005578 Ga0068854_100000237 Ga0068854_10000023723 338
114 3300005718 Ga0068866_10000004 Ga0068866_10000004152 338
115 3300005718 Ga0068866_10001671 Ga0068866_100016716 338
116 3300005834 Ga0068851_10001578 Ga0068851_1000157811 338
117 3300005843 Ga0068860_100014544 Ga0068860_1000145441 338
118 3300006163 Ga0070715_10000014 Ga0070715_10000014113 338
119 3300006881 Ga0068865_100000140 Ga0068865_1000001403 338
120 3300009098 Ga0105245_10007310 Ga0105245_100073104 338
121 3300009101 Ga0105247_10000955 Ga0105247_100009556 338
122 3300013297 Ga0157378_10151852 Ga0157378_101518522 338
123 3300013307 Ga0157372_10004870 Ga0157372_100048708 338
124 3300025321 Ga0207656_10002200 Ga0207656_100022008 338
125 3300025899 Ga0207642_10000005 Ga0207642_1000000555 338
126 3300025899 Ga0207642_10000872 Ga0207642_100008726 338
127 3300025900 Ga0207710_10000543 Ga0207710_100005439 338
128 3300025905 Ga0207685_10000025 Ga0207685_1000002553 338
129 3300025927 Ga0207687_10004101 Ga0207687_100041017 338
130 3300025934 Ga0207686_10006267 Ga0207686_100062675 338
131 3300025935 Ga0207709_10020598 Ga0207709_100205983 338
132 3300025937 Ga0207669_10000017 Ga0207669_1000001759 338
133 3300025937 Ga0207669_10000195 Ga0207669_1000019523 338
134 3300025938 Ga0207704_10000360 Ga0207704_1000036019 338
135 3300025944 Ga0207661_10099821 Ga0207661_100998212 338
136 3300025972 Ga0207668_10039542 Ga0207668_100395422 338
137 3300025981 Ga0207640_10000248 Ga0207640_100002487 338
138 3300026067 Ga0207678_10288095 Ga0207678_102880952 338
139 3300026089 Ga0207648_10002595 Ga0207648_1000259513 338
140 3300028379 Ga0268266_10014906 Ga0268266_100149068 338
141 3300028381 Ga0268264_10008972 Ga0268264_100089726 338
142 3300032126 Ga0307415_100000494 Ga0307415_1000004946 338
143 3300044842 Ga0466957_0020175 Ga0466957_0020175_628_1710 338
144 3300045976 Ga0466967_0000017 Ga0466967_0000017_40590_41672 338
145 3300046473 Ga0495582_0000001 Ga0495582_0000001_242715_243827 338
146 3300046476 Ga0495662_0001700 Ga0495662_0001700_2446_3531 338
147 3300046660 Ga0495625_0000453 Ga0495625_0000453_13588_14727 338
148 3300046683 Ga0495658_0000306 Ga0495658_0000306_8595_9707 338
149 3300048911 Ga0496108_0011523 Ga0496108_0011523_3047_4135 338
150 3300048912 Ga0496109_0000628 Ga0496109_0000628_28201_29283 338
151 3300048913 Ga0496110_0000011 Ga0496110_0000011_61500_62582 338
152 3300048914 Ga0496111_0000170 Ga0496111_0000170_24835_25917 338
153 3300048915 Ga0496112_0020305 Ga0496112_0020305_2789_3871 338
154 3300048916 Ga0496113_0000202 Ga0496113_0000202_23850_24932 338
155 3300053085 Ga0495619_0000037 Ga0495619_0000037_22204_23286 338
156 3300053085 Ga0495619_0001172 Ga0495619_0001172_15308_16420 338
157 3300005333 Ga0070677_10000868 Ga0070677_100008683 339
158 3300005337 Ga0070682_100067812 Ga0070682_1000678123 339
159 3300005340 Ga0070689_100058585 Ga0070689_1000585851 339
160 3300005354 Ga0070675_100000370 Ga0070675_1000003706 339
161 3300005365 Ga0070688_100008127 Ga0070688_1000081275 339
162 3300005366 Ga0070659_100005337 Ga0070659_1000053375 339
163 3300005436 Ga0070713_100000010 Ga0070713_1000000106 339
164 3300005436 Ga0070713_100025217 Ga0070713_1000252175 339
165 3300005455 Ga0070663_100000956 Ga0070663_1000009569 339
166 3300005456 Ga0070678_100000345 Ga0070678_1000003458 339
167 3300005466 Ga0070685_10001687 Ga0070685_100016876 339
168 3300005530 Ga0070679_100001408 Ga0070679_1000014084 339
169 3300005535 Ga0070684_100047427 Ga0070684_1000474272 339
170 3300005539 Ga0068853_100265224 Ga0068853_1002652242 339
171 3300005545 Ga0070695_100210940 Ga0070695_1002109401 339
172 3300005548 Ga0070665_100008395 Ga0070665_1000083954 339
173 3300005614 Ga0068856_100008825 Ga0068856_1000088259 339
174 3300005614 Ga0068856_100205891 Ga0068856_1002058913 339
175 3300005616 Ga0068852_100000170 Ga0068852_10000017033 339
176 3300005834 Ga0068851_10009301 Ga0068851_100093012 339
177 3300005841 Ga0068863_100000107 Ga0068863_10000010746 339
178 3300005841 Ga0068863_100124472 Ga0068863_1001244722 339
179 3300005842 Ga0068858_100194838 Ga0068858_1001948382 339
180 3300005843 Ga0068860_100276950 Ga0068860_1002769502 339
181 3300005844 Ga0068862_100033642 Ga0068862_1000336424 339
182 3300005937 Ga0081455_10007388 Ga0081455_100073884 339
183 3300005985 Ga0081539_10023698 Ga0081539_100236984 339
184 3300007076 Ga0075435_100058432 Ga0075435_1000584322 339
185 3300009098 Ga0105245_10000116 Ga0105245_1000011620 339
186 3300009098 Ga0105245_10000212 Ga0105245_100002128 339
187 3300009177 Ga0105248_10000008 Ga0105248_1000000831 339
188 3300009551 Ga0105238_10000048 Ga0105238_1000004888 339
189 3300009553 Ga0105249_10000070 Ga0105249_1000007063 339
190 3300009553 Ga0105249_10004349 Ga0105249_100043498 339
191 3300013102 Ga0157371_10005511 Ga0157371_100055113 339
192 3300013105 Ga0157369_10000078 Ga0157369_1000007882 339
193 3300013297 Ga0157378_10086456 Ga0157378_100864562 339
194 3300013306 Ga0163162_10089692 Ga0163162_100896922 339
195 3300013308 Ga0157375_10214789 Ga0157375_102147891 339
196 3300014325 Ga0163163_10390863 Ga0163163_103908632 339
197 3300014326 Ga0157380_10000149 Ga0157380_1000014935 339
198 3300014326 Ga0157380_10086326 Ga0157380_100863262 339
199 3300014968 Ga0157379_10007056 Ga0157379_100070569 339
200 3300014968 Ga0157379_10036079 Ga0157379_100360794 339
201 3300014969 Ga0157376_10011312 Ga0157376_100113123 339
202 3300025321 Ga0207656_10005231 Ga0207656_100052312 339
203 3300025893 Ga0207682_10000180 Ga0207682_100001808 339
204 3300025921 Ga0207652_10004337 Ga0207652_1000433712 339
205 3300025924 Ga0207694_10000056 Ga0207694_1000005688 339
206 3300025925 Ga0207650_10078773 Ga0207650_100787733 339
207 3300025926 Ga0207659_10000022 Ga0207659_10000022125 339
208 3300025927 Ga0207687_10000020 Ga0207687_1000002061 339
209 3300025927 Ga0207687_10000031 Ga0207687_1000003199 339
210 3300025928 Ga0207700_10000007 Ga0207700_10000007207 339
211 3300025928 Ga0207700_10062273 Ga0207700_100622734 339
212 3300025932 Ga0207690_10003023 Ga0207690_100030233 339
213 3300025934 Ga0207686_10000356 Ga0207686_100003566 339
214 3300025936 Ga0207670_10063341 Ga0207670_100633411 339
215 3300025941 Ga0207711_10000006 Ga0207711_10000006428 339
216 3300025944 Ga0207661_10002602 Ga0207661_100026026 339
217 3300025944 Ga0207661_10148530 Ga0207661_101485302 339
218 3300025961 Ga0207712_10000019 Ga0207712_10000019248 339
219 3300025961 Ga0207712_10026642 Ga0207712_100266422 339
220 3300025972 Ga0207668_10006016 Ga0207668_100060165 339
221 3300025981 Ga0207640_10017114 Ga0207640_100171142 339
222 3300025986 Ga0207658_10003673 Ga0207658_100036734 339
223 3300025986 Ga0207658_10091414 Ga0207658_100914142 339
224 3300026035 Ga0207703_10079201 Ga0207703_100792012 339
225 3300026041 Ga0207639_10128239 Ga0207639_101282392 339
226 3300026067 Ga0207678_10005666 Ga0207678_100056664 339
227 3300026067 Ga0207678_10173766 Ga0207678_101737662 339
228 3300026078 Ga0207702_10000242 Ga0207702_100002424 339
229 3300026078 Ga0207702_10009047 Ga0207702_100090478 339
230 3300026088 Ga0207641_10000077 Ga0207641_1000007773 339
231 3300026121 Ga0207683_10001994 Ga0207683_1000199414 339
232 3300026142 Ga0207698_10000042 Ga0207698_1000004265 339
233 3300026142 Ga0207698_10059961 Ga0207698_100599612 339
234 3300028379 Ga0268266_10001339 Ga0268266_1000133927 339
235 3300028381 Ga0268264_10129064 Ga0268264_101290642 339
236 3300044694 Ga0466963_0000289 Ga0466963_0000289_9069_10151 339
237 3300046455 Ga0495603_0020677 Ga0495603_0020677_1298_2404 339
238 3300046459 Ga0495629_0003726 Ga0495629_0003726_2398_3483 339
239 3300046461 Ga0495641_0000014 Ga0495641_0000014_116806_117885 339
240 3300046461 Ga0495641_0017264 Ga0495641_0017264_2373_3458 339
241 3300046463 Ga0495653_0228740 Ga0495653_0228740_64_1143 339
242 3300046511 Ga0495608_0000036 Ga0495608_0000036_70515_71600 339
243 3300046511 Ga0495608_0069207 Ga0495608_0069207_953_2032 339
244 3300046517 Ga0495630_0000012 Ga0495630_0000012_179121_180206 339
245 3300046674 Ga0495588_0000149 Ga0495588_0000149_18386_19471 339
246 3300046675 Ga0495657_0000001 Ga0495657_0000001_70515_71600 339
247 3300046681 Ga0495647_0000047 Ga0495647_0000047_23240_24325 339
248 3300046683 Ga0495658_0001601 Ga0495658_0001601_6647_7732 339
249 3300046684 Ga0495669_0000635 Ga0495669_0000635_4954_6033 339
250 3300046689 Ga0495613_0000481 Ga0495613_0000481_8002_9087 339
251 3300046690 Ga0495624_0000038 Ga0495624_0000038_66816_67901 339
252 3300046809 Ga0495600_0037837 Ga0495600_0037837_922_2007 339
253 3300047317 Ga0495604_0000122 Ga0495604_0000122_58504_59589 339
254 3300047317 Ga0495604_0017335 Ga0495604_0017335_578_1663 339
255 3300047317 Ga0495604_0055428 Ga0495604_0055428_1500_2579 339
256 3300047444 Ga0495675_0000037 Ga0495675_0000037_57329_58414 339
257 3300047673 Ga0495593_0012869 Ga0495593_0012869_2384_3466 339
258 3300048088 Ga0495602_0000166 Ga0495602_0000166_57710_58795 339
259 3300048088 Ga0495602_0038462 Ga0495602_0038462_1642_2718 339
260 3300048088 Ga0495602_0095387 Ga0495602_0095387_338_1423 339
261 3300048903 Ga0496100_0000014 Ga0496100_0000014_64764_65843 339
262 3300048904 Ga0496101_0000036 Ga0496101_0000036_65368_66447 339
263 3300048907 Ga0496104_0000024 Ga0496104_0000024_64272_65351 339
264 3300048907 Ga0496104_0044152 Ga0496104_0044152_462_1547 339
265 3300048908 Ga0496105_0000013 Ga0496105_0000013_164563_165642 339
266 3300048909 Ga0496106_0000043 Ga0496106_0000043_43588_44667 339
267 3300048909 Ga0496106_0000213 Ga0496106_0000213_39230_40306 339
268 3300048910 Ga0496107_0000022 Ga0496107_0000022_18764_19843 339
269 3300048910 Ga0496107_0079494 Ga0496107_0079494_166_1242 339
270 3300048911 Ga0496108_0000005 Ga0496108_0000005_18613_19698 339
271 3300048911 Ga0496108_0000006 Ga0496108_0000006_168392_169471 339
272 3300048912 Ga0496109_0000004 Ga0496109_0000004_341135_342214 339
273 3300048912 Ga0496109_0000095 Ga0496109_0000095_18559_19644 339
274 3300048913 Ga0496110_0057974 Ga0496110_0057974_155_1240 339
275 3300048929 Ga0496126_0014886 Ga0496126_0014886_5011_6096 339
276 3300049584 Ga0501068_0071366 Ga0501068_0071366_500_1585 339
277 3300050513 nmdc:mga0rr50_18549_c1 nmdc:mga0rr50_18549_c1_2473_3552 339
278 3300053077 Ga0495601_0000034 Ga0495601_0000034_25320_26405 339
279 3300053084 Ga0495595_0000002 Ga0495595_0000002_374042_375127 339
280 3300053084 Ga0495595_0002896 Ga0495595_0002896_3593_4678 339
281 3300053085 Ga0495619_0000541 Ga0495619_0000541_2478_3563 339
282 3300053123 Ga0500614_000259 Ga0500614_000259_655_1734 339
283 3300005337 Ga0070682_100000030 Ga0070682_100000030116 340
284 3300005530 Ga0070679_100000225 Ga0070679_10000022524 340
285 3300005539 Ga0068853_100024630 Ga0068853_1000246304 340
286 3300005548 Ga0070665_100000040 Ga0070665_10000004061 340
287 3300005614 Ga0068856_100029013 Ga0068856_1000290132 340
288 3300005842 Ga0068858_100000075 Ga0068858_10000007545 340
289 3300005842 Ga0068858_100000319 Ga0068858_10000031917 340
290 3300005937 Ga0081455_10140326 Ga0081455_101403261 340
291 3300006847 Ga0075431_100077064 Ga0075431_1000770641 340
292 3300009098 Ga0105245_10001002 Ga0105245_100010025 340
293 3300009553 Ga0105249_10046590 Ga0105249_100465902 340
294 3300010375 Ga0105239_10115492 Ga0105239_101154923 340
295 3300013104 Ga0157370_10107046 Ga0157370_101070464 340
296 3300013296 Ga0157374_10000686 Ga0157374_100006867 340
297 3300013308 Ga0157375_10000130 Ga0157375_1000013015 340
298 3300025917 Ga0207660_10039147 Ga0207660_100391473 340
299 3300025921 Ga0207652_10000309 Ga0207652_1000030929 340
300 3300025927 Ga0207687_10000079 Ga0207687_1000007966 340
301 3300025944 Ga0207661_10013737 Ga0207661_100137374 340
302 3300025961 Ga0207712_10044699 Ga0207712_100446991 340
303 3300026035 Ga0207703_10000088 Ga0207703_1000008845 340
304 3300026035 Ga0207703_10000166 Ga0207703_1000016617 340
305 3300026041 Ga0207639_10053131 Ga0207639_100531313 340
306 3300026078 Ga0207702_10020977 Ga0207702_100209776 340
307 3300028379 Ga0268266_10000045 Ga0268266_1000004564 340
308 3300028556 Ga0265337_1003867 Ga0265337_10038671 340
309 3300028558 Ga0265326_10000229 Ga0265326_1000022914 340
310 3300028654 Ga0265322_10000020 Ga0265322_1000002065 340
311 3300029957 Ga0265324_10000360 Ga0265324_1000036019 340
312 3300029957 Ga0265324_10059787 Ga0265324_100597872 340
313 3300031239 Ga0265328_10062997 Ga0265328_100629971 340
314 3300031240 Ga0265320_10000035 Ga0265320_1000003565 340
315 3300031250 Ga0265331_10003031 Ga0265331_100030314 340
316 3300031251 Ga0265327_10000015 Ga0265327_10000015433 340
317 3300031711 Ga0265314_10002307 Ga0265314_1000230719 340
318 3300041512 Ga0451853_0309797 Ga0451853_0309797_75_1154 340
319 3300046454 Ga0495592_0086563 Ga0495592_0086563_429_1517 340
320 3300046462 Ga0495651_0146562 Ga0495651_0146562_24_1100 340
321 3300046499 Ga0495594_0000011 Ga0495594_0000011_3833_4927 340
322 3300046515 Ga0495620_0000797 Ga0495620_0000797_4946_6028 340
323 3300046516 Ga0495628_0046561 Ga0495628_0046561_2218_3294 340
324 3300046519 Ga0495632_0043599 Ga0495632_0043599_66_1169 340
325 3300046529 Ga0495652_0000023 Ga0495652_0000023_102558_103646 340
326 3300046557 Ga0495622_0000021 Ga0495622_0000021_68635_69729 340
327 3300046642 Ga0495634_0000028 Ga0495634_0000028_53785_54867 340
328 3300046678 Ga0495599_0007290 Ga0495599_0007290_4408_5490 340
329 3300046681 Ga0495647_0000009 Ga0495647_0000009_24383_25465 340
330 3300046689 Ga0495613_0036319 Ga0495613_0036319_77_1159 340
331 3300046690 Ga0495624_0000414 Ga0495624_0000414_27793_28875 340
332 3300046694 Ga0495649_0001181 Ga0495649_0001181_14077_15159 340
333 3300047321 Ga0495676_0002391 Ga0495676_0002391_5883_6965 340
334 3300047322 Ga0495680_0005747 Ga0495680_0005747_1655_2737 340
335 3300047446 Ga0495679_012527 Ga0495679_012527_1549_2631 340
336 3300047472 Ga0495686_0108144 Ga0495686_0108144_394_1494 340
337 3300048906 Ga0496103_0081446 Ga0496103_0081446_831_1934 340
338 3300048917 Ga0496114_0004552 Ga0496114_0004552_5409_6491 340
339 3300048919 Ga0496116_0000519 Ga0496116_0000519_27433_28536 340
340 3300048920 Ga0496117_0047585 Ga0496117_0047585_1707_2810 340
341 3300048921 Ga0496118_0001908 Ga0496118_0001908_9884_10987 340
342 3300048921 Ga0496118_0075638 Ga0496118_0075638_532_1623 340
343 3300048921 Ga0496118_0078581 Ga0496118_0078581_130_1233 340
344 3300048922 Ga0496119_0002641 Ga0496119_0002641_12655_13758 340
345 3300048922 Ga0496119_0015645 Ga0496119_0015645_3595_4683 340
346 3300048923 Ga0496120_0003219 Ga0496120_0003219_8203_9294 340
347 3300048924 Ga0496121_0081636 Ga0496121_0081636_1299_2390 340
348 3300049568 Ga0501031_0002856 Ga0501031_0002856_9594_10682 340
349 3300049569 Ga0501032_0000297 Ga0501032_0000297_40344_41432 340
350 3300049570 Ga0501033_0001109 Ga0501033_0001109_23000_24088 340
351 3300049571 Ga0501034_0038342 Ga0501034_0038342_349_1437 340
352 3300049571 Ga0501034_0078775 Ga0501034_0078775_971_2059 340
353 3300049572 Ga0501036_0024005 Ga0501036_0024005_321_1409 340
354 3300049573 Ga0501037_0000452 Ga0501037_0000452_349_1437 340
355 3300049574 Ga0501038_0001076 Ga0501038_0001076_351_1439 340
356 3300049575 Ga0501039_0018657 Ga0501039_0018657_1695_2783 340
357 3300049576 Ga0501040_0085880 Ga0501040_0085880_970_2058 340
358 3300049578 Ga0501042_0010425 Ga0501042_0010425_1968_3062 340
359 3300049578 Ga0501042_0073647 Ga0501042_0073647_1068_2156 340
360 3300049579 Ga0501043_0001014 Ga0501043_0001014_349_1437 340
361 3300049580 Ga0501046_0001243 Ga0501046_0001243_351_1439 340
362 3300049581 Ga0501047_0000513 Ga0501047_0000513_351_1439 340
363 3300049581 Ga0501047_0009245 Ga0501047_0009245_2454_3554 340
364 3300049582 Ga0501048_0019240 Ga0501048_0019240_1680_2768 340
365 3300049583 Ga0501067_0052350 Ga0501067_0052350_1066_2154 340
366 3300049584 Ga0501068_0018844 Ga0501068_0018844_323_1411 340
367 3300049585 Ga0501069_0120141 Ga0501069_0120141_44_1132 340
368 3300049586 Ga0501070_0000351 Ga0501070_0000351_40349_41437 340
369 3300049587 Ga0501071_0042658 Ga0501071_0042658_377_1465 340
370 3300049589 Ga0501073_0007102 Ga0501073_0007102_331_1419 340
371 3300049590 Ga0501074_0036177 Ga0501074_0036177_92_1180 340
372 3300049741 Ga0501079_0004712 Ga0501079_0004712_1816_2904 340
373 3300049742 Ga0501080_0216167 Ga0501080_0216167_639_1727 340
374 3300049744 Ga0501083_0005854 Ga0501083_0005854_335_1423 340
375 3300049822 Ga0501035_0003467 Ga0501035_0003467_13668_14756 340
376 3300049823 Ga0501044_0001061 Ga0501044_0001061_31624_32712 340
377 3300049823 Ga0501044_0333351 Ga0501044_0333351_60_1148 340
378 3300049824 Ga0501045_0037662 Ga0501045_0037662_1823_2911 340
379 3300053077 Ga0495601_0000104 Ga0495601_0000104_8819_9901 340
380 3300053078 Ga0495612_0003818 Ga0495612_0003818_954_2036 340
381 3300053085 Ga0495619_0000008 Ga0495619_0000008_237334_238410 340
382 3300060353 Ga0501082_0066066 Ga0501082_0066066_1682_2770 340
383 3300003659 JGI25404J52841_10010398 JGI25404J52841_100103981 341
384 3300005364 Ga0070673_100005029 Ga0070673_1000050294 341
385 3300005435 Ga0070714_100032012 Ga0070714_1000320122 341
386 3300005983 Ga0081540_1000063 Ga0081540_100006331 341
387 3300006852 Ga0075433_10001022 Ga0075433_100010229 341
388 3300025929 Ga0207664_10021131 Ga0207664_100211312 341
389 3300025945 Ga0207679_10082582 Ga0207679_100825822 341
390 3300025960 Ga0207651_10002519 Ga0207651_100025194 341
391 3300025986 Ga0207658_10082904 Ga0207658_100829042 341
392 3300046454 Ga0495592_0000318 Ga0495592_0000318_14946_16031 341
393 3300046455 Ga0495603_0000711 Ga0495603_0000711_7421_8530 341
394 3300046461 Ga0495641_0025027 Ga0495641_0025027_817_1896 341
395 3300046476 Ga0495662_0004716 Ga0495662_0004716_5636_6721 341
396 3300046511 Ga0495608_0000183 Ga0495608_0000183_26458_27570 341
397 3300046514 Ga0495618_0000144 Ga0495618_0000144_46922_48007 341
398 3300046516 Ga0495628_0001544 Ga0495628_0001544_5988_7073 341
399 3300046516 Ga0495628_0017394 Ga0495628_0017394_2468_3580 341
400 3300046517 Ga0495630_0000175 Ga0495630_0000175_24079_25161 341
401 3300046517 Ga0495630_0000555 Ga0495630_0000555_15023_16108 341
402 3300046517 Ga0495630_0095391 Ga0495630_0095391_683_1765 341
403 3300046533 Ga0495640_0043718 Ga0495640_0043718_240_1325 341
404 3300046535 Ga0495586_0048284 Ga0495586_0048284_599_1687 341
405 3300046537 Ga0495598_0022753 Ga0495598_0022753_480_1580 341
406 3300046543 Ga0495645_0025391 Ga0495645_0025391_1295_2377 341
407 3300046543 Ga0495645_0036952 Ga0495645_0036952_2315_3400 341
408 3300046559 Ga0495667_0000034 Ga0495667_0000034_76547_77638 341
409 3300046642 Ga0495634_0002025 Ga0495634_0002025_12886_13968 341
410 3300046642 Ga0495634_0098765 Ga0495634_0098765_265_1344 341
411 3300046663 Ga0495635_0000005 Ga0495635_0000005_244935_246020 341
412 3300046663 Ga0495635_0098640 Ga0495635_0098640_474_1556 341
413 3300046663 Ga0495635_0144191 Ga0495635_0144191_341_1423 341
414 3300046675 Ga0495657_0002724 Ga0495657_0002724_12099_13211 341
415 3300046689 Ga0495613_0000321 Ga0495613_0000321_11889_13001 341
416 3300046690 Ga0495624_0005038 Ga0495624_0005038_432_1544 341
417 3300047317 Ga0495604_0000317 Ga0495604_0000317_34683_35768 341
418 3300047319 Ga0495674_0000019 Ga0495674_0000019_150197_151291 341
419 3300047321 Ga0495676_0002025 Ga0495676_0002025_12385_13548 341
420 3300047322 Ga0495680_0000193 Ga0495680_0000193_55655_56767 341
421 3300047322 Ga0495680_0058143 Ga0495680_0058143_1372_2457 341
422 3300047322 Ga0495680_0152101 Ga0495680_0152101_312_1403 341
423 3300048906 Ga0496103_0036386 Ga0496103_0036386_1846_2940 341
424 3300048907 Ga0496104_0005387 Ga0496104_0005387_4617_5717 341
425 3300048908 Ga0496105_0000098 Ga0496105_0000098_6391_7491 341
426 3300048913 Ga0496110_0172628 Ga0496110_0172628_50_1129 341
427 3300048917 Ga0496114_0088287 Ga0496114_0088287_148_1239 341
428 3300048918 Ga0496115_0000010 Ga0496115_0000010_170576_171667 341
429 3300050515 nmdc:mga0a205_45_c1 nmdc:mga0a205_45_c1_57081_58163 341
430 3300053077 Ga0495601_0011008 Ga0495601_0011008_2315_3397 341
431 3300053084 Ga0495595_0000121 Ga0495595_0000121_7624_8736 341
432 3300053085 Ga0495619_0000769 Ga0495619_0000769_18837_19919 341
433 3300053085 Ga0495619_0002670 Ga0495619_0002670_5411_6493 341
434 3300001977 JGI24746J21847_1000221 JGI24746J21847_10002212 343
435 3300048913 Ga0496110_0178352 Ga0496110_0178352_810_1901 343
436 3300050510 nmdc:mga06r32_88700_c1 nmdc:mga06r32_88700_c1_94_1185 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

311

367

0.97

PF08668

HDOD

HDOD domain

79

247

0.95

PF01966

HD

HD domain

147

281

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3clo-assembly2.cif.gz_C-2 crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9704 283 324
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9687 283 324
6zj2-assembly3.cif.gz_L structure of rcsb from salmonella enterica serovar typhimurium bound to promoter rpra in the presence of phosphomimetic bef3- 0.9432 283 326
8hno-assembly1.cif.gz_B archaeal transcription factor wild type 0.9423 283 334
5f64-assembly2.cif.gz_C putative positive transcription regulator (sensor evgs) from shigella flexneri 0.9388 282 326
ID Description Score Start End Superfamily
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9647 283 326 1.10.10.10
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9524 282 326 1.10.10.10
3p7nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9454 283 326 1.10.10.10
af_Q2G2N6_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9248 284 328 1.10.10.10
5f64B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9241 282 326 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1D8K9J0-F1-model_v4 HDOD domain-containing protein 0.7975 124 266
AF-A0A354A4L1-F1-model_v4 HDOD domain-containing protein 0.7722 115 267
AF-A0A351BLY0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.7647 104 265 GO:0000155
AF-A0A838JK57-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.7536 108 267 GO:0000155
AF-A0A3D3NJC7-F1-model_v4 Histidine kinase 0.7533 107 279 GO:0016301

Feature Viewer

pLDDT pTM Quality
68.55 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map