F443444

General Info

Members Datasets Scaffolds Average Seq Length
435 318 288 208

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8018127388|8018129302
Length 231
Sequence NSAQAKVRTERPCSRTAVVQVQGSDSVLAMAAKKIMIVGNGSVDRQHVAAIDAADLVVRFNDCRSTSTSGMRTDVVAVCNTGRPARSMLGSDTWSMHPAVAAASEIWCVRDPKRFAAMKRLLAVVHPELDDFCDDGTQGFEQFCCLSGKRCLVISEATHDRVDDALREFNPAPYIVPSSGMIVIASVLDMFATDEITIAGFGHQGWEHHPFAAERRLVDHYVAQGRLSRLS

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
11 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
12 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
13 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
14 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
15 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
16 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
17 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
18 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
19 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
20 2519899620 Rhizobium sp. Pop5 Isolate Nodule
21 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
22 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
23 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
24 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
25 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
26 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
27 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
28 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
29 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
30 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
31 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
32 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
33 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
34 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
35 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
36 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
37 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
38 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
39 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
40 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
41 2718217927 Rhizobium sp. N324 Isolate Nodule
42 2718218423 Rhizobium sp. N941 Isolate Nodule
43 2721755809 Rhizobium sp. N541 Isolate Nodule
44 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
45 2738541293 Rhizobium sp. GV031 Isolate Unclassified
46 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
47 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
48 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
49 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
50 2791355256 Rhizobium sp. M10 Isolate Nodule
51 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
52 2791355260 Rhizobium sp. L9 Isolate Nodule
53 2791355261 Rhizobium sp. J15 Isolate Nodule
54 2791355262 Rhizobium sp. M1 Isolate Nodule
55 2791355263 Rhizobium chutanense C5 Isolate Nodule
56 2791355265 Rhizobium sp. H4 Isolate Nodule
57 2791355267 Rhizobium sp. L18 Isolate Nodule
58 2802429633 Rhizobium anhuiense J3 Isolate Nodule
59 2802429634 Rhizobium anhuiense S10 Isolate Nodule
60 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
61 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
62 2802429637 Rhizobium anhuiense C15 Isolate Nodule
63 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
64 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
65 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
66 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
67 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
68 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
69 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
70 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
71 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
72 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
73 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
74 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
75 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
76 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
77 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
78 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
79 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
80 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
81 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
82 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
83 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
84 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
85 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
86 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
87 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
88 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
89 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
90 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
91 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
92 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
93 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
94 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
95 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
96 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
97 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
98 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
99 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
100 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
101 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
102 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
103 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
104 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
105 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
106 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
107 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
108 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
109 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
110 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
111 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
112 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
113 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
114 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
115 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
116 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
117 2933599457 Rhizobium phaseoli M3 Isolate Nodule
118 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
119 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
120 2996893221 Rhizobium sp. R635 Isolate Nodule
121 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
122 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
123 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
124 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
125 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
126 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
127 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
128 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
129 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
130 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
131 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
132 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
133 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
134 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
135 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
136 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
137 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
138 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
139 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
140 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
141 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
142 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
143 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
144 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
145 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
146 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
147 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
148 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
149 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
150 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
151 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
152 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
153 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
158 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
161 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
162 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
166 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
178 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
179 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
213 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
214 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
217 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
218 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
219 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
220 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
221 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
293 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
296 8005275841 Rhizobium sp. N4311 Isolate Nodule
297 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
298 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
299 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
300 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
301 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
302 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
303 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
304 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
305 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
306 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
307 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
308 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
309 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
310 8018176218 Rhizobium sp. N122 Isolate Nodule
311 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
312 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
313 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
314 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
315 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
316 8056382006 Rhizobium croatiense 13T Isolate Nodule
317 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
318 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.98
Metatranscriptomes 0.23
Isolates 33.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.67
Nodule 26.9
Rhizoplane 2.3
Rhizosphere 24.14
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000066 3300002704 Bacteria 69429
2 JGI25156J39149_1000075 3300002705 Bacteria 76505
3 JGI25162J39368_1000149 3300002737 Bacteria 76227
4 JGI25162J39368_1000211 3300002737 Bacteria 61063
5 JGI25154J39366_1000075 3300002738 Bacteria 91249
6 JGI25158J39367_1000025 3300002739 Bacteria 34914
7 JGI25157J39369_1000051 3300002741 Bacteria 111770
8 JGI25157J39369_1000077 3300002741 Bacteria 86251
9 JGI25152J39213_1002125 3300002773 Bacteria 7773
10 JGI25152J39213_1004250 3300002773 Bacteria 4579
11 JGI25152J39213_1005146 3300002773 Bacteria 3915
12 JGI25150J39212_1000091 3300002774 Bacteria 52487
13 JGI25150J39212_1023602 3300002774 Bacteria 913
14 JGI25159J45721_1001753 3300002987 Bacteria 8728
15 JGI25159J45721_1005135 3300002987 Bacteria 4155
16 JGI25151J46595_10000027 3300003187 Bacteria 208739
17 JGI25151J46595_10000737 3300003187 Bacteria 26948
18 JGI25165J46597_1000781 3300003214 Bacteria 24238
19 JGI25165J46597_1001553 3300003214 Bacteria 11382
20 JGI25153J46596_10004225 3300003215 Bacteria 7778
21 JGI25153J46596_10007114 3300003215 Bacteria 5553
22 JGI25153J46596_10009810 3300003215 Bacteria 4399
23 JGI25153J46596_10012436 3300003215 Bacteria 3672
24 JGI25153J46596_10012555 3300003215 Bacteria 3645
25 rootH1_10130903 3300003316 Bacteria 1776
26 rootH2_10294434 3300003320 Unclassified 1827
27 rootL2_10082099 3300003322 Bacteria 3216
28 rootL2_10248515 3300003322 Unclassified 1629
29 rootH1_10124041 3300003323 Unclassified 2133
30 rootH1_10150991 3300003323 Bacteria 1611
31 JGI25160J50197_1000766 3300003354 Bacteria 17317
32 JGI25160J50197_1003059 3300003354 Bacteria 7625
33 JGI25160J50197_1005146 3300003354 Bacteria 5497
34 JGI25161J50226_1000161 3300003374 Bacteria 46957
35 JGI25161J50226_1002967 3300003374 Bacteria 4093
36 Ga0055526_1005491 3300003771 Bacteria 7271
37 Ga0055526_1005836 3300003771 Bacteria 6915
38 Ga0055526_1006258 3300003771 Bacteria 6520
39 Ga0055526_1006291 3300003771 Bacteria 6494
40 Ga0055524_1004407 3300003775 Bacteria 6494
41 Ga0055524_1007195 3300003775 Bacteria 4760
42 Ga0055524_1016106 3300003775 Bacteria 2697
43 Ga0055524_1019880 3300003775 Unclassified 2281
44 Ga0055528_1001127 3300003790 Bacteria 17528
45 Ga0055528_1001694 3300003790 Bacteria 12840
46 Ga0055528_1004885 3300003790 Bacteria 6344
47 Ga0055528_1023079 3300003790 Bacteria 1912
48 Ga0055528_1032946 3300003790 Bacteria 1309
49 Ga0055528_1051729 3300003790 Bacteria 826
50 Ga0055540_1000483 3300003792 Bacteria 30602
51 Ga0055540_1009938 3300003792 Bacteria 3217
52 Ga0055540_1033188 3300003792 Bacteria 1171
53 Ga0055531_10050374 3300003794 Bacteria 1103
54 Ga0055543_1000108 3300004625 Bacteria 71519
55 Ga0055543_1000116 3300004625 Bacteria 67872
56 Ga0055543_1000220 3300004625 Bacteria 45860
57 Ga0065165_1006866 3300005262 Bacteria 5789
58 Ga0065165_1007123 3300005262 Bacteria 5608
59 Ga0070661_100135272 3300005344 Unclassified 1854
60 Ga0070668_100276575 3300005347 Bacteria 1401
61 Ga0070669_100097231 3300005353 Bacteria 2216
62 Ga0070663_100816818 3300005455 Unclassified 800
63 Ga0068855_100196427 3300005563 Bacteria 2273
64 Ga0068854_100022393 3300005578 Bacteria 4304
65 Ga0068856_100018348 3300005614 Bacteria 6782
66 Ga0068852_100087647 3300005616 Bacteria 2778
67 Ga0068851_10022537 3300005834 Bacteria 3070
68 Ga0075365_10002545 3300006038 Bacteria 8990
69 Ga0075363_100043064 3300006048 Bacteria 2387
70 Ga0075367_10114542 3300006178 Bacteria 1657
71 Ga0075369_10004959 3300006186 Bacteria 4954
72 Ga0075366_10002595 3300006195 Bacteria 9288
73 Ga0075370_10000296 3300006353 Bacteria 17852
74 Ga0075370_10139389 3300006353 Bacteria 1417
75 Ga0105240_10000014 3300009093 Bacteria 482033
76 Ga0105248_10434597 3300009177 Bacteria 1478
77 Ga0105237_10000685 3300009545 Bacteria 46922
78 Ga0123341_1000018 3300009765 Bacteria 81421
79 Ga0123342_1021409 3300009766 Bacteria 4547
80 Ga0105239_10001960 3300010375 Bacteria 26777
81 Ga0157373_10053659 3300013100 Bacteria 2866
82 Ga0157370_10000015 3300013104 Bacteria 185771
83 Ga0157369_10219157 3300013105 Bacteria 1992
84 Ga0182008_10027555 3300014497 Bacteria 2877
85 Ga0182007_10001042 3300015262 Bacteria 15186
86 Ga0182005_1001381 3300015265 Bacteria 9884
87 Ga0209436_100272 3300025208 Bacteria 23718
88 Ga0209436_100441 3300025208 Bacteria 18619
89 Ga0209437_100058 3300025233 Bacteria 357279
90 Ga0209437_100060 3300025233 Bacteria 355034
91 Ga0207425_1000043 3300025245 Bacteria 208791
92 Ga0207425_1000495 3300025245 Bacteria 24691
93 Ga0207425_1003377 3300025245 Bacteria 5131
94 Ga0207425_1027928 3300025245 Bacteria 1148
95 Ga0209646_1000011 3300025246 Bacteria 573745
96 Ga0209646_1025352 3300025246 Bacteria 829
97 Ga0209026_1000008 3300025250 Bacteria 573745
98 Ga0209677_100493 3300025253 Bacteria 22233
99 Ga0209148_1012055 3300025254 Bacteria 1590
100 Ga0209759_1000004 3300025256 Bacteria 573745
101 Ga0209129_1000072 3300025258 Bacteria 208805
102 Ga0209129_1000702 3300025258 Bacteria 21824
103 Ga0209129_1000810 3300025258 Bacteria 19737
104 Ga0209129_1002064 3300025258 Bacteria 10356
105 Ga0209129_1004989 3300025258 Bacteria 4900
106 Ga0209233_1000137 3300025261 Bacteria 200314
107 Ga0209233_1000149 3300025261 Bacteria 181183
108 Ga0209233_1000160 3300025261 Bacteria 159035
109 Ga0209455_1024734 3300025272 Bacteria 1104
110 Ga0209673_1000256 3300025273 Bacteria 100514
111 Ga0209673_1001106 3300025273 Bacteria 30133
112 Ga0209673_1001124 3300025273 Bacteria 29604
113 Ga0209673_1036861 3300025273 Bacteria 1445
114 Ga0209673_1037478 3300025273 Bacteria 1424
115 Ga0209130_1000022 3300025284 Bacteria 361244
116 Ga0209130_1000023 3300025284 Bacteria 359355
117 Ga0209025_1000120 3300025294 Bacteria 208791
118 Ga0209025_1000537 3300025294 Bacteria 71838
119 Ga0209564_1000259 3300025295 Bacteria 112570
120 Ga0209564_1000475 3300025295 Bacteria 67102
121 Ga0209564_1000778 3300025295 Bacteria 44316
122 Ga0209564_1002794 3300025295 Bacteria 13027
123 Ga0209758_1000111 3300025297 Bacteria 208790
124 Ga0209758_1000666 3300025297 Bacteria 51353
125 Ga0209758_1001689 3300025297 Bacteria 24856
126 Ga0209758_1001921 3300025297 Bacteria 22607
127 Ga0209758_1003699 3300025297 Bacteria 13571
128 Ga0209050_1004503 3300025298 Bacteria 9372
129 Ga0209256_1000283 3300025299 Bacteria 89387
130 Ga0209256_1000669 3300025299 Bacteria 46351
131 Ga0209256_1003508 3300025299 Bacteria 10927
132 Ga0209256_1011902 3300025299 Bacteria 3412
133 Ga0209256_1045441 3300025299 Bacteria 1091
134 Ga0207426_1000005 3300025302 Bacteria 1037188
135 Ga0207426_1000087 3300025302 Bacteria 288870
136 Ga0207426_1000386 3300025302 Bacteria 75890
137 Ga0209051_1000434 3300025303 Bacteria 56673
138 Ga0209051_1002537 3300025303 Bacteria 12902
139 Ga0209051_1012705 3300025303 Bacteria 4055
140 Ga0209051_1036143 3300025303 Bacteria 1828
141 Ga0209257_1004256 3300025304 Bacteria 11296
142 Ga0207695_10000037 3300025913 Bacteria 476303
143 Ga0207671_10000080 3300025914 Bacteria 148567
144 Ga0207681_10117080 3300025923 Bacteria 1948
145 Ga0207667_10094086 3300025949 Bacteria 3094
146 Ga0207668_10340394 3300025972 Bacteria 1251
147 Ga0207702_10052389 3300026078 Bacteria 3453
148 Ga0207698_10052722 3300026142 Bacteria 3118
149 Ga0209371_1007571 3300027312 Bacteria 3757
150 Ga0209371_1036365 3300027312 Bacteria 1030
151 Ga0209371_1041207 3300027312 Bacteria 936
152 Ga0268266_10042736 3300028379 Bacteria 3872
153 Ga0307515_10016158 3300028794 Bacteria 13688
154 Ga0268256_1010152 3300030500 Bacteria 3069
155 Ga0268256_1041365 3300030500 Bacteria 1030
156 Ga0268256_1046712 3300030500 Bacteria 936
157 Ga0307513_10040200 3300031456 Bacteria 5173
158 Ga0307405_10001622 3300031731 Bacteria 9573
159 Ga0307406_10089390 3300031901 Bacteria 2069
160 Ga0307412_10062208 3300031911 Bacteria 2512
161 Ga0439465_0026722 3300041413 Bacteria 1826
162 Ga0451798_1148991 3300041458 Bacteria 2576
163 Ga0451833_0043866 3300041491 Bacteria 2904
164 Ga0451833_0439495 3300041491 Bacteria 704
165 Ga0451835_0455892 3300041492 Bacteria 1490
166 Ga0451837_1553596 3300041494 Bacteria 1225
167 Ga0451839_0138960 3300041496 Bacteria 1182
168 Ga0451839_0406433 3300041496 Bacteria 2860
169 Ga0451841_1441740 3300041498 Bacteria 1542
170 Ga0451845_0778439 3300041501 Bacteria 1830
171 Ga0451846_65300 3300041502 Bacteria 2814
172 Ga0451847_0008587 3300041503 Bacteria 1696
173 Ga0451851_1289785 3300041507 Bacteria 4146
174 Ga0451855_0270275 3300041511 Bacteria 1753
175 Ga0451853_0225910 3300041512 Bacteria 2819
176 Ga0451853_3122558 3300041512 Bacteria 778
177 Ga0466963_0032651 3300044694 Bacteria 3373
178 Ga0466970_0007726 3300044765 Bacteria 5395
179 Ga0466957_0055721 3300044842 Bacteria 2416
180 Ga0466958_0041516 3300045836 Bacteria 2767
181 Ga0466967_0116284 3300045976 Bacteria 2464
182 Ga0495627_111193 3300046453 Bacteria 778
183 Ga0495638_0082252 3300046460 Bacteria 1953
184 Ga0495605_0057880 3300046474 Bacteria 1864
185 Ga0495585_0054116 3300046492 Bacteria 2219
186 Ga0495585_0308483 3300046492 Bacteria 776
187 Ga0495607_0254720 3300046501 Bacteria 843
188 Ga0495583_0232141 3300046506 Bacteria 743
189 Ga0495606_0008343 3300046507 Bacteria 9021
190 Ga0495606_0044188 3300046507 Bacteria 2965
191 Ga0495606_0064955 3300046507 Bacteria 2320
192 Ga0495610_0033348 3300046512 Bacteria 2663
193 Ga0495620_0008785 3300046515 Bacteria 5408
194 Ga0495620_0024017 3300046515 Bacteria 2905
195 Ga0495631_0144027 3300046518 Bacteria 1023
196 Ga0495632_0176711 3300046519 Bacteria 979
197 Ga0495643_0029150 3300046522 Bacteria 3089
198 Ga0495643_0083067 3300046522 Bacteria 1663
199 Ga0495648_0062988 3300046524 Bacteria 2193
200 Ga0495648_0281470 3300046524 Bacteria 788
201 Ga0495633_0023526 3300046558 Bacteria 3051
202 Ga0495668_0017800 3300046616 Bacteria 4117
203 Ga0495661_0091119 3300046665 Bacteria 1734
204 Ga0495588_0276862 3300046674 Bacteria 884
205 Ga0495670_0079606 3300046691 Bacteria 1668
206 Ga0495649_0085924 3300046694 Bacteria 1679
207 Ga0495687_043283 3300047443 Bacteria 1962
208 Ga0495681_0044466 3300047470 Bacteria 2134
209 Ga0495686_0010433 3300047472 Bacteria 6609
210 Ga0495686_0063210 3300047472 Bacteria 2294
211 Ga0495686_0247535 3300047472 Bacteria 1003
212 Ga0495626_0016546 3300048091 Bacteria 3743
213 Ga0496100_0015646 3300048903 Bacteria 4433
214 Ga0496101_0182870 3300048904 Bacteria 1615
215 Ga0496102_0010148 3300048905 Bacteria 8098
216 Ga0496103_0077641 3300048906 Bacteria 2085
217 Ga0496110_0600711 3300048913 Bacteria 998
218 Ga0496113_0188128 3300048916 Bacteria 1638
219 Ga0496114_0089443 3300048917 Bacteria 2613
220 Ga0496116_0006284 3300048919 Bacteria 10823
221 Ga0496116_0007875 3300048919 Bacteria 9349
222 Ga0496116_0015598 3300048919 Bacteria 5999
223 Ga0496116_0016160 3300048919 Bacteria 5857
224 Ga0496116_0102718 3300048919 Bacteria 1703
225 Ga0496116_0216751 3300048919 Bacteria 986
226 Ga0496117_0006083 3300048920 Bacteria 12375
227 Ga0496117_0026516 3300048920 Bacteria 4533
228 Ga0496117_0041686 3300048920 Bacteria 3359
229 Ga0496117_0050089 3300048920 Bacteria 2964
230 Ga0496117_0117336 3300048920 Bacteria 1643
231 Ga0496118_0006836 3300048921 Bacteria 12375
232 Ga0496118_0043384 3300048921 Bacteria 3536
233 Ga0496118_0121041 3300048921 Bacteria 1706
234 Ga0496119_0009897 3300048922 Bacteria 8096
235 Ga0496119_0010784 3300048922 Bacteria 7652
236 Ga0496120_0137970 3300048923 Bacteria 1241
237 Ga0496121_0007360 3300048924 Bacteria 13307
238 Ga0496121_0054762 3300048924 Bacteria 3330
239 Ga0496121_0066766 3300048924 Bacteria 2918
240 Ga0496121_0101771 3300048924 Bacteria 2214
241 Ga0496121_0345675 3300048924 Bacteria 992
242 Ga0496122_0008642 3300048925 Bacteria 10929
243 Ga0496122_0019590 3300048925 Bacteria 6171
244 Ga0496122_0076875 3300048925 Bacteria 2347
245 Ga0496122_0098000 3300048925 Bacteria 1970
246 Ga0496122_0264712 3300048925 Bacteria 951
247 Ga0496123_0004716 3300048926 Bacteria 14106
248 Ga0496123_0011311 3300048926 Bacteria 7753
249 Ga0496123_0031661 3300048926 Bacteria 3844
250 Ga0496124_0006891 3300048927 Bacteria 12213
251 Ga0496124_0020559 3300048927 Bacteria 6094
252 Ga0496124_0043511 3300048927 Bacteria 3860
253 Ga0496124_0059548 3300048927 Bacteria 3207
254 Ga0496124_0132717 3300048927 Bacteria 1976
255 Ga0496124_0136462 3300048927 Bacteria 1941
256 Ga0496125_0018305 3300048928 Bacteria 6656
257 Ga0496125_0023438 3300048928 Bacteria 5697
258 Ga0496125_0035790 3300048928 Bacteria 4347
259 Ga0496125_0081254 3300048928 Bacteria 2477
260 Ga0496126_0021661 3300048929 Bacteria 6273
261 Ga0496126_0225032 3300048929 Bacteria 1574
262 Ga0501031_0156050 3300049568 Bacteria 1492
263 Ga0501032_0135560 3300049569 Bacteria 1623
264 Ga0501034_0161232 3300049571 Bacteria 2213
265 Ga0501037_0485061 3300049573 Bacteria 840
266 Ga0501039_0760753 3300049575 Bacteria 756
267 Ga0501043_0033643 3300049579 Bacteria 4033
268 Ga0501046_0495560 3300049580 Bacteria 875
269 Ga0501047_0255255 3300049581 Bacteria 1602
270 Ga0501068_0053552 3300049584 Bacteria 2444
271 Ga0501073_0573598 3300049589 Bacteria 779
272 Ga0501074_0369390 3300049590 Bacteria 1018
273 Ga0501080_0561306 3300049742 Bacteria 1016
274 Ga0501083_0056861 3300049744 Bacteria 2621
275 Ga0501044_0085736 3300049823 Bacteria 3182
276 Ga0495655_0064489 3300053083 Bacteria 1008
277 Ga0500646_0073340 3300053090 Bacteria 1031
278 Ga0500651_0314251 3300053093 Bacteria 896
279 Ga0500569_021260 3300053109 Bacteria 1713
280 Ga0500658_0055032 3300053134 Bacteria 1636
281 Ga0500568_0066597 3300053139 Unclassified 1385
282 Ga0500616_0048537 3300053153 Bacteria 2250
283 Ga0500622_0001357 3300053156 Bacteria 19789
284 Ga0500622_0132238 3300053156 Bacteria 1198
285 Ga0500627_0051327 3300053158 Bacteria 1799
286 Ga0500633_0186821 3300053160 Bacteria 777
287 Ga0500636_0080501 3300053177 Bacteria 1877
288 Ga0501082_0061799 3300060353 Bacteria 3224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002739 JGI25158J39367_1000025 JGI25158J39367_100002526 195
2 3300002773 JGI25152J39213_1005146 JGI25152J39213_10051462 195
3 3300002987 JGI25159J45721_1005135 JGI25159J45721_10051353 195
4 3300003320 rootH2_10294434 rootH2_102944341 195
5 3300003322 rootL2_10248515 rootL2_102485152 195
6 3300003323 rootH1_10124041 rootH1_101240412 195
7 3300003354 JGI25160J50197_1003059 JGI25160J50197_10030593 195
8 3300003374 JGI25161J50226_1000161 JGI25161J50226_100016129 195
9 3300003771 Ga0055526_1005491 Ga0055526_10054915 195
10 3300003775 Ga0055524_1019880 Ga0055524_10198802 195
11 3300003790 Ga0055528_1001694 Ga0055528_10016946 195
12 3300004625 Ga0055543_1000116 Ga0055543_100011618 195
13 3300005344 Ga0070661_100135272 Ga0070661_1001352722 195
14 3300005455 Ga0070663_100816818 Ga0070663_1008168181 195
15 3300025208 Ga0209436_100441 Ga0209436_10044114 195
16 3300025258 Ga0209129_1004989 Ga0209129_10049892 195
17 3300025284 Ga0209130_1000022 Ga0209130_100002286 195
18 3300025295 Ga0209564_1000475 Ga0209564_100047524 195
19 3300025299 Ga0209256_1011902 Ga0209256_10119022 195
20 3300025302 Ga0207426_1000005 Ga0207426_1000005160 195
21 3300053139 Ga0500568_0066597 Ga0500568_0066597_668_1267 195
22 iso_pu_bacteria 2757320392 2757571144 195
23 iso_pu_bacteria 8018127388 8018129302 196
24 3300002737 JGI25162J39368_1000149 JGI25162J39368_100014912 197
25 3300003214 JGI25165J46597_1001553 JGI25165J46597_100155312 197
26 3300025233 Ga0209437_100058 Ga0209437_100058129 197
27 3300025261 Ga0209233_1000149 Ga0209233_100014955 197
28 3300041512 Ga0451853_3122558 Ga0451853_3122558_11_634 200
29 3300049580 Ga0501046_0495560 Ga0501046_0495560_244_861 200
30 3300049589 Ga0501073_0573598 Ga0501073_0573598_19_636 200
31 iso_pu_bacteria 8005658619 8005658753 200
32 3300047472 Ga0495686_0010433 Ga0495686_0010433_5063_5671 202
33 iso_pu_bacteria 2558860983 2561469042 202
34 iso_pu_bacteria 2765235942 2766066471 202
35 iso_pu_bacteria 2509276033 2509447570 203
36 iso_pu_bacteria 2510065019 2510134400 203
37 iso_pu_bacteria 2510461076 2510895824 203
38 iso_pu_bacteria 2510917030 2511195281 203
39 iso_pu_bacteria 2513237084 2513567485 203
40 iso_pu_bacteria 2513237085 2513577822 203
41 iso_pu_bacteria 2513237093 2513632032 203
42 iso_pu_bacteria 2513237103 2513712498 203
43 iso_pu_bacteria 2513237162 2514017869 203
44 iso_pu_bacteria 2515075009 2515113562 203
45 iso_pu_bacteria 2515154113 2515635276 203
46 iso_pu_bacteria 2515154114 2515643818 203
47 iso_pu_bacteria 2515154116 2515654906 203
48 iso_pu_bacteria 2515154134 2515739919 203
49 iso_pu_bacteria 2516653077 2517037178 203
50 iso_pu_bacteria 2516653085 2517077516 203
51 iso_pu_bacteria 2517093000 2517096286 203
52 iso_pu_bacteria 2517287029 2517408145 203
53 iso_pu_bacteria 2529292951 2530646356 203
54 iso_pu_bacteria 2582581298 2585225223 203
55 iso_pu_bacteria 2582581304 2585259148 203
56 iso_pu_bacteria 2585427526 2585524945 203
57 iso_pu_bacteria 2585427528 2585542752 203
58 iso_pu_bacteria 2585427529 2585547779 203
59 iso_pu_bacteria 2585427593 2585841394 203
60 iso_pu_bacteria 2585427594 2585847735 203
61 iso_pu_bacteria 2724679232 2725949244 203
62 iso_pu_bacteria 2738541293 2738805454 203
63 iso_pu_bacteria 2738541333 2739033267 203
64 iso_pu_bacteria 2765235942 2766066316 203
65 iso_pu_bacteria 2791355256 2793293984 203
66 iso_pu_bacteria 2791355261 2793329733 203
67 iso_pu_bacteria 2791355262 2793335079 203
68 iso_pu_bacteria 2791355263 2793342333 203
69 iso_pu_bacteria 2802429633 2806047491 203
70 iso_pu_bacteria 2802429634 2806055159 203
71 iso_pu_bacteria 2802429635 2806063031 203
72 iso_pu_bacteria 2802429636 2806069766 203
73 iso_pu_bacteria 2802429637 2806075695 203
74 iso_pu_bacteria 2838680041 2838682995 203
75 iso_pu_bacteria 2838694306 2838698062 203
76 iso_pu_bacteria 2842118031 2842118138 203
77 iso_pu_bacteria 2842237096 2842240051 203
78 iso_pu_bacteria 2842370503 2842373624 203
79 iso_pu_bacteria 2842377471 2842379411 203
80 iso_pu_bacteria 2842384541 2842384648 203
81 iso_pu_bacteria 2935894831 2935896555 203
82 iso_pu_bacteria 3005445848 3005448865 203
83 iso_pu_bacteria 639633055 639649607 203
84 iso_pu_bacteria 8024486573 8024488459 203
85 3300027312 Ga0209371_1036365 Ga0209371_10363651 204
86 3300030500 Ga0268256_1041365 Ga0268256_10413652 204
87 3300046507 Ga0495606_0008343 Ga0495606_0008343_1019_1633 204
88 3300048924 Ga0496121_0101771 Ga0496121_0101771_1042_1656 204
89 iso_pu_bacteria 8005301065 8005303592 204
90 iso_pu_bacteria 8005688590 8005691629 204
91 iso_pu_bacteria 2842278818 2842284372 205
92 3300046507 Ga0495606_0044188 Ga0495606_0044188_1338_1973 206
93 3300046522 Ga0495643_0083067 Ga0495643_0083067_235_873 206
94 iso_pu_bacteria 2791355259 2793314340 206
95 iso_pu_bacteria 8055431914 8055432253 206
96 3300002704 JGI25155J39150_1000066 JGI25155J39150_100006611 207
97 3300002705 JGI25156J39149_1000075 JGI25156J39149_100007526 207
98 3300002737 JGI25162J39368_1000211 JGI25162J39368_100021145 207
99 3300002738 JGI25154J39366_1000075 JGI25154J39366_100007527 207
100 3300002741 JGI25157J39369_1000051 JGI25157J39369_100005164 207
101 3300002741 JGI25157J39369_1000077 JGI25157J39369_100007738 207
102 3300002773 JGI25152J39213_1002125 JGI25152J39213_10021259 207
103 3300002773 JGI25152J39213_1004250 JGI25152J39213_10042503 207
104 3300002774 JGI25150J39212_1000091 JGI25150J39212_100009144 207
105 3300002774 JGI25150J39212_1023602 JGI25150J39212_10236022 207
106 3300002987 JGI25159J45721_1001753 JGI25159J45721_10017536 207
107 3300003187 JGI25151J46595_10000027 JGI25151J46595_1000002757 207
108 3300003187 JGI25151J46595_10000737 JGI25151J46595_100007379 207
109 3300003214 JGI25165J46597_1000781 JGI25165J46597_100078114 207
110 3300003215 JGI25153J46596_10004225 JGI25153J46596_100042259 207
111 3300003215 JGI25153J46596_10007114 JGI25153J46596_100071144 207
112 3300003215 JGI25153J46596_10009810 JGI25153J46596_100098103 207
113 3300003215 JGI25153J46596_10012436 JGI25153J46596_100124367 207
114 3300003215 JGI25153J46596_10012555 JGI25153J46596_100125554 207
115 3300003316 rootH1_10130903 rootH1_101309031 207
116 3300003322 rootL2_10082099 rootL2_100820996 207
117 3300003323 rootH1_10150991 rootH1_101509914 207
118 3300003354 JGI25160J50197_1000766 JGI25160J50197_100076611 207
119 3300003354 JGI25160J50197_1005146 JGI25160J50197_10051462 207
120 3300003374 JGI25161J50226_1002967 JGI25161J50226_10029674 207
121 3300003771 Ga0055526_1005836 Ga0055526_100583610 207
122 3300003771 Ga0055526_1006258 Ga0055526_100625810 207
123 3300003771 Ga0055526_1006291 Ga0055526_100629110 207
124 3300003775 Ga0055524_1004407 Ga0055524_100440710 207
125 3300003775 Ga0055524_1007195 Ga0055524_10071952 207
126 3300003775 Ga0055524_1016106 Ga0055524_10161062 207
127 3300003790 Ga0055528_1001127 Ga0055528_10011272 207
128 3300003790 Ga0055528_1004885 Ga0055528_100488510 207
129 3300003790 Ga0055528_1023079 Ga0055528_10230792 207
130 3300003790 Ga0055528_1032946 Ga0055528_10329463 207
131 3300003790 Ga0055528_1051729 Ga0055528_10517292 207
132 3300003792 Ga0055540_1000483 Ga0055540_10004837 207
133 3300003792 Ga0055540_1009938 Ga0055540_10099382 207
134 3300003792 Ga0055540_1033188 Ga0055540_10331882 207
135 3300003794 Ga0055531_10050374 Ga0055531_100503742 207
136 3300004625 Ga0055543_1000108 Ga0055543_100010829 207
137 3300004625 Ga0055543_1000220 Ga0055543_10002209 207
138 3300005262 Ga0065165_1006866 Ga0065165_10068663 207
139 3300005262 Ga0065165_1007123 Ga0065165_10071232 207
140 3300005347 Ga0070668_100276575 Ga0070668_1002765752 207
141 3300005353 Ga0070669_100097231 Ga0070669_1000972312 207
142 3300005563 Ga0068855_100196427 Ga0068855_1001964272 207
143 3300005578 Ga0068854_100022393 Ga0068854_1000223936 207
144 3300005614 Ga0068856_100018348 Ga0068856_1000183488 207
145 3300005616 Ga0068852_100087647 Ga0068852_1000876474 207
146 3300005834 Ga0068851_10022537 Ga0068851_100225372 207
147 3300006038 Ga0075365_10002545 Ga0075365_100025456 207
148 3300006048 Ga0075363_100043064 Ga0075363_1000430642 207
149 3300006178 Ga0075367_10114542 Ga0075367_101145423 207
150 3300006186 Ga0075369_10004959 Ga0075369_100049592 207
151 3300006195 Ga0075366_10002595 Ga0075366_100025955 207
152 3300006353 Ga0075370_10000296 Ga0075370_1000029611 207
153 3300006353 Ga0075370_10139389 Ga0075370_101393892 207
154 3300009093 Ga0105240_10000014 Ga0105240_10000014106 207
155 3300009177 Ga0105248_10434597 Ga0105248_104345972 207
156 3300009545 Ga0105237_10000685 Ga0105237_1000068533 207
157 3300009765 Ga0123341_1000018 Ga0123341_100001838 207
158 3300009766 Ga0123342_1021409 Ga0123342_10214093 207
159 3300010375 Ga0105239_10001960 Ga0105239_1000196016 207
160 3300013100 Ga0157373_10053659 Ga0157373_100536592 207
161 3300013104 Ga0157370_10000015 Ga0157370_10000015106 207
162 3300013105 Ga0157369_10219157 Ga0157369_102191573 207
163 3300014497 Ga0182008_10027555 Ga0182008_100275552 207
164 3300015262 Ga0182007_10001042 Ga0182007_100010427 207
165 3300015265 Ga0182005_1001381 Ga0182005_100138111 207
166 3300025208 Ga0209436_100272 Ga0209436_10027210 207
167 3300025233 Ga0209437_100060 Ga0209437_100060131 207
168 3300025245 Ga0207425_1000043 Ga0207425_100004355 207
169 3300025245 Ga0207425_1000495 Ga0207425_100049519 207
170 3300025245 Ga0207425_1003377 Ga0207425_10033773 207
171 3300025245 Ga0207425_1027928 Ga0207425_10279282 207
172 3300025246 Ga0209646_1000011 Ga0209646_1000011456 207
173 3300025246 Ga0209646_1025352 Ga0209646_10253522 207
174 3300025250 Ga0209026_1000008 Ga0209026_1000008456 207
175 3300025253 Ga0209677_100493 Ga0209677_10049312 207
176 3300025254 Ga0209148_1012055 Ga0209148_10120552 207
177 3300025256 Ga0209759_1000004 Ga0209759_1000004456 207
178 3300025258 Ga0209129_1000072 Ga0209129_1000072139 207
179 3300025258 Ga0209129_1000702 Ga0209129_10007028 207
180 3300025258 Ga0209129_1000810 Ga0209129_100081011 207
181 3300025258 Ga0209129_1002064 Ga0209129_100206411 207
182 3300025261 Ga0209233_1000137 Ga0209233_1000137108 207
183 3300025261 Ga0209233_1000160 Ga0209233_1000160100 207
184 3300025272 Ga0209455_1024734 Ga0209455_10247342 207
185 3300025273 Ga0209673_1000256 Ga0209673_100025642 207
186 3300025273 Ga0209673_1001106 Ga0209673_10011067 207
187 3300025273 Ga0209673_1001124 Ga0209673_100112421 207
188 3300025273 Ga0209673_1036861 Ga0209673_10368612 207
189 3300025273 Ga0209673_1037478 Ga0209673_10374782 207
190 3300025284 Ga0209130_1000023 Ga0209130_1000023164 207
191 3300025294 Ga0209025_1000120 Ga0209025_1000120139 207
192 3300025294 Ga0209025_1000537 Ga0209025_100053734 207
193 3300025295 Ga0209564_1000259 Ga0209564_100025949 207
194 3300025295 Ga0209564_1000778 Ga0209564_100077835 207
195 3300025295 Ga0209564_1002794 Ga0209564_10027949 207
196 3300025297 Ga0209758_1000111 Ga0209758_1000111139 207
197 3300025297 Ga0209758_1000666 Ga0209758_100066612 207
198 3300025297 Ga0209758_1001689 Ga0209758_100168915 207
199 3300025297 Ga0209758_1001921 Ga0209758_100192114 207
200 3300025297 Ga0209758_1003699 Ga0209758_10036995 207
201 3300025298 Ga0209050_1004503 Ga0209050_10045036 207
202 3300025299 Ga0209256_1000283 Ga0209256_100028349 207
203 3300025299 Ga0209256_1000669 Ga0209256_100066938 207
204 3300025299 Ga0209256_1003508 Ga0209256_100350812 207
205 3300025299 Ga0209256_1045441 Ga0209256_10454412 207
206 3300025302 Ga0207426_1000087 Ga0207426_1000087198 207
207 3300025302 Ga0207426_1000386 Ga0207426_10003862 207
208 3300025303 Ga0209051_1000434 Ga0209051_100043430 207
209 3300025303 Ga0209051_1002537 Ga0209051_100253711 207
210 3300025303 Ga0209051_1012705 Ga0209051_10127056 207
211 3300025303 Ga0209051_1036143 Ga0209051_10361432 207
212 3300025304 Ga0209257_1004256 Ga0209257_100425611 207
213 3300025913 Ga0207695_10000037 Ga0207695_10000037107 207
214 3300025914 Ga0207671_10000080 Ga0207671_10000080108 207
215 3300025923 Ga0207681_10117080 Ga0207681_101170802 207
216 3300025949 Ga0207667_10094086 Ga0207667_100940863 207
217 3300025972 Ga0207668_10340394 Ga0207668_103403942 207
218 3300026078 Ga0207702_10052389 Ga0207702_100523895 207
219 3300026142 Ga0207698_10052722 Ga0207698_100527224 207
220 3300027312 Ga0209371_1007571 Ga0209371_10075712 207
221 3300027312 Ga0209371_1041207 Ga0209371_10412071 207
222 3300028379 Ga0268266_10042736 Ga0268266_100427363 207
223 3300028794 Ga0307515_10016158 Ga0307515_100161586 207
224 3300030500 Ga0268256_1010152 Ga0268256_10101525 207
225 3300030500 Ga0268256_1046712 Ga0268256_10467121 207
226 3300031456 Ga0307513_10040200 Ga0307513_100402007 207
227 3300031731 Ga0307405_10001622 Ga0307405_100016224 207
228 3300031901 Ga0307406_10089390 Ga0307406_100893902 207
229 3300031911 Ga0307412_10062208 Ga0307412_100622082 207
230 3300041413 Ga0439465_0026722 Ga0439465_0026722_64_687 207
231 3300041458 Ga0451798_1148991 Ga0451798_1148991_378_1001 207
232 3300041491 Ga0451833_0043866 Ga0451833_0043866_2174_2797 207
233 3300041491 Ga0451833_0439495 Ga0451833_0439495_33_656 207
234 3300041492 Ga0451835_0455892 Ga0451835_0455892_445_1068 207
235 3300041494 Ga0451837_1553596 Ga0451837_1553596_555_1178 207
236 3300041496 Ga0451839_0138960 Ga0451839_0138960_179_802 207
237 3300041496 Ga0451839_0406433 Ga0451839_0406433_588_1211 207
238 3300041498 Ga0451841_1441740 Ga0451841_1441740_835_1458 207
239 3300041501 Ga0451845_0778439 Ga0451845_0778439_1175_1798 207
240 3300041502 Ga0451846_65300 Ga0451846_65300_768_1391 207
241 3300041503 Ga0451847_0008587 Ga0451847_0008587_738_1361 207
242 3300041507 Ga0451851_1289785 Ga0451851_1289785_1359_1982 207
243 3300041511 Ga0451855_0270275 Ga0451855_0270275_231_869 207
244 3300041512 Ga0451853_0225910 Ga0451853_0225910_1972_2595 207
245 3300044694 Ga0466963_0032651 Ga0466963_0032651_75_698 207
246 3300044765 Ga0466970_0007726 Ga0466970_0007726_901_1524 207
247 3300044842 Ga0466957_0055721 Ga0466957_0055721_938_1561 207
248 3300045836 Ga0466958_0041516 Ga0466958_0041516_1230_1853 207
249 3300045976 Ga0466967_0116284 Ga0466967_0116284_1181_1804 207
250 3300046453 Ga0495627_111193 Ga0495627_111193_98_721 207
251 3300046460 Ga0495638_0082252 Ga0495638_0082252_372_995 207
252 3300046474 Ga0495605_0057880 Ga0495605_0057880_378_1001 207
253 3300046492 Ga0495585_0054116 Ga0495585_0054116_599_1222 207
254 3300046492 Ga0495585_0308483 Ga0495585_0308483_77_700 207
255 3300046501 Ga0495607_0254720 Ga0495607_0254720_174_797 207
256 3300046506 Ga0495583_0232141 Ga0495583_0232141_46_669 207
257 3300046507 Ga0495606_0064955 Ga0495606_0064955_248_871 207
258 3300046512 Ga0495610_0033348 Ga0495610_0033348_191_814 207
259 3300046515 Ga0495620_0008785 Ga0495620_0008785_242_865 207
260 3300046515 Ga0495620_0024017 Ga0495620_0024017_194_817 207
261 3300046518 Ga0495631_0144027 Ga0495631_0144027_216_839 207
262 3300046519 Ga0495632_0176711 Ga0495632_0176711_17_640 207
263 3300046522 Ga0495643_0029150 Ga0495643_0029150_1688_2311 207
264 3300046524 Ga0495648_0062988 Ga0495648_0062988_775_1398 207
265 3300046524 Ga0495648_0281470 Ga0495648_0281470_27_650 207
266 3300046558 Ga0495633_0023526 Ga0495633_0023526_2139_2762 207
267 3300046616 Ga0495668_0017800 Ga0495668_0017800_3413_4036 207
268 3300046665 Ga0495661_0091119 Ga0495661_0091119_903_1526 207
269 3300046674 Ga0495588_0276862 Ga0495588_0276862_139_762 207
270 3300046691 Ga0495670_0079606 Ga0495670_0079606_969_1592 207
271 3300046694 Ga0495649_0085924 Ga0495649_0085924_65_688 207
272 3300047443 Ga0495687_043283 Ga0495687_043283_138_761 207
273 3300047470 Ga0495681_0044466 Ga0495681_0044466_1013_1636 207
274 3300047472 Ga0495686_0063210 Ga0495686_0063210_109_732 207
275 3300047472 Ga0495686_0247535 Ga0495686_0247535_269_892 207
276 3300048091 Ga0495626_0016546 Ga0495626_0016546_51_674 207
277 3300048903 Ga0496100_0015646 Ga0496100_0015646_3003_3647 207
278 3300048904 Ga0496101_0182870 Ga0496101_0182870_790_1413 207
279 3300048905 Ga0496102_0010148 Ga0496102_0010148_2540_3184 207
280 3300048906 Ga0496103_0077641 Ga0496103_0077641_262_906 207
281 3300048913 Ga0496110_0600711 Ga0496110_0600711_329_979 207
282 3300048916 Ga0496113_0188128 Ga0496113_0188128_743_1387 207
283 3300048917 Ga0496114_0089443 Ga0496114_0089443_1677_2327 207
284 3300048919 Ga0496116_0006284 Ga0496116_0006284_7767_8411 207
285 3300048919 Ga0496116_0007875 Ga0496116_0007875_2261_2884 207
286 3300048919 Ga0496116_0015598 Ga0496116_0015598_5232_5870 207
287 3300048919 Ga0496116_0016160 Ga0496116_0016160_289_912 207
288 3300048919 Ga0496116_0102718 Ga0496116_0102718_130_753 207
289 3300048919 Ga0496116_0216751 Ga0496116_0216751_333_956 207
290 3300048920 Ga0496117_0006083 Ga0496117_0006083_6892_7536 207
291 3300048920 Ga0496117_0026516 Ga0496117_0026516_3060_3683 207
292 3300048920 Ga0496117_0041686 Ga0496117_0041686_113_736 207
293 3300048920 Ga0496117_0050089 Ga0496117_0050089_1962_2588 207
294 3300048920 Ga0496117_0117336 Ga0496117_0117336_37_660 207
295 3300048921 Ga0496118_0006836 Ga0496118_0006836_6892_7536 207
296 3300048921 Ga0496118_0043384 Ga0496118_0043384_2789_3412 207
297 3300048921 Ga0496118_0121041 Ga0496118_0121041_735_1358 207
298 3300048922 Ga0496119_0009897 Ga0496119_0009897_5040_5684 207
299 3300048922 Ga0496119_0010784 Ga0496119_0010784_1431_2057 207
300 3300048923 Ga0496120_0137970 Ga0496120_0137970_308_934 207
301 3300048924 Ga0496121_0007360 Ga0496121_0007360_2413_3057 207
302 3300048924 Ga0496121_0054762 Ga0496121_0054762_2118_2774 207
303 3300048924 Ga0496121_0066766 Ga0496121_0066766_35_658 207
304 3300048924 Ga0496121_0345675 Ga0496121_0345675_35_658 207
305 3300048925 Ga0496122_0008642 Ga0496122_0008642_2728_3372 207
306 3300048925 Ga0496122_0019590 Ga0496122_0019590_2003_2629 207
307 3300048925 Ga0496122_0076875 Ga0496122_0076875_1424_2047 207
308 3300048925 Ga0496122_0098000 Ga0496122_0098000_1313_1936 207
309 3300048925 Ga0496122_0264712 Ga0496122_0264712_294_917 207
310 3300048926 Ga0496123_0004716 Ga0496123_0004716_6369_6992 207
311 3300048926 Ga0496123_0011311 Ga0496123_0011311_4395_5039 207
312 3300048926 Ga0496123_0031661 Ga0496123_0031661_3194_3817 207
313 3300048927 Ga0496124_0006891 Ga0496124_0006891_5125_5748 207
314 3300048927 Ga0496124_0020559 Ga0496124_0020559_374_997 207
315 3300048927 Ga0496124_0043511 Ga0496124_0043511_2848_3492 207
316 3300048927 Ga0496124_0059548 Ga0496124_0059548_274_930 207
317 3300048927 Ga0496124_0132717 Ga0496124_0132717_850_1476 207
318 3300048927 Ga0496124_0136462 Ga0496124_0136462_17_640 207
319 3300048928 Ga0496125_0018305 Ga0496125_0018305_5259_5882 207
320 3300048928 Ga0496125_0023438 Ga0496125_0023438_4372_5028 207
321 3300048928 Ga0496125_0035790 Ga0496125_0035790_2746_3390 207
322 3300048928 Ga0496125_0081254 Ga0496125_0081254_1034_1660 207
323 3300048929 Ga0496126_0021661 Ga0496126_0021661_2828_3472 207
324 3300048929 Ga0496126_0225032 Ga0496126_0225032_906_1529 207
325 3300049568 Ga0501031_0156050 Ga0501031_0156050_408_1034 207
326 3300049569 Ga0501032_0135560 Ga0501032_0135560_403_1029 207
327 3300049571 Ga0501034_0161232 Ga0501034_0161232_29_655 207
328 3300049573 Ga0501037_0485061 Ga0501037_0485061_78_704 207
329 3300049575 Ga0501039_0760753 Ga0501039_0760753_11_637 207
330 3300049579 Ga0501043_0033643 Ga0501043_0033643_3160_3813 207
331 3300049581 Ga0501047_0255255 Ga0501047_0255255_223_849 207
332 3300049584 Ga0501068_0053552 Ga0501068_0053552_818_1471 207
333 3300049590 Ga0501074_0369390 Ga0501074_0369390_195_821 207
334 3300049742 Ga0501080_0561306 Ga0501080_0561306_135_761 207
335 3300049744 Ga0501083_0056861 Ga0501083_0056861_126_752 207
336 3300049823 Ga0501044_0085736 Ga0501044_0085736_1810_2436 207
337 3300053083 Ga0495655_0064489 Ga0495655_0064489_40_663 207
338 3300053090 Ga0500646_0073340 Ga0500646_0073340_79_702 207
339 3300053093 Ga0500651_0314251 Ga0500651_0314251_10_633 207
340 3300053109 Ga0500569_021260 Ga0500569_021260_995_1618 207
341 3300053134 Ga0500658_0055032 Ga0500658_0055032_980_1603 207
342 3300053153 Ga0500616_0048537 Ga0500616_0048537_89_712 207
343 3300053156 Ga0500622_0001357 Ga0500622_0001357_4197_4853 207
344 3300053156 Ga0500622_0132238 Ga0500622_0132238_541_1164 207
345 3300053158 Ga0500627_0051327 Ga0500627_0051327_689_1327 207
346 3300053160 Ga0500633_0186821 Ga0500633_0186821_81_704 207
347 3300053177 Ga0500636_0080501 Ga0500636_0080501_911_1534 207
348 3300060353 Ga0501082_0061799 Ga0501082_0061799_795_1448 207
349 iso_pu_bacteria 2510917022 2511131955 207
350 iso_pu_bacteria 2519899620 2520381984 207
351 iso_pu_bacteria 2582581294 2585203975 207
352 iso_pu_bacteria 2582581308 2585279455 207
353 iso_pu_bacteria 2582581315 2585322885 207
354 iso_pu_bacteria 2582581316 2585331051 207
355 iso_pu_bacteria 2585427527 2585531061 207
356 iso_pu_bacteria 2585427530 2585553018 207
357 iso_pu_bacteria 2615840624 2616296622 207
358 iso_pu_bacteria 2615840626 2616307028 207
359 iso_pu_bacteria 2615840698 2616554643 207
360 iso_pu_bacteria 2617270742 2617386327 207
361 iso_pu_bacteria 2667528174 2671111886 207
362 iso_pu_bacteria 2718217927 2719386869 207
363 iso_pu_bacteria 2718218423 2721400592 207
364 iso_pu_bacteria 2721755809 2724039405 207
365 iso_pu_bacteria 2775507266 2778173408 207
366 iso_pu_bacteria 2791355260 2793323829 207
367 iso_pu_bacteria 2791355265 2793355352 207
368 iso_pu_bacteria 2791355267 2793369911 207
369 iso_pu_bacteria 2818991453 2819640012 207
370 iso_pu_bacteria 2838022645 2838023408 207
371 iso_pu_bacteria 2838029111 2838033213 207
372 iso_pu_bacteria 2838042994 2838045647 207
373 iso_pu_bacteria 2838686498 2838686605 207
374 iso_pu_bacteria 2838707686 2838711176 207
375 iso_pu_bacteria 2838729681 2838734847 207
376 iso_pu_bacteria 2838742623 2838747462 207
377 iso_pu_bacteria 2841851746 2841854434 207
378 iso_pu_bacteria 2842077413 2842079352 207
379 iso_pu_bacteria 2842110456 2842115542 207
380 iso_pu_bacteria 2842156927 2842158547 207
381 iso_pu_bacteria 2842163707 2842169007 207
382 iso_pu_bacteria 2842180545 2842182161 207
383 iso_pu_bacteria 2842198810 2842198922 207
384 iso_pu_bacteria 2842217011 2842218394 207
385 iso_pu_bacteria 2842229732 2842229839 207
386 iso_pu_bacteria 2842243621 2842243728 207
387 iso_pu_bacteria 2842257432 2842258187 207
388 iso_pu_bacteria 2842264693 2842268940 207
389 iso_pu_bacteria 2842271015 2842271857 207
390 iso_pu_bacteria 2842285085 2842285159 207
391 iso_pu_bacteria 2842291075 2842293014 207
392 iso_pu_bacteria 2842304105 2842305470 207
393 iso_pu_bacteria 2842395702 2842400552 207
394 iso_pu_bacteria 2842402390 2842402517 207
395 iso_pu_bacteria 2842409023 2842410112 207
396 iso_pu_bacteria 2842415677 2842416760 207
397 iso_pu_bacteria 2842422224 2842423310 207
398 iso_pu_bacteria 2842428310 2842433138 207
399 iso_pu_bacteria 2842434925 2842439443 207
400 iso_pu_bacteria 2842441272 2842446072 207
401 iso_pu_bacteria 2842462802 2842467323 207
402 iso_pu_bacteria 2842469257 2842474118 207
403 iso_pu_bacteria 2842475841 2842480122 207
404 iso_pu_bacteria 2842482326 2842483682 207
405 iso_pu_bacteria 2842502639 2842505093 207
406 iso_pu_bacteria 2842509118 2842510406 207
407 iso_pu_bacteria 2844454524 2844457903 207
408 iso_pu_bacteria 2852387548 2852390822 207
409 iso_pu_bacteria 2857516855 2857516974 207
410 iso_pu_bacteria 2919100787 2919105625 207
411 iso_pu_bacteria 2919408235 2919410388 207
412 iso_pu_bacteria 2933016740 2933023695 207
413 iso_pu_bacteria 2933570622 2933571277 207
414 iso_pu_bacteria 2933586486 2933591957 207
415 iso_pu_bacteria 2933599457 2933600503 207
416 iso_pu_bacteria 2935901341 2935901449 207
417 iso_pu_bacteria 2996893221 2996898085 207
418 iso_pu_bacteria 8005275841 8005281681 207
419 iso_pu_bacteria 8005289223 8005289612 207
420 iso_pu_bacteria 8005307578 8005314105 207
421 iso_pu_bacteria 8005376324 8005382653 207
422 iso_pu_bacteria 8005460587 8005464250 207
423 iso_pu_bacteria 8005556819 8005561663 207
424 iso_pu_bacteria 8005563573 8005568441 207
425 iso_pu_bacteria 8005570704 8005573022 207
426 iso_pu_bacteria 8005682033 8005682494 207
427 iso_pu_bacteria 8018127388 8018127602 207
428 iso_pu_bacteria 8018163183 8018163317 207
429 iso_pu_bacteria 8018176218 8018178985 207
430 iso_pu_bacteria 8023680758 8023682724 207
431 iso_pu_bacteria 8046767195 8046772614 207
432 iso_pu_bacteria 8056375014 8056377046 207
433 iso_pu_bacteria 8056382006 8056387370 207
434 iso_pu_bacteria 8057575449 8057576926 207
435 iso_pu_bacteria 8057874678 8057881893 207

Structural Annotation

Top 5 Hits

ID Description Score Start End
6apl-assembly5.cif.gz_E crystal structure of human st6galnac2 in complex with cmp 0.5726 2 197
2x62-assembly1.cif.gz_A crystal structure of the sialyltransferase cst-ii y81f in complex with cmp 0.545 2 201
6apl-assembly5.cif.gz_E crystal structure of human st6galnac2 in complex with cmp 0.5431 2 197
7kse-assembly1.cif.gz_A crystal structure of prototype foamy virus protease-reverse transcriptase csh mutant (selenomethionine-labeled) 0.5311 146 198
2x62-assembly1.cif.gz_A crystal structure of the sialyltransferase cst-ii y81f in complex with cmp 0.5288 2 201
ID Description Score Start End Superfamily
af_Q9JM95_64_328_3.90.1480.20 Alpha Beta;Alpha-Beta Complex;sialyltransferase cstii, chain A;Glycosyl transferase family 29 0.6628 2 195 3.90.1480.20
af_Q6ZXC8_116_370_3.90.1480.20 Alpha Beta;Alpha-Beta Complex;sialyltransferase cstii, chain A;Glycosyl transferase family 29 0.6373 2 196 3.90.1480.20
af_Q9JM95_64_328_3.90.1480.20 Alpha Beta;Alpha-Beta Complex;sialyltransferase cstii, chain A;Glycosyl transferase family 29 0.6241 2 195 3.90.1480.20
af_Q6ZXC8_116_370_3.90.1480.20 Alpha Beta;Alpha-Beta Complex;sialyltransferase cstii, chain A;Glycosyl transferase family 29 0.6021 2 196 3.90.1480.20
af_Q5P990_86_405_3.90.1480.20 Alpha Beta;Alpha-Beta Complex;sialyltransferase cstii, chain A;Glycosyl transferase family 29 0.6008 2 197 3.90.1480.20
ID Description Score Start End GO Terms
AF-A0A7W5QHW5-F1-model_v4 deleted 0.9743 2 149
AF-A0A7W9ZXR5-F1-model_v4 Urease operon accessory protein 0.9667 2 200
AF-A0A7C1SWT7-F1-model_v4 Urease operon accessory protein 0.9573 1 78
AF-A0A0Q5ENI2-F1-model_v4 deleted 0.957 1 195
AF-A0A0Q4W7T7-F1-model_v4 deleted 0.9565 1 195

Feature Viewer

pLDDT pTM Quality
89.68 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map