F443428

General Info

Members Datasets Scaffolds Average Seq Length
435 237 870 87

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0324788|Ga0495619_0324788_66_383
Length 105
Sequence MPVVAVTLFSTSDILEGGVEMDVNEPRVRRRGFFLHSDTTGEPETGELENPEGFTVRVRISRPAVPRQVASAAGRSRTTSRAEDTRPEIRSGSVTGSRQRAHLPR

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 4.37
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0324788 3300053085 Bacteria 1065
2 JGI24751J29686_10071322 3300002459 Unclassified 717
3 Ga0007416J51690_1039095 3300003577 Unclassified 615
4 Ga0058860_12161653 3300004801 Bacteria 619
5 Ga0065715_10056673 3300005293 Bacteria 778
6 Ga0065715_11152983 3300005293 Bacteria 506
7 Ga0070676_10210682 3300005328 Bacteria 1279
8 Ga0070690_100002101 3300005330 Bacteria 10634
9 Ga0070670_100349011 3300005331 Bacteria 1300
10 Ga0068869_100053348 3300005334 Bacteria 2939
11 Ga0068869_100563263 3300005334 Bacteria 959
12 Ga0070666_10013764 3300005335 Bacteria 5138
13 Ga0070680_100317162 3300005336 Bacteria 1323
14 Ga0070682_100889962 3300005337 Bacteria 731
15 Ga0068868_100274247 3300005338 Bacteria 1426
16 Ga0068868_102189600 3300005338 Bacteria 527
17 Ga0070660_101289952 3300005339 Bacteria 620
18 Ga0070687_100006263 3300005343 Bacteria 4870
19 Ga0070687_100584770 3300005343 Bacteria 765
20 Ga0070687_100880085 3300005343 Bacteria 641
21 Ga0070687_101024389 3300005343 Bacteria 600
22 Ga0070687_101219004 3300005343 Bacteria 555
23 Ga0070661_100395408 3300005344 Bacteria 1092
24 Ga0070661_100584287 3300005344 Bacteria 902
25 Ga0070668_100734569 3300005347 Bacteria 873
26 Ga0070669_100214517 3300005353 Bacteria 1520
27 Ga0070675_102228288 3300005354 Bacteria 505
28 Ga0070671_101110532 3300005355 Bacteria 695
29 Ga0070673_100554024 3300005364 Bacteria 1045
30 Ga0070688_100173802 3300005365 Bacteria 1489
31 Ga0070688_100589379 3300005365 Bacteria 850
32 Ga0070659_100179320 3300005366 Bacteria 1738
33 Ga0070659_101470322 3300005366 Bacteria 607
34 Ga0070667_100536211 3300005367 Bacteria 1075
35 Ga0070713_101274914 3300005436 Bacteria 712
36 Ga0070710_10903380 3300005437 Bacteria 638
37 Ga0070701_10382910 3300005438 Bacteria 887
38 Ga0070705_100096177 3300005440 Bacteria 1858
39 Ga0070705_100634420 3300005440 Bacteria 831
40 Ga0070700_101715679 3300005441 Unclassified 539
41 Ga0070694_100288884 3300005444 Bacteria 1253
42 Ga0070678_100398037 3300005456 Bacteria 1196
43 Ga0070678_101856207 3300005456 Bacteria 569
44 Ga0070662_100829671 3300005457 Bacteria 787
45 Ga0070681_11314541 3300005458 Bacteria 646
46 Ga0068867_100253647 3300005459 Bacteria 1431
47 Ga0070685_10037459 3300005466 Bacteria 2747
48 Ga0070706_100535165 3300005467 Bacteria 1090
49 Ga0070706_100839400 3300005467 Bacteria 850
50 Ga0070706_101806341 3300005467 Bacteria 556
51 Ga0070707_100124821 3300005468 Bacteria 2500
52 Ga0070707_100169219 3300005468 Bacteria 2129
53 Ga0070707_100582798 3300005468 Bacteria 1081
54 Ga0070707_101212787 3300005468 Bacteria 721
55 Ga0070698_100015040 3300005471 Bacteria 8181
56 Ga0070698_101915830 3300005471 Bacteria 546
57 Ga0070699_100029666 3300005518 Bacteria 4717
58 Ga0070699_100202688 3300005518 Bacteria 1765
59 Ga0070699_100956909 3300005518 Bacteria 785
60 Ga0070699_101466788 3300005518 Bacteria 626
61 Ga0070679_100495310 3300005530 Bacteria 1166
62 Ga0070679_101908963 3300005530 Bacteria 543
63 Ga0070684_100498465 3300005535 Bacteria 1128
64 Ga0070697_100184347 3300005536 Bacteria 1770
65 Ga0070697_101047240 3300005536 Bacteria 726
66 Ga0070697_101475952 3300005536 Bacteria 608
67 Ga0070672_100058077 3300005543 Bacteria 3039
68 Ga0070672_102001596 3300005543 Bacteria 522
69 Ga0070686_100000937 3300005544 Bacteria 16784
70 Ga0070686_100956534 3300005544 Bacteria 700
71 Ga0070686_101141300 3300005544 Unclassified 645
72 Ga0070695_100398485 3300005545 Bacteria 1043
73 Ga0070695_100498251 3300005545 Bacteria 942
74 Ga0070695_100930211 3300005545 Bacteria 704
75 Ga0070696_100222785 3300005546 Bacteria 1416
76 Ga0070696_100900955 3300005546 Bacteria 734
77 Ga0070696_101855092 3300005546 Bacteria 522
78 Ga0070665_100002716 3300005548 Bacteria 19180
79 Ga0070665_100007034 3300005548 Bacteria 11432
80 Ga0070665_100033801 3300005548 Bacteria 5143
81 Ga0070704_100279301 3300005549 Bacteria 1383
82 Ga0070704_101376045 3300005549 Unclassified 647
83 Ga0068855_100166904 3300005563 Bacteria 2495
84 Ga0068855_101009700 3300005563 Bacteria 874
85 Ga0068855_101430415 3300005563 Bacteria 712
86 Ga0070664_100785655 3300005564 Bacteria 890
87 Ga0070664_100803263 3300005564 Bacteria 880
88 Ga0068857_100868972 3300005577 Bacteria 864
89 Ga0068854_100460740 3300005578 Bacteria 1064
90 Ga0068854_101571973 3300005578 Bacteria 599
91 Ga0068856_100077177 3300005614 Bacteria 3301
92 Ga0068852_101596781 3300005616 Bacteria 675
93 Ga0068864_100023820 3300005618 Bacteria 5144
94 Ga0068864_101159288 3300005618 Bacteria 770
95 Ga0068861_100125565 3300005719 Bacteria 2075
96 Ga0068861_102101810 3300005719 Bacteria 565
97 Ga0068861_102433003 3300005719 Bacteria 527
98 Ga0068851_10258550 3300005834 Bacteria 990
99 Ga0068863_100053269 3300005841 Bacteria 3834
100 Ga0068863_100227682 3300005841 Bacteria 1798
101 Ga0068863_100241926 3300005841 Bacteria 1742
102 Ga0068863_101562515 3300005841 Bacteria 669
103 Ga0068858_100008146 3300005842 Bacteria 10074
104 Ga0068858_100012756 3300005842 Bacteria 7919
105 Ga0068858_100430524 3300005842 Bacteria 1269
106 Ga0068860_100189782 3300005843 Bacteria 1988
107 Ga0068860_100756287 3300005843 Bacteria 984
108 Ga0068860_100900253 3300005843 Bacteria 901
109 Ga0068860_101225855 3300005843 Bacteria 771
110 Ga0068862_100013972 3300005844 Bacteria 6656
111 Ga0068862_101324953 3300005844 Bacteria 722
112 Ga0068862_101387812 3300005844 Bacteria 706
113 Ga0081540_1323337 3300005983 Bacteria 529
114 Ga0075363_100774839 3300006048 Bacteria 582
115 Ga0070715_10154182 3300006163 Bacteria 1129
116 Ga0070715_10279274 3300006163 Bacteria 885
117 Ga0070715_11068221 3300006163 Bacteria 507
118 Ga0070716_100505073 3300006173 Bacteria 893
119 Ga0070716_100894714 3300006173 Bacteria 695
120 Ga0070716_101088633 3300006173 Bacteria 637
121 Ga0097621_100003330 3300006237 Bacteria 11056
122 Ga0097621_100065341 3300006237 Bacteria 2994
123 Ga0097621_100345722 3300006237 Bacteria 1321
124 Ga0097621_101364553 3300006237 Bacteria 671
125 Ga0068871_100022631 3300006358 Bacteria 4848
126 Ga0068871_101160384 3300006358 Bacteria 724
127 Ga0075433_10171473 3300006852 Bacteria 1931
128 Ga0075433_10221956 3300006852 Bacteria 1679
129 Ga0075433_10528375 3300006852 Bacteria 1038
130 Ga0075434_100002262 3300006871 Bacteria 16850
131 Ga0075434_100021725 3300006871 Bacteria 6241
132 Ga0075434_100155900 3300006871 Bacteria 2303
133 Ga0075434_100175994 3300006871 Bacteria 2160
134 Ga0075434_100273705 3300006871 Bacteria 1708
135 Ga0075434_100595430 3300006871 Bacteria 1125
136 Ga0075434_100813036 3300006871 Bacteria 951
137 Ga0075434_101436324 3300006871 Bacteria 700
138 Ga0075429_100710012 3300006880 Bacteria 881
139 Ga0068865_100018047 3300006881 Bacteria 4548
140 Ga0068865_100104646 3300006881 Bacteria 2078
141 Ga0075436_100003654 3300006914 Bacteria 10533
142 Ga0075436_100018012 3300006914 Bacteria 4837
143 Ga0075436_100390185 3300006914 Bacteria 1008
144 Ga0075436_100624996 3300006914 Bacteria 794
145 Ga0075436_101184334 3300006914 Bacteria 576
146 Ga0075435_100000034 3300007076 Bacteria 70048
147 Ga0075435_100000413 3300007076 Bacteria 26254
148 Ga0075435_100069042 3300007076 Bacteria 2880
149 Ga0075435_100111210 3300007076 Bacteria 2279
150 Ga0075435_100286439 3300007076 Bacteria 1407
151 Ga0075435_101724522 3300007076 Bacteria 550
152 Ga0075435_101872721 3300007076 Bacteria 527
153 Ga0105245_10507294 3300009098 Bacteria 1223
154 Ga0114129_10528517 3300009147 Bacteria 1537
155 Ga0105242_11211880 3300009176 Bacteria 774
156 Ga0105248_10082428 3300009177 Bacteria 3617
157 Ga0105248_10113706 3300009177 Bacteria 3053
158 Ga0105248_13475897 3300009177 Bacteria 500
159 Ga0105239_13370531 3300010375 Bacteria 520
160 Ga0157372_10561391 3300013307 Bacteria 1331
161 Ga0157375_11187405 3300013308 Bacteria 895
162 Ga0157380_10991774 3300014326 Bacteria 873
163 Ga0157379_11712397 3300014968 Bacteria 616
164 Ga0157379_11898727 3300014968 Bacteria 587
165 Ga0157379_12624839 3300014968 Bacteria 505
166 Ga0157376_11256569 3300014969 Bacteria 770
167 Ga0163161_10190785 3300017792 Bacteria 1575
168 Ga0206356_10699489 3300020070 Bacteria 525
169 Ga0224712_10371140 3300022467 Bacteria 679
170 Ga0207656_10145698 3300025321 Bacteria 1119
171 Ga0207642_10462910 3300025899 Bacteria 770
172 Ga0207710_10029388 3300025900 Bacteria 2392
173 Ga0207710_10402884 3300025900 Bacteria 702
174 Ga0207680_10007831 3300025903 Bacteria 5223
175 Ga0207680_10060347 3300025903 Bacteria 2308
176 Ga0207680_10572776 3300025903 Bacteria 807
177 Ga0207685_10271290 3300025905 Bacteria 829
178 Ga0207684_10954853 3300025910 Bacteria 719
179 Ga0207684_11535131 3300025910 Bacteria 541
180 Ga0207671_10524031 3300025914 Bacteria 945
181 Ga0207660_11214633 3300025917 Bacteria 613
182 Ga0207662_10144483 3300025918 Bacteria 1509
183 Ga0207662_10478653 3300025918 Bacteria 855
184 Ga0207662_10674028 3300025918 Bacteria 723
185 Ga0207657_10013041 3300025919 Bacteria 8168
186 Ga0207649_10040600 3300025920 Bacteria 2829
187 Ga0207652_10441640 3300025921 Bacteria 1173
188 Ga0207681_10432623 3300025923 Bacteria 1068
189 Ga0207694_10451692 3300025924 Bacteria 1073
190 Ga0207694_10823216 3300025924 Bacteria 784
191 Ga0207650_10079417 3300025925 Bacteria 2485
192 Ga0207650_10335119 3300025925 Bacteria 1241
193 Ga0207687_11056740 3300025927 Bacteria 697
194 Ga0207687_11183403 3300025927 Bacteria 657
195 Ga0207644_10172035 3300025931 Bacteria 1692
196 Ga0207644_11283116 3300025931 Bacteria 615
197 Ga0207690_10334011 3300025932 Bacteria 1194
198 Ga0207706_11157447 3300025933 Bacteria 644
199 Ga0207686_10005659 3300025934 Bacteria 6696
200 Ga0207686_10010078 3300025934 Bacteria 5141
201 Ga0207686_10014686 3300025934 Bacteria 4366
202 Ga0207686_11175396 3300025934 Bacteria 627
203 Ga0207709_10544254 3300025935 Bacteria 912
204 Ga0207670_10259835 3300025936 Bacteria 1345
205 Ga0207669_10428591 3300025937 Bacteria 1043
206 Ga0207669_10461342 3300025937 Bacteria 1009
207 Ga0207669_11645170 3300025937 Bacteria 548
208 Ga0207704_10075743 3300025938 Bacteria 2153
209 Ga0207704_11496473 3300025938 Bacteria 579
210 Ga0207665_10938647 3300025939 Bacteria 687
211 Ga0207691_10010979 3300025940 Bacteria 8690
212 Ga0207691_10089883 3300025940 Bacteria 2753
213 Ga0207691_10102050 3300025940 Bacteria 2559
214 Ga0207711_10852451 3300025941 Bacteria 848
215 Ga0207711_11008595 3300025941 Bacteria 772
216 Ga0207711_11239715 3300025941 Bacteria 687
217 Ga0207711_11251221 3300025941 Bacteria 684
218 Ga0207689_10072902 3300025942 Bacteria 2821
219 Ga0207689_10303462 3300025942 Bacteria 1323
220 Ga0207689_10382930 3300025942 Bacteria 1171
221 Ga0207661_10301213 3300025944 Bacteria 1437
222 Ga0207661_11039385 3300025944 Bacteria 754
223 Ga0207679_11590251 3300025945 Bacteria 599
224 Ga0207667_10369008 3300025949 Bacteria 1463
225 Ga0207651_10553569 3300025960 Bacteria 1001
226 Ga0207651_11806886 3300025960 Bacteria 550
227 Ga0207651_11941248 3300025960 Bacteria 529
228 Ga0207712_10093821 3300025961 Bacteria 2215
229 Ga0207712_10567303 3300025961 Bacteria 978
230 Ga0207712_11767242 3300025961 Unclassified 554
231 Ga0207640_10143273 3300025981 Bacteria 1745
232 Ga0207658_10237531 3300025986 Bacteria 1542
233 Ga0207677_10127319 3300026023 Bacteria 1927
234 Ga0207677_10564489 3300026023 Bacteria 994
235 Ga0207677_11981887 3300026023 Bacteria 541
236 Ga0207677_12188931 3300026023 Bacteria 514
237 Ga0207703_10007330 3300026035 Bacteria 8769
238 Ga0207703_10123225 3300026035 Bacteria 2228
239 Ga0207703_10171212 3300026035 Bacteria 1910
240 Ga0207703_10196920 3300026035 Bacteria 1788
241 Ga0207703_10448501 3300026035 Bacteria 1205
242 Ga0207703_10511004 3300026035 Bacteria 1129
243 Ga0207703_12410188 3300026035 Bacteria 502
244 Ga0207639_10408602 3300026041 Bacteria 1225
245 Ga0207702_10142526 3300026078 Bacteria 2170
246 Ga0207641_10001180 3300026088 Bacteria 26217
247 Ga0207641_10513426 3300026088 Bacteria 1165
248 Ga0207641_10710225 3300026088 Bacteria 990
249 Ga0207676_10209209 3300026095 Bacteria 1729
250 Ga0207676_10264316 3300026095 Bacteria 1555
251 Ga0207676_10816379 3300026095 Bacteria 910
252 Ga0207676_12223660 3300026095 Bacteria 546
253 Ga0207674_10859131 3300026116 Bacteria 875
254 Ga0207674_10930207 3300026116 Bacteria 838
255 Ga0207674_10998083 3300026116 Bacteria 806
256 Ga0207675_100209588 3300026118 Bacteria 1874
257 Ga0207675_100793493 3300026118 Bacteria 960
258 Ga0207683_10206462 3300026121 Bacteria 1787
259 Ga0207683_10238692 3300026121 Bacteria 1658
260 Ga0207683_10454464 3300026121 Bacteria 1181
261 Ga0207683_11045121 3300026121 Bacteria 758
262 Ga0207428_10327788 3300027907 Bacteria 1130
263 Ga0207428_11287670 3300027907 Bacteria 507
264 Ga0268266_10020014 3300028379 Bacteria 5704
265 Ga0268266_10020137 3300028379 Bacteria 5686
266 Ga0268266_10086990 3300028379 Bacteria 2733
267 Ga0268266_12035215 3300028379 Bacteria 547
268 Ga0268265_10020084 3300028380 Bacteria 4657
269 Ga0268265_10474232 3300028380 Bacteria 1174
270 Ga0268265_10917469 3300028380 Bacteria 861
271 Ga0268265_11147868 3300028380 Bacteria 773
272 Ga0268265_11817801 3300028380 Bacteria 616
273 Ga0268264_10227867 3300028381 Bacteria 1719
274 Ga0268264_10799607 3300028381 Bacteria 942
275 Ga0268264_12384482 3300028381 Bacteria 535
276 Ga0307413_11556268 3300031824 Bacteria 586
277 Ga0373930_0009621 3300034816 Bacteria 1713
278 Ga0373948_0015794 3300034817 Bacteria 1389
279 Ga0373950_0001170 3300034818 Bacteria 3373
280 Ga0373959_0006751 3300034820 Bacteria 1914
281 Ga0373938_0001722 3300034957 Bacteria 3490
282 Ga0373926_0016652 3300035083 Bacteria 2518
283 Ga0373928_0001989 3300035084 Bacteria 3981
284 Ga0373929_0003257 3300035085 Bacteria 2934
285 Ga0373934_0092911 3300035086 Bacteria 1217
286 Ga0373940_0008841 3300035088 Bacteria 2325
287 Ga0373949_0004522 3300035090 Bacteria 3176
288 Ga0373949_0197428 3300035090 Bacteria 603
289 Ga0373951_0001257 3300035091 Bacteria 6710
290 Ga0373952_0001122 3300035092 Bacteria 4895
291 Ga0373932_0002991 3300035112 Bacteria 4146
292 Ga0373939_0030164 3300035114 Bacteria 1557
293 Ga0373941_0009703 3300035115 Bacteria 2430
294 Ga0373945_0032518 3300035116 Bacteria 1849
295 Ga0373945_0124065 3300035116 Bacteria 1029
296 Ga0373945_0159520 3300035116 Bacteria 919
297 Ga0373953_0156046 3300035117 Bacteria 980
298 Ga0373953_0314859 3300035117 Bacteria 684
299 Ga0373954_0267636 3300035118 Bacteria 842
300 Ga0373954_0664128 3300035118 Bacteria 517
301 Ga0373957_0296609 3300035120 Bacteria 685
302 Ga0373960_0000203 3300035121 Bacteria 10878
303 Ga0373943_0047953 3300035170 Bacteria 2091
304 Ga0373943_0473574 3300035170 Bacteria 730
305 Ga0373946_0002551 3300035171 Bacteria 6436
306 Ga0373955_0166347 3300035172 Bacteria 1304
307 Ga0373942_0001244 3300035207 Bacteria 6689
308 Ga0373961_0002694 3300035241 Bacteria 4544
309 Ga0373962_0002529 3300035242 Bacteria 4340
310 Ga0373924_0009788 3300035410 Bacteria 3521
311 Ga0373924_0294984 3300035410 Bacteria 720
312 Ga0373931_0625566 3300035691 Bacteria 705
313 Ga0373931_1005473 3300035691 Bacteria 564
314 Ga0373935_0102172 3300035692 Bacteria 1892
315 Ga0373935_0562029 3300035692 Bacteria 832
316 Ga0373927_0408261 3300035695 Bacteria 896
317 Ga0373933_0253690 3300035724 Bacteria 1133
318 Ga0373933_0310806 3300035724 Bacteria 1021
319 Ga0373933_0451582 3300035724 Bacteria 841
320 Ga0373933_0695064 3300035724 Bacteria 669
321 Ga0373947_0016930 3300035725 Bacteria 4188
322 Ga0373947_0065858 3300035725 Bacteria 2210
323 Ga0373947_0136086 3300035725 Bacteria 1572
324 Ga0373937_0201301 3300036401 Bacteria 1872
325 Ga0373937_0995416 3300036401 Bacteria 787
326 Ga0373937_1943018 3300036401 Bacteria 534
327 Ga0373925_0031931 3300037068 Bacteria 3874
328 Ga0373925_0230520 3300037068 Bacteria 1481
329 Ga0439465_0240954 3300041413 Bacteria 667
330 Ga0451853_0697802 3300041512 Bacteria 797
331 Ga0439434_0166019 3300042435 Bacteria 735
332 Ga0451576_0172815 3300045051 Bacteria 2255
333 Ga0451576_1218984 3300045051 Bacteria 786
334 Ga0466967_0388123 3300045976 Bacteria 1357
335 Ga0466967_0631851 3300045976 Bacteria 1058
336 Ga0495629_0107353 3300046459 Bacteria 1947
337 Ga0495629_1095240 3300046459 Bacteria 515
338 Ga0495651_1005909 3300046462 Bacteria 506
339 Ga0495653_0206446 3300046463 Bacteria 1330
340 Ga0495580_0347430 3300046472 Bacteria 1005
341 Ga0495594_0530722 3300046499 Bacteria 668
342 Ga0495608_0426613 3300046511 Bacteria 809
343 Ga0495628_0522412 3300046516 Bacteria 855
344 Ga0495628_0634992 3300046516 Bacteria 760
345 Ga0495630_1288859 3300046517 Bacteria 551
346 Ga0495642_0560719 3300046528 Bacteria 507
347 Ga0495652_0278937 3300046529 Bacteria 1225
348 Ga0495640_0682872 3300046533 Bacteria 617
349 Ga0495587_0552449 3300046536 Bacteria 635
350 Ga0495587_0640501 3300046536 Bacteria 584
351 Ga0495645_0054759 3300046543 Bacteria 2897
352 Ga0495633_0353887 3300046558 Bacteria 665
353 Ga0495667_0250159 3300046559 Bacteria 1128
354 Ga0495634_0330150 3300046642 Bacteria 917
355 Ga0495634_0440082 3300046642 Bacteria 770
356 Ga0495657_0170594 3300046675 Bacteria 1340
357 Ga0495599_0364869 3300046678 Bacteria 864
358 Ga0495599_0678201 3300046678 Bacteria 595
359 Ga0495623_0276293 3300046679 Bacteria 936
360 Ga0495658_0590192 3300046683 Bacteria 712
361 Ga0495669_0209330 3300046684 Bacteria 933
362 Ga0495613_0276169 3300046689 Bacteria 1168
363 Ga0495671_0355186 3300046692 Bacteria 703
364 Ga0495600_0081988 3300046809 Bacteria 2105
365 Ga0495604_0616754 3300047317 Bacteria 694
366 Ga0495680_0613036 3300047322 Bacteria 727
367 Ga0495675_0467401 3300047444 Bacteria 728
368 Ga0495593_0598938 3300047673 Bacteria 553
369 Ga0496104_0131951 3300048907 Bacteria 2400
370 Ga0496104_0781134 3300048907 Bacteria 861
371 Ga0496104_1653310 3300048907 Bacteria 543
372 Ga0496105_0142685 3300048908 Bacteria 1971
373 Ga0496105_0370534 3300048908 Bacteria 1141
374 Ga0496106_0049156 3300048909 Bacteria 3177
375 Ga0496106_0082633 3300048909 Bacteria 2469
376 Ga0496106_0167514 3300048909 Bacteria 1740
377 Ga0496107_0048221 3300048910 Bacteria 3068
378 Ga0496107_0213544 3300048910 Bacteria 1435
379 Ga0496108_0003830 3300048911 Bacteria 12060
380 Ga0496109_0688426 3300048912 Bacteria 960
381 Ga0496112_0014653 3300048915 Bacteria 7285
382 Ga0496114_0090038 3300048917 Bacteria 2604
383 Ga0496114_0098239 3300048917 Bacteria 2496
384 Ga0496114_0768287 3300048917 Bacteria 841
385 Ga0496115_0241317 3300048918 Bacteria 1489
386 Ga0496115_0340329 3300048918 Bacteria 1224
387 Ga0496115_1202047 3300048918 Bacteria 569
388 Ga0501031_0549774 3300049568 Bacteria 744
389 Ga0501036_0605136 3300049572 Bacteria 909
390 Ga0501040_0950531 3300049576 Bacteria 623
391 Ga0501040_1252259 3300049576 Bacteria 538
392 Ga0501074_0987519 3300049590 Bacteria 592
393 Ga0501075_1441761 3300049591 Bacteria 521
394 Ga0501076_0278280 3300049592 Bacteria 1371
395 Ga0501077_0123260 3300049593 Bacteria 1643
396 Ga0501079_0391212 3300049741 Bacteria 1090
397 Ga0501081_0715621 3300049743 Bacteria 752
398 Ga0501083_0319519 3300049744 Bacteria 1010
399 nmdc:mga03n38_387164_c1 3300050490 Bacteria 767
400 nmdc:mga05p37_18421_c1 3300050507 Bacteria 8435
401 nmdc:mga05p37_28582_c1 3300050507 Bacteria 6800
402 nmdc:mga05p37_41722_c1 3300050507 Bacteria 5635
403 nmdc:mga05p37_417645_c1 3300050507 Bacteria 1562
404 nmdc:mga05p37_86166_c1 3300050507 Bacteria 3871
405 nmdc:mga09592_675148_c1 3300050508 Bacteria 881
406 nmdc:mga06r32_464630_c1 3300050510 Bacteria 1244
407 nmdc:mga08y16_175521_c1 3300050511 Bacteria 2225
408 nmdc:mga08y16_47805_c1 3300050511 Bacteria 4478
409 nmdc:mga0n895_274376_c1 3300050512 Bacteria 1710
410 nmdc:mga0n895_327474_c1 3300050512 Bacteria 1552
411 nmdc:mga0n895_780409_c1 3300050512 Bacteria 947
412 nmdc:mga0n895_949_c1 3300050512 Bacteria 17319
413 nmdc:mga0n895_956993_c1 3300050512 Bacteria 839
414 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
415 nmdc:mga0rr50_323_c1 3300050513 Bacteria 25968
416 nmdc:mga0rr50_978284_c1 3300050513 Bacteria 721
417 nmdc:mga08x19_1689_c1 3300050514 Bacteria 13576
418 nmdc:mga08x19_19769_c1 3300050514 Bacteria 4138
419 nmdc:mga08x19_405559_c1 3300050514 Bacteria 957
420 nmdc:mga08x19_70815_c1 3300050514 Bacteria 2273
421 nmdc:mga0a205_1460398_c1 3300050515 Bacteria 532
422 nmdc:mga0a205_1592801_c1 3300050515 Bacteria 502
423 nmdc:mga0a205_303877_c1 3300050515 Bacteria 1468
424 nmdc:mga0a205_682170_c1 3300050515 Bacteria 878
425 Ga0495601_0159289 3300053077 Bacteria 1475
426 Ga0495601_0237314 3300053077 Bacteria 1191
427 Ga0495601_1015841 3300053077 Bacteria 521
428 Ga0495612_0088119 3300053078 Bacteria 1311
429 Ga0495619_0081431 3300053085 Bacteria 2180
430 Ga0495619_0170167 3300053085 Bacteria 1506
431 Ga0495619_1001050 3300053085 Bacteria 559
432 Ga0500658_0263036 3300053134 Bacteria 793
433 Ga0501084_1596876 3300054114 Bacteria 545
434 Ga0587128_149893 3300059630 Bacteria 530
435 Ga0587111_0146784 3300060346 Bacteria 630
436 Ga0495619_0324788
437 JGI24751J29686_10071322
438 Ga0007416J51690_1039095
439 Ga0058860_12161653
440 Ga0065715_10056673
441 Ga0065715_11152983
442 Ga0070676_10210682
443 Ga0070690_100002101
444 Ga0070670_100349011
445 Ga0068869_100053348
446 Ga0068869_100563263
447 Ga0070666_10013764
448 Ga0070680_100317162
449 Ga0070682_100889962
450 Ga0068868_100274247
451 Ga0068868_102189600
452 Ga0070660_101289952
453 Ga0070687_100006263
454 Ga0070687_100584770
455 Ga0070687_100880085
456 Ga0070687_101024389
457 Ga0070687_101219004
458 Ga0070661_100395408
459 Ga0070661_100584287
460 Ga0070668_100734569
461 Ga0070669_100214517
462 Ga0070675_102228288
463 Ga0070671_101110532
464 Ga0070673_100554024
465 Ga0070688_100173802
466 Ga0070688_100589379
467 Ga0070659_100179320
468 Ga0070659_101470322
469 Ga0070667_100536211
470 Ga0070713_101274914
471 Ga0070710_10903380
472 Ga0070701_10382910
473 Ga0070705_100096177
474 Ga0070705_100634420
475 Ga0070700_101715679
476 Ga0070694_100288884
477 Ga0070678_100398037
478 Ga0070678_101856207
479 Ga0070662_100829671
480 Ga0070681_11314541
481 Ga0068867_100253647
482 Ga0070685_10037459
483 Ga0070706_100535165
484 Ga0070706_100839400
485 Ga0070706_101806341
486 Ga0070707_100124821
487 Ga0070707_100169219
488 Ga0070707_100582798
489 Ga0070707_101212787
490 Ga0070698_100015040
491 Ga0070698_101915830
492 Ga0070699_100029666
493 Ga0070699_100202688
494 Ga0070699_100956909
495 Ga0070699_101466788
496 Ga0070679_100495310
497 Ga0070679_101908963
498 Ga0070684_100498465
499 Ga0070697_100184347
500 Ga0070697_101047240
501 Ga0070697_101475952
502 Ga0070672_100058077
503 Ga0070672_102001596
504 Ga0070686_100000937
505 Ga0070686_100956534
506 Ga0070686_101141300
507 Ga0070695_100398485
508 Ga0070695_100498251
509 Ga0070695_100930211
510 Ga0070696_100222785
511 Ga0070696_100900955
512 Ga0070696_101855092
513 Ga0070665_100002716
514 Ga0070665_100007034
515 Ga0070665_100033801
516 Ga0070704_100279301
517 Ga0070704_101376045
518 Ga0068855_100166904
519 Ga0068855_101009700
520 Ga0068855_101430415
521 Ga0070664_100785655
522 Ga0070664_100803263
523 Ga0068857_100868972
524 Ga0068854_100460740
525 Ga0068854_101571973
526 Ga0068856_100077177
527 Ga0068852_101596781
528 Ga0068864_100023820
529 Ga0068864_101159288
530 Ga0068861_100125565
531 Ga0068861_102101810
532 Ga0068861_102433003
533 Ga0068851_10258550
534 Ga0068863_100053269
535 Ga0068863_100227682
536 Ga0068863_100241926
537 Ga0068863_101562515
538 Ga0068858_100008146
539 Ga0068858_100012756
540 Ga0068858_100430524
541 Ga0068860_100189782
542 Ga0068860_100756287
543 Ga0068860_100900253
544 Ga0068860_101225855
545 Ga0068862_100013972
546 Ga0068862_101324953
547 Ga0068862_101387812
548 Ga0081540_1323337
549 Ga0075363_100774839
550 Ga0070715_10154182
551 Ga0070715_10279274
552 Ga0070715_11068221
553 Ga0070716_100505073
554 Ga0070716_100894714
555 Ga0070716_101088633
556 Ga0097621_100003330
557 Ga0097621_100065341
558 Ga0097621_100345722
559 Ga0097621_101364553
560 Ga0068871_100022631
561 Ga0068871_101160384
562 Ga0075433_10171473
563 Ga0075433_10221956
564 Ga0075433_10528375
565 Ga0075434_100002262
566 Ga0075434_100021725
567 Ga0075434_100155900
568 Ga0075434_100175994
569 Ga0075434_100273705
570 Ga0075434_100595430
571 Ga0075434_100813036
572 Ga0075434_101436324
573 Ga0075429_100710012
574 Ga0068865_100018047
575 Ga0068865_100104646
576 Ga0075436_100003654
577 Ga0075436_100018012
578 Ga0075436_100390185
579 Ga0075436_100624996
580 Ga0075436_101184334
581 Ga0075435_100000034
582 Ga0075435_100000413
583 Ga0075435_100069042
584 Ga0075435_100111210
585 Ga0075435_100286439
586 Ga0075435_101724522
587 Ga0075435_101872721
588 Ga0105245_10507294
589 Ga0114129_10528517
590 Ga0105242_11211880
591 Ga0105248_10082428
592 Ga0105248_10113706
593 Ga0105248_13475897
594 Ga0105239_13370531
595 Ga0157372_10561391
596 Ga0157375_11187405
597 Ga0157380_10991774
598 Ga0157379_11712397
599 Ga0157379_11898727
600 Ga0157379_12624839
601 Ga0157376_11256569
602 Ga0163161_10190785
603 Ga0206356_10699489
604 Ga0224712_10371140
605 Ga0207656_10145698
606 Ga0207642_10462910
607 Ga0207710_10029388
608 Ga0207710_10402884
609 Ga0207680_10007831
610 Ga0207680_10060347
611 Ga0207680_10572776
612 Ga0207685_10271290
613 Ga0207684_10954853
614 Ga0207684_11535131
615 Ga0207671_10524031
616 Ga0207660_11214633
617 Ga0207662_10144483
618 Ga0207662_10478653
619 Ga0207662_10674028
620 Ga0207657_10013041
621 Ga0207649_10040600
622 Ga0207652_10441640
623 Ga0207681_10432623
624 Ga0207694_10451692
625 Ga0207694_10823216
626 Ga0207650_10079417
627 Ga0207650_10335119
628 Ga0207687_11056740
629 Ga0207687_11183403
630 Ga0207644_10172035
631 Ga0207644_11283116
632 Ga0207690_10334011
633 Ga0207706_11157447
634 Ga0207686_10005659
635 Ga0207686_10010078
636 Ga0207686_10014686
637 Ga0207686_11175396
638 Ga0207709_10544254
639 Ga0207670_10259835
640 Ga0207669_10428591
641 Ga0207669_10461342
642 Ga0207669_11645170
643 Ga0207704_10075743
644 Ga0207704_11496473
645 Ga0207665_10938647
646 Ga0207691_10010979
647 Ga0207691_10089883
648 Ga0207691_10102050
649 Ga0207711_10852451
650 Ga0207711_11008595
651 Ga0207711_11239715
652 Ga0207711_11251221
653 Ga0207689_10072902
654 Ga0207689_10303462
655 Ga0207689_10382930
656 Ga0207661_10301213
657 Ga0207661_11039385
658 Ga0207679_11590251
659 Ga0207667_10369008
660 Ga0207651_10553569
661 Ga0207651_11806886
662 Ga0207651_11941248
663 Ga0207712_10093821
664 Ga0207712_10567303
665 Ga0207712_11767242
666 Ga0207640_10143273
667 Ga0207658_10237531
668 Ga0207677_10127319
669 Ga0207677_10564489
670 Ga0207677_11981887
671 Ga0207677_12188931
672 Ga0207703_10007330
673 Ga0207703_10123225
674 Ga0207703_10171212
675 Ga0207703_10196920
676 Ga0207703_10448501
677 Ga0207703_10511004
678 Ga0207703_12410188
679 Ga0207639_10408602
680 Ga0207702_10142526
681 Ga0207641_10001180
682 Ga0207641_10513426
683 Ga0207641_10710225
684 Ga0207676_10209209
685 Ga0207676_10264316
686 Ga0207676_10816379
687 Ga0207676_12223660
688 Ga0207674_10859131
689 Ga0207674_10930207
690 Ga0207674_10998083
691 Ga0207675_100209588
692 Ga0207675_100793493
693 Ga0207683_10206462
694 Ga0207683_10238692
695 Ga0207683_10454464
696 Ga0207683_11045121
697 Ga0207428_10327788
698 Ga0207428_11287670
699 Ga0268266_10020014
700 Ga0268266_10020137
701 Ga0268266_10086990
702 Ga0268266_12035215
703 Ga0268265_10020084
704 Ga0268265_10474232
705 Ga0268265_10917469
706 Ga0268265_11147868
707 Ga0268265_11817801
708 Ga0268264_10227867
709 Ga0268264_10799607
710 Ga0268264_12384482
711 Ga0307413_11556268
712 Ga0373930_0009621
713 Ga0373948_0015794
714 Ga0373950_0001170
715 Ga0373959_0006751
716 Ga0373938_0001722
717 Ga0373926_0016652
718 Ga0373928_0001989
719 Ga0373929_0003257
720 Ga0373934_0092911
721 Ga0373940_0008841
722 Ga0373949_0004522
723 Ga0373949_0197428
724 Ga0373951_0001257
725 Ga0373952_0001122
726 Ga0373932_0002991
727 Ga0373939_0030164
728 Ga0373941_0009703
729 Ga0373945_0032518
730 Ga0373945_0124065
731 Ga0373945_0159520
732 Ga0373953_0156046
733 Ga0373953_0314859
734 Ga0373954_0267636
735 Ga0373954_0664128
736 Ga0373957_0296609
737 Ga0373960_0000203
738 Ga0373943_0047953
739 Ga0373943_0473574
740 Ga0373946_0002551
741 Ga0373955_0166347
742 Ga0373942_0001244
743 Ga0373961_0002694
744 Ga0373962_0002529
745 Ga0373924_0009788
746 Ga0373924_0294984
747 Ga0373931_0625566
748 Ga0373931_1005473
749 Ga0373935_0102172
750 Ga0373935_0562029
751 Ga0373927_0408261
752 Ga0373933_0253690
753 Ga0373933_0310806
754 Ga0373933_0451582
755 Ga0373933_0695064
756 Ga0373947_0016930
757 Ga0373947_0065858
758 Ga0373947_0136086
759 Ga0373937_0201301
760 Ga0373937_0995416
761 Ga0373937_1943018
762 Ga0373925_0031931
763 Ga0373925_0230520
764 Ga0439465_0240954
765 Ga0451853_0697802
766 Ga0439434_0166019
767 Ga0451576_0172815
768 Ga0451576_1218984
769 Ga0466967_0388123
770 Ga0466967_0631851
771 Ga0495629_0107353
772 Ga0495629_1095240
773 Ga0495651_1005909
774 Ga0495653_0206446
775 Ga0495580_0347430
776 Ga0495594_0530722
777 Ga0495608_0426613
778 Ga0495628_0522412
779 Ga0495628_0634992
780 Ga0495630_1288859
781 Ga0495642_0560719
782 Ga0495652_0278937
783 Ga0495640_0682872
784 Ga0495587_0552449
785 Ga0495587_0640501
786 Ga0495645_0054759
787 Ga0495633_0353887
788 Ga0495667_0250159
789 Ga0495634_0330150
790 Ga0495634_0440082
791 Ga0495657_0170594
792 Ga0495599_0364869
793 Ga0495599_0678201
794 Ga0495623_0276293
795 Ga0495658_0590192
796 Ga0495669_0209330
797 Ga0495613_0276169
798 Ga0495671_0355186
799 Ga0495600_0081988
800 Ga0495604_0616754
801 Ga0495680_0613036
802 Ga0495675_0467401
803 Ga0495593_0598938
804 Ga0496104_0131951
805 Ga0496104_0781134
806 Ga0496104_1653310
807 Ga0496105_0142685
808 Ga0496105_0370534
809 Ga0496106_0049156
810 Ga0496106_0082633
811 Ga0496106_0167514
812 Ga0496107_0048221
813 Ga0496107_0213544
814 Ga0496108_0003830
815 Ga0496109_0688426
816 Ga0496112_0014653
817 Ga0496114_0090038
818 Ga0496114_0098239
819 Ga0496114_0768287
820 Ga0496115_0241317
821 Ga0496115_0340329
822 Ga0496115_1202047
823 Ga0501031_0549774
824 Ga0501036_0605136
825 Ga0501040_0950531
826 Ga0501040_1252259
827 Ga0501074_0987519
828 Ga0501075_1441761
829 Ga0501076_0278280
830 Ga0501077_0123260
831 Ga0501079_0391212
832 Ga0501081_0715621
833 Ga0501083_0319519
834 nmdc:mga03n38_387164_c1
835 nmdc:mga05p37_18421_c1
836 nmdc:mga05p37_28582_c1
837 nmdc:mga05p37_41722_c1
838 nmdc:mga05p37_417645_c1
839 nmdc:mga05p37_86166_c1
840 nmdc:mga09592_675148_c1
841 nmdc:mga06r32_464630_c1
842 nmdc:mga08y16_175521_c1
843 nmdc:mga08y16_47805_c1
844 nmdc:mga0n895_274376_c1
845 nmdc:mga0n895_327474_c1
846 nmdc:mga0n895_780409_c1
847 nmdc:mga0n895_949_c1
848 nmdc:mga0n895_956993_c1
849 nmdc:mga0rr50_19_c1
850 nmdc:mga0rr50_323_c1
851 nmdc:mga0rr50_978284_c1
852 nmdc:mga08x19_1689_c1
853 nmdc:mga08x19_19769_c1
854 nmdc:mga08x19_405559_c1
855 nmdc:mga08x19_70815_c1
856 nmdc:mga0a205_1460398_c1
857 nmdc:mga0a205_1592801_c1
858 nmdc:mga0a205_303877_c1
859 nmdc:mga0a205_682170_c1
860 Ga0495601_0159289
861 Ga0495601_0237314
862 Ga0495601_1015841
863 Ga0495612_0088119
864 Ga0495619_0081431
865 Ga0495619_0170167
866 Ga0495619_1001050
867 Ga0500658_0263036
868 Ga0501084_1596876
869 Ga0587128_149893
870 Ga0587111_0146784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map