F443368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 267 | 435 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0111443|Ga0373925_0111443_865_1593 |
| Length | 242 |
| Sequence | MRILIRPIPWKRQMEIVSRAQVYVVIPAYNEGTVLSRVVTEVKRAGYAVVVVDDGSTDATADHAHAAGAAVIRHPFNLGQGAALQTGIDYALTQPAQFVVTFDADGQHRVADISRLTEALVRERADFALGSRFLGQAPNLPPLRRLMLQAATLFTRLTTGLQVTDTHNGLRAMTRRGAAALALRQNRMAHASECLSQIGSSGLRYVEQPVTIEYTAYSLAKGQNLRDAVLILLDLFARRLYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 151 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 165 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 166 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 167 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 263 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 264 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.21 |
| Nodule | 0 |
| Rhizoplane | 16.09 |
| Rhizosphere | 77.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1006673 | 3300002070 | Bacteria | 1441 |
| 2 | JGI24742J22300_10013026 | 3300002244 | Bacteria | 1391 |
| 3 | Ga0070676_10142013 | 3300005328 | Bacteria | 1530 |
| 4 | Ga0070683_100053001 | 3300005329 | Bacteria | 3759 |
| 5 | Ga0070690_100264179 | 3300005330 | Bacteria | 1222 |
| 6 | Ga0070670_100083808 | 3300005331 | Bacteria | 2739 |
| 7 | Ga0070677_10039296 | 3300005333 | Unclassified | 1856 |
| 8 | Ga0068869_100470181 | 3300005334 | Bacteria | 1045 |
| 9 | Ga0070680_100369525 | 3300005336 | Bacteria | 1220 |
| 10 | Ga0070682_100063751 | 3300005337 | Bacteria | 2338 |
| 11 | Ga0070689_100104050 | 3300005340 | Bacteria | 2251 |
| 12 | Ga0070689_100355210 | 3300005340 | Bacteria | 1230 |
| 13 | Ga0070691_10104398 | 3300005341 | Bacteria | 1411 |
| 14 | Ga0070687_100066062 | 3300005343 | Bacteria | 1926 |
| 15 | Ga0070661_100096227 | 3300005344 | Bacteria | 2197 |
| 16 | Ga0070692_10031896 | 3300005345 | Bacteria | 2645 |
| 17 | Ga0070692_10047711 | 3300005345 | Bacteria | 2217 |
| 18 | Ga0070668_100083720 | 3300005347 | Bacteria | 2504 |
| 19 | Ga0070669_100049879 | 3300005353 | Bacteria | 3056 |
| 20 | Ga0070669_100356130 | 3300005353 | Bacteria | 1189 |
| 21 | Ga0070675_100080417 | 3300005354 | Bacteria | 2716 |
| 22 | Ga0070675_100376294 | 3300005354 | Bacteria | 1263 |
| 23 | Ga0070671_100281588 | 3300005355 | Bacteria | 1414 |
| 24 | Ga0070673_100030762 | 3300005364 | Bacteria | 4023 |
| 25 | Ga0070688_100012076 | 3300005365 | Bacteria | 4825 |
| 26 | Ga0070659_100012408 | 3300005366 | Bacteria | 6318 |
| 27 | Ga0070667_100048063 | 3300005367 | Bacteria | 3591 |
| 28 | Ga0070667_100235202 | 3300005367 | Bacteria | 1635 |
| 29 | Ga0070714_100004118 | 3300005435 | Bacteria | 10932 |
| 30 | Ga0070713_100001118 | 3300005436 | Bacteria | 17119 |
| 31 | Ga0070710_10001184 | 3300005437 | Bacteria | 12311 |
| 32 | Ga0070711_100008435 | 3300005439 | Bacteria | 6312 |
| 33 | Ga0070711_100185893 | 3300005439 | Bacteria | 1593 |
| 34 | Ga0070700_100081610 | 3300005441 | Bacteria | 2089 |
| 35 | Ga0070678_100658763 | 3300005456 | Bacteria | 940 |
| 36 | Ga0070662_100066855 | 3300005457 | Bacteria | 2638 |
| 37 | Ga0070662_100373542 | 3300005457 | Bacteria | 1172 |
| 38 | Ga0068867_100076991 | 3300005459 | Bacteria | 2506 |
| 39 | Ga0070685_10100644 | 3300005466 | Bacteria | 1764 |
| 40 | Ga0070706_101122414 | 3300005467 | Unclassified | 724 |
| 41 | Ga0070707_100188791 | 3300005468 | Bacteria | 2009 |
| 42 | Ga0070699_100095779 | 3300005518 | Bacteria | 2599 |
| 43 | Ga0070684_100228297 | 3300005535 | Bacteria | 1699 |
| 44 | Ga0070686_100055919 | 3300005544 | Bacteria | 2530 |
| 45 | Ga0070686_100106793 | 3300005544 | Bacteria | 1900 |
| 46 | Ga0070695_100532998 | 3300005545 | Bacteria | 913 |
| 47 | Ga0070665_100022039 | 3300005548 | Bacteria | 6409 |
| 48 | Ga0070665_100139404 | 3300005548 | Bacteria | 2429 |
| 49 | Ga0070704_100170908 | 3300005549 | Bacteria | 1729 |
| 50 | Ga0070664_100111343 | 3300005564 | Bacteria | 2390 |
| 51 | Ga0068857_100208005 | 3300005577 | Bacteria | 1785 |
| 52 | Ga0068857_100235511 | 3300005577 | Bacteria | 1675 |
| 53 | Ga0068856_100067111 | 3300005614 | Bacteria | 3545 |
| 54 | Ga0068852_100181802 | 3300005616 | Bacteria | 1978 |
| 55 | Ga0068864_100012803 | 3300005618 | Bacteria | 6935 |
| 56 | Ga0068866_10017502 | 3300005718 | Bacteria | 3223 |
| 57 | Ga0068861_100079988 | 3300005719 | Bacteria | 2556 |
| 58 | Ga0068861_100235993 | 3300005719 | Unclassified | 1553 |
| 59 | Ga0068870_10002002 | 3300005840 | Bacteria | 8433 |
| 60 | Ga0068870_10316907 | 3300005840 | Bacteria | 990 |
| 61 | Ga0068863_100020579 | 3300005841 | Bacteria | 6306 |
| 62 | Ga0068858_100324213 | 3300005842 | Bacteria | 1472 |
| 63 | Ga0068862_100015319 | 3300005844 | Bacteria | 6367 |
| 64 | Ga0081455_10019031 | 3300005937 | Bacteria | 6512 |
| 65 | Ga0081455_10043942 | 3300005937 | Bacteria | 3904 |
| 66 | Ga0081455_10068174 | 3300005937 | Bacteria | 2962 |
| 67 | Ga0081455_10189558 | 3300005937 | Bacteria | 1550 |
| 68 | Ga0070717_10001698 | 3300006028 | Bacteria | 15327 |
| 69 | Ga0070717_10156192 | 3300006028 | Bacteria | 1977 |
| 70 | Ga0075365_10015278 | 3300006038 | Bacteria | 4640 |
| 71 | Ga0075365_10065109 | 3300006038 | Bacteria | 2442 |
| 72 | Ga0075365_10081034 | 3300006038 | Bacteria | 2198 |
| 73 | Ga0075365_10121789 | 3300006038 | Bacteria | 1800 |
| 74 | Ga0075365_10159171 | 3300006038 | Bacteria | 1573 |
| 75 | Ga0075365_10197905 | 3300006038 | Bacteria | 1407 |
| 76 | Ga0075368_10012815 | 3300006042 | Bacteria | 3072 |
| 77 | Ga0075368_10109939 | 3300006042 | Bacteria | 1136 |
| 78 | Ga0070715_10000121 | 3300006163 | Bacteria | 18586 |
| 79 | Ga0070716_100065679 | 3300006173 | Bacteria | 2114 |
| 80 | Ga0070712_100008593 | 3300006175 | Bacteria | 6425 |
| 81 | Ga0075362_10008686 | 3300006177 | Bacteria | 3900 |
| 82 | Ga0075367_10132176 | 3300006178 | Bacteria | 1543 |
| 83 | Ga0075367_10164807 | 3300006178 | Bacteria | 1379 |
| 84 | Ga0097621_100016412 | 3300006237 | Bacteria | 5598 |
| 85 | Ga0075370_10014940 | 3300006353 | Bacteria | 4149 |
| 86 | Ga0068871_100145251 | 3300006358 | Bacteria | 2019 |
| 87 | Ga0068871_100222938 | 3300006358 | Bacteria | 1634 |
| 88 | Ga0075428_100081230 | 3300006844 | Bacteria | 3537 |
| 89 | Ga0075428_100100970 | 3300006844 | Bacteria | 3145 |
| 90 | Ga0075428_100519090 | 3300006844 | Bacteria | 1274 |
| 91 | Ga0075431_100254844 | 3300006847 | Bacteria | 1782 |
| 92 | Ga0075431_100349127 | 3300006847 | Bacteria | 1488 |
| 93 | Ga0075431_100488215 | 3300006847 | Bacteria | 1224 |
| 94 | Ga0075431_100680303 | 3300006847 | Bacteria | 1007 |
| 95 | Ga0075433_10034418 | 3300006852 | Bacteria | 4351 |
| 96 | Ga0075433_10151629 | 3300006852 | Bacteria | 2062 |
| 97 | Ga0075434_100009717 | 3300006871 | Bacteria | 8988 |
| 98 | Ga0075434_100201149 | 3300006871 | Bacteria | 2012 |
| 99 | Ga0068865_100037203 | 3300006881 | Bacteria | 3285 |
| 100 | Ga0068865_100151967 | 3300006881 | Bacteria | 1757 |
| 101 | Ga0099794_10009734 | 3300007265 | Bacteria | 4055 |
| 102 | Ga0099795_10002353 | 3300007788 | Bacteria | 4423 |
| 103 | Ga0099795_10002912 | 3300007788 | Unclassified | 4144 |
| 104 | Ga0111539_10016349 | 3300009094 | Bacteria | 9199 |
| 105 | Ga0111539_10032107 | 3300009094 | Bacteria | 6378 |
| 106 | Ga0111539_10075369 | 3300009094 | Bacteria | 3974 |
| 107 | Ga0111539_10288565 | 3300009094 | Bacteria | 1909 |
| 108 | Ga0111539_10796107 | 3300009094 | Bacteria | 1100 |
| 109 | Ga0105245_10173413 | 3300009098 | Bacteria | 2055 |
| 110 | Ga0105245_10498989 | 3300009098 | Bacteria | 1233 |
| 111 | Ga0105247_10006463 | 3300009101 | Bacteria | 7259 |
| 112 | Ga0114129_10034551 | 3300009147 | Bacteria | 7142 |
| 113 | Ga0105248_10336422 | 3300009177 | Bacteria | 1700 |
| 114 | Ga0105249_10120373 | 3300009553 | Bacteria | 2494 |
| 115 | Ga0099796_10042038 | 3300010159 | Unclassified | 1550 |
| 116 | Ga0105239_10621471 | 3300010375 | Bacteria | 1233 |
| 117 | Ga0105246_10050403 | 3300011119 | Bacteria | 2855 |
| 118 | Ga0105246_10073164 | 3300011119 | Bacteria | 2419 |
| 119 | Ga0105246_10483177 | 3300011119 | Bacteria | 1048 |
| 120 | Ga0157370_10711643 | 3300013104 | Unclassified | 916 |
| 121 | Ga0157378_10225906 | 3300013297 | Bacteria | 1782 |
| 122 | Ga0163162_10021867 | 3300013306 | Bacteria | 6302 |
| 123 | Ga0163162_10200983 | 3300013306 | Bacteria | 2122 |
| 124 | Ga0163162_10276916 | 3300013306 | Bacteria | 1810 |
| 125 | Ga0157375_10070108 | 3300013308 | Bacteria | 3514 |
| 126 | Ga0157375_10136861 | 3300013308 | Bacteria | 2574 |
| 127 | Ga0157375_10352526 | 3300013308 | Bacteria | 1637 |
| 128 | Ga0163163_10069114 | 3300014325 | Bacteria | 3516 |
| 129 | Ga0157380_10005881 | 3300014326 | Bacteria | 8581 |
| 130 | Ga0157380_10047029 | 3300014326 | Bacteria | 3391 |
| 131 | Ga0157380_10140731 | 3300014326 | Unclassified | 2073 |
| 132 | Ga0157377_10007710 | 3300014745 | Bacteria | 5214 |
| 133 | Ga0157377_10339666 | 3300014745 | Bacteria | 1004 |
| 134 | Ga0157379_10133487 | 3300014968 | Bacteria | 2236 |
| 135 | Ga0157379_10134200 | 3300014968 | Bacteria | 2229 |
| 136 | Ga0157376_10032234 | 3300014969 | Unclassified | 4205 |
| 137 | Ga0157376_10319592 | 3300014969 | Bacteria | 1475 |
| 138 | Ga0163161_10376867 | 3300017792 | Bacteria | 1133 |
| 139 | Ga0206350_11605048 | 3300020080 | Unclassified | 800 |
| 140 | Ga0207697_10037322 | 3300025315 | Bacteria | 1990 |
| 141 | Ga0207656_10084462 | 3300025321 | Bacteria | 1432 |
| 142 | Ga0207692_10000094 | 3300025898 | Bacteria | 26409 |
| 143 | Ga0207642_10023895 | 3300025899 | Bacteria | 2449 |
| 144 | Ga0207688_10000663 | 3300025901 | Bacteria | 16993 |
| 145 | Ga0207680_10055526 | 3300025903 | Bacteria | 2387 |
| 146 | Ga0207685_10026766 | 3300025905 | Unclassified | 2010 |
| 147 | Ga0207699_10002950 | 3300025906 | Bacteria | 8092 |
| 148 | Ga0207645_10019254 | 3300025907 | Bacteria | 4477 |
| 149 | Ga0207643_10000808 | 3300025908 | Bacteria | 19021 |
| 150 | Ga0207643_10010809 | 3300025908 | Bacteria | 4922 |
| 151 | Ga0207705_10022634 | 3300025909 | Bacteria | 4481 |
| 152 | Ga0207693_10013527 | 3300025915 | Bacteria | 6577 |
| 153 | Ga0207663_10000575 | 3300025916 | Bacteria | 16196 |
| 154 | Ga0207663_10041410 | 3300025916 | Bacteria | 2807 |
| 155 | Ga0207660_10285981 | 3300025917 | Bacteria | 1310 |
| 156 | Ga0207662_10035677 | 3300025918 | Bacteria | 2905 |
| 157 | Ga0207649_10083768 | 3300025920 | Bacteria | 2071 |
| 158 | Ga0207646_10061562 | 3300025922 | Bacteria | 3350 |
| 159 | Ga0207681_10479802 | 3300025923 | Bacteria | 1015 |
| 160 | Ga0207650_10092570 | 3300025925 | Bacteria | 2313 |
| 161 | Ga0207650_10109340 | 3300025925 | Bacteria | 2138 |
| 162 | Ga0207659_10003344 | 3300025926 | Bacteria | 9616 |
| 163 | Ga0207659_10020638 | 3300025926 | Bacteria | 4358 |
| 164 | Ga0207659_10328611 | 3300025926 | Bacteria | 1263 |
| 165 | Ga0207700_10050297 | 3300025928 | Unclassified | 3105 |
| 166 | Ga0207664_10011516 | 3300025929 | Bacteria | 6293 |
| 167 | Ga0207690_10101778 | 3300025932 | Bacteria | 2053 |
| 168 | Ga0207706_10007308 | 3300025933 | Bacteria | 10214 |
| 169 | Ga0207670_10046122 | 3300025936 | Bacteria | 2893 |
| 170 | Ga0207670_10112070 | 3300025936 | Bacteria | 1968 |
| 171 | Ga0207670_10295432 | 3300025936 | Unclassified | 1267 |
| 172 | Ga0207669_10484513 | 3300025937 | Bacteria | 986 |
| 173 | Ga0207704_10075670 | 3300025938 | Bacteria | 2154 |
| 174 | Ga0207665_10014420 | 3300025939 | Bacteria | 5204 |
| 175 | Ga0207691_10026975 | 3300025940 | Bacteria | 5389 |
| 176 | Ga0207711_10047767 | 3300025941 | Bacteria | 3661 |
| 177 | Ga0207689_10116691 | 3300025942 | Bacteria | 2194 |
| 178 | Ga0207661_10015655 | 3300025944 | Bacteria | 5587 |
| 179 | Ga0207661_10090369 | 3300025944 | Bacteria | 2550 |
| 180 | Ga0207679_10110607 | 3300025945 | Bacteria | 2168 |
| 181 | Ga0207667_10946862 | 3300025949 | Bacteria | 851 |
| 182 | Ga0207651_10047291 | 3300025960 | Unclassified | 2900 |
| 183 | Ga0207712_10015779 | 3300025961 | Bacteria | 4879 |
| 184 | Ga0207668_10058626 | 3300025972 | Bacteria | 2692 |
| 185 | Ga0207640_10155928 | 3300025981 | Bacteria | 1683 |
| 186 | Ga0207658_10046363 | 3300025986 | Bacteria | 3174 |
| 187 | Ga0207677_10272859 | 3300026023 | Bacteria | 1384 |
| 188 | Ga0207703_10096819 | 3300026035 | Bacteria | 2492 |
| 189 | Ga0207639_10474557 | 3300026041 | Bacteria | 1139 |
| 190 | Ga0207678_10022427 | 3300026067 | Bacteria | 5529 |
| 191 | Ga0207708_10032444 | 3300026075 | Bacteria | 3966 |
| 192 | Ga0207641_10055543 | 3300026088 | Bacteria | 3363 |
| 193 | Ga0207641_10112659 | 3300026088 | Bacteria | 2414 |
| 194 | Ga0207648_10030869 | 3300026089 | Bacteria | 4742 |
| 195 | Ga0207676_10133199 | 3300026095 | Bacteria | 2116 |
| 196 | Ga0207674_10186918 | 3300026116 | Bacteria | 2022 |
| 197 | Ga0207675_100103623 | 3300026118 | Unclassified | 2681 |
| 198 | Ga0207675_100115017 | 3300026118 | Bacteria | 2541 |
| 199 | Ga0207675_100607676 | 3300026118 | Bacteria | 1097 |
| 200 | Ga0207683_10002624 | 3300026121 | Bacteria | 15706 |
| 201 | Ga0207683_10691502 | 3300026121 | Bacteria | 945 |
| 202 | Ga0207698_10630050 | 3300026142 | Bacteria | 1060 |
| 203 | Ga0209813_10060549 | 3300027866 | Bacteria | 1207 |
| 204 | Ga0207428_10027247 | 3300027907 | Bacteria | 4759 |
| 205 | Ga0268265_10030740 | 3300028380 | Bacteria | 3871 |
| 206 | Ga0265327_10014016 | 3300031251 | Bacteria | 5278 |
| 207 | Ga0307410_10372893 | 3300031852 | Bacteria | 1146 |
| 208 | Ga0307416_100191839 | 3300032002 | Bacteria | 1928 |
| 209 | Ga0307415_100070222 | 3300032126 | Bacteria | 2459 |
| 210 | Ga0373958_0020322 | 3300034819 | Bacteria | 1222 |
| 211 | Ga0373926_0085342 | 3300035083 | Unclassified | 1171 |
| 212 | Ga0373952_0058233 | 3300035092 | Bacteria | 938 |
| 213 | Ga0373943_0073188 | 3300035170 | Unclassified | 1740 |
| 214 | Ga0373943_0158256 | 3300035170 | Bacteria | 1231 |
| 215 | Ga0373946_0017468 | 3300035171 | Bacteria | 2745 |
| 216 | Ga0373955_0362301 | 3300035172 | Bacteria | 879 |
| 217 | Ga0373927_0026617 | 3300035695 | Bacteria | 3780 |
| 218 | Ga0373927_0214210 | 3300035695 | Bacteria | 1265 |
| 219 | Ga0373927_0216921 | 3300035695 | Unclassified | 1257 |
| 220 | Ga0373947_0042742 | 3300035725 | Bacteria | 2705 |
| 221 | Ga0373947_0058796 | 3300035725 | Bacteria | 2330 |
| 222 | Ga0373947_0189140 | 3300035725 | Bacteria | 1343 |
| 223 | Ga0373947_0260276 | 3300035725 | Bacteria | 1149 |
| 224 | Ga0373947_0281639 | 3300035725 | Bacteria | 1105 |
| 225 | Ga0373937_0260348 | 3300036401 | Bacteria | 1636 |
| 226 | Ga0373925_0051626 | 3300037068 | Bacteria | 3070 |
| 227 | Ga0373925_0095652 | 3300037068 | Unclassified | 2276 |
| 228 | Ga0373925_0111443 | 3300037068 | Bacteria | 2114 |
| 229 | Ga0373925_0134722 | 3300037068 | Bacteria | 1929 |
| 230 | Ga0373925_0264526 | 3300037068 | Bacteria | 1382 |
| 231 | Ga0373925_0446782 | 3300037068 | Bacteria | 1058 |
| 232 | Ga0395899_0089919 | 3300037312 | Bacteria | 2226 |
| 233 | Ga0395900_0040729 | 3300037418 | Bacteria | 4787 |
| 234 | Ga0395898_0526117 | 3300037466 | Bacteria | 1124 |
| 235 | Ga0395901_0061861 | 3300038443 | Bacteria | 3895 |
| 236 | Ga0436365_0714609 | 3300039437 | Bacteria | 1182 |
| 237 | Ga0436363_0801524 | 3300039450 | Bacteria | 2118 |
| 238 | Ga0439439_0104799 | 3300041406 | Bacteria | 780 |
| 239 | Ga0439454_037417 | 3300042011 | Unclassified | 783 |
| 240 | Ga0495603_0320094 | 3300046455 | Bacteria | 890 |
| 241 | Ga0495590_0059190 | 3300046457 | Bacteria | 1340 |
| 242 | Ga0495590_0104214 | 3300046457 | Bacteria | 1009 |
| 243 | Ga0495591_045991 | 3300046458 | Bacteria | 1214 |
| 244 | Ga0495629_0197650 | 3300046459 | Bacteria | 1391 |
| 245 | Ga0495638_0367765 | 3300046460 | Bacteria | 755 |
| 246 | Ga0495641_0119375 | 3300046461 | Bacteria | 1176 |
| 247 | Ga0495580_0191170 | 3300046472 | Bacteria | 1412 |
| 248 | Ga0495580_0418180 | 3300046472 | Bacteria | 902 |
| 249 | Ga0495582_0236150 | 3300046473 | Bacteria | 1047 |
| 250 | Ga0495605_0043170 | 3300046474 | Bacteria | 2236 |
| 251 | Ga0495662_0262406 | 3300046476 | Bacteria | 850 |
| 252 | Ga0495584_0044658 | 3300046491 | Bacteria | 2236 |
| 253 | Ga0495584_0158636 | 3300046491 | Bacteria | 1149 |
| 254 | Ga0495596_0028591 | 3300046500 | Bacteria | 2237 |
| 255 | Ga0495596_0080653 | 3300046500 | Bacteria | 1263 |
| 256 | Ga0495607_0107194 | 3300046501 | Bacteria | 1486 |
| 257 | Ga0495616_0109658 | 3300046513 | Bacteria | 1283 |
| 258 | Ga0495616_0158207 | 3300046513 | Bacteria | 1021 |
| 259 | Ga0495620_0110187 | 3300046515 | Bacteria | 1091 |
| 260 | Ga0495630_0063328 | 3300046517 | Bacteria | 2778 |
| 261 | Ga0495631_0042883 | 3300046518 | Bacteria | 1998 |
| 262 | Ga0495632_0116335 | 3300046519 | Bacteria | 1252 |
| 263 | Ga0495637_0052215 | 3300046520 | Bacteria | 1707 |
| 264 | Ga0495644_0040114 | 3300046523 | Bacteria | 1765 |
| 265 | Ga0495644_0063435 | 3300046523 | Bacteria | 1388 |
| 266 | Ga0495644_0099221 | 3300046523 | Bacteria | 1101 |
| 267 | Ga0495663_0012213 | 3300046525 | Unclassified | 2393 |
| 268 | Ga0495665_0078734 | 3300046531 | Bacteria | 1734 |
| 269 | Ga0495640_0020582 | 3300046533 | Bacteria | 4854 |
| 270 | Ga0495587_0202642 | 3300046536 | Bacteria | 1122 |
| 271 | Ga0495598_0001326 | 3300046537 | Bacteria | 4856 |
| 272 | Ga0495598_0011678 | 3300046537 | Bacteria | 2135 |
| 273 | Ga0495598_0086331 | 3300046537 | Bacteria | 1015 |
| 274 | Ga0495609_0092196 | 3300046538 | Bacteria | 1317 |
| 275 | Ga0495621_0021555 | 3300046539 | Bacteria | 2125 |
| 276 | Ga0495633_0036982 | 3300046558 | Unclassified | 2337 |
| 277 | Ga0495633_0095250 | 3300046558 | Bacteria | 1383 |
| 278 | Ga0495656_0064602 | 3300046615 | Unclassified | 1607 |
| 279 | Ga0495656_0092175 | 3300046615 | Bacteria | 1387 |
| 280 | Ga0495668_0101324 | 3300046616 | Bacteria | 1575 |
| 281 | Ga0495611_0028514 | 3300046648 | Bacteria | 2445 |
| 282 | Ga0495625_0234581 | 3300046660 | Bacteria | 1197 |
| 283 | Ga0495659_0020393 | 3300046664 | Bacteria | 2226 |
| 284 | Ga0495659_0193852 | 3300046664 | Bacteria | 831 |
| 285 | Ga0495661_0103019 | 3300046665 | Unclassified | 1603 |
| 286 | Ga0495588_0094096 | 3300046674 | Bacteria | 1571 |
| 287 | Ga0495588_0414141 | 3300046674 | Unclassified | 707 |
| 288 | Ga0495646_0240153 | 3300046680 | Bacteria | 974 |
| 289 | Ga0495647_0120227 | 3300046681 | Bacteria | 1104 |
| 290 | Ga0495647_0132467 | 3300046681 | Unclassified | 1057 |
| 291 | Ga0495658_0227375 | 3300046683 | Bacteria | 1169 |
| 292 | Ga0495669_0053084 | 3300046684 | Unclassified | 1822 |
| 293 | Ga0495613_0157931 | 3300046689 | Bacteria | 1615 |
| 294 | Ga0495624_0075579 | 3300046690 | Bacteria | 2092 |
| 295 | Ga0495624_0132077 | 3300046690 | Bacteria | 1531 |
| 296 | Ga0495670_0073866 | 3300046691 | Bacteria | 1729 |
| 297 | Ga0495670_0104949 | 3300046691 | Bacteria | 1458 |
| 298 | Ga0495670_0134478 | 3300046691 | Bacteria | 1290 |
| 299 | Ga0495671_0058363 | 3300046692 | Unclassified | 1909 |
| 300 | Ga0495649_0335184 | 3300046694 | Bacteria | 766 |
| 301 | Ga0495589_0049898 | 3300046794 | Unclassified | 2071 |
| 302 | Ga0495589_0166428 | 3300046794 | Bacteria | 1049 |
| 303 | Ga0495660_0002653 | 3300046810 | Bacteria | 11334 |
| 304 | Ga0495660_0104444 | 3300046810 | Bacteria | 1454 |
| 305 | Ga0495581_0097110 | 3300047315 | Bacteria | 1711 |
| 306 | Ga0495581_0382037 | 3300047315 | Bacteria | 822 |
| 307 | Ga0495674_0222499 | 3300047319 | Bacteria | 1560 |
| 308 | Ga0495672_0030499 | 3300047320 | Bacteria | 3381 |
| 309 | Ga0495676_0170450 | 3300047321 | Bacteria | 1532 |
| 310 | Ga0495677_0025841 | 3300047445 | Bacteria | 2130 |
| 311 | Ga0495679_087792 | 3300047446 | Bacteria | 875 |
| 312 | Ga0495685_068510 | 3300047447 | Bacteria | 1191 |
| 313 | Ga0495673_0119501 | 3300047469 | Bacteria | 1045 |
| 314 | Ga0495614_0207660 | 3300048089 | Bacteria | 887 |
| 315 | Ga0495615_0036361 | 3300048090 | Bacteria | 1208 |
| 316 | Ga0495626_0041194 | 3300048091 | Bacteria | 2177 |
| 317 | Ga0496100_0017619 | 3300048903 | Bacteria | 4221 |
| 318 | Ga0496100_0037404 | 3300048903 | Bacteria | 3068 |
| 319 | Ga0496100_0039186 | 3300048903 | Bacteria | 3008 |
| 320 | Ga0496100_0078940 | 3300048903 | Bacteria | 2216 |
| 321 | Ga0496100_0110273 | 3300048903 | Bacteria | 1910 |
| 322 | Ga0496101_0095503 | 3300048904 | Bacteria | 2217 |
| 323 | Ga0496101_0166353 | 3300048904 | Bacteria | 1693 |
| 324 | Ga0496101_0696755 | 3300048904 | Bacteria | 802 |
| 325 | Ga0496102_0152819 | 3300048905 | Bacteria | 2169 |
| 326 | Ga0496102_0253726 | 3300048905 | Bacteria | 1658 |
| 327 | Ga0496102_0276683 | 3300048905 | Bacteria | 1582 |
| 328 | Ga0496102_0430138 | 3300048905 | Bacteria | 1239 |
| 329 | Ga0496103_0009597 | 3300048906 | Bacteria | 5729 |
| 330 | Ga0496103_0158179 | 3300048906 | Unclassified | 1453 |
| 331 | Ga0496103_0421104 | 3300048906 | Bacteria | 857 |
| 332 | Ga0496104_0000463 | 3300048907 | Bacteria | 34981 |
| 333 | Ga0496104_0007636 | 3300048907 | Bacteria | 9575 |
| 334 | Ga0496104_0020467 | 3300048907 | Bacteria | 6064 |
| 335 | Ga0496104_0033526 | 3300048907 | Bacteria | 4785 |
| 336 | Ga0496104_0166281 | 3300048907 | Bacteria | 2115 |
| 337 | Ga0496104_0273359 | 3300048907 | Bacteria | 1602 |
| 338 | Ga0496105_0002565 | 3300048908 | Bacteria | 13193 |
| 339 | Ga0496105_0052148 | 3300048908 | Bacteria | 3378 |
| 340 | Ga0496105_0092475 | 3300048908 | Bacteria | 2497 |
| 341 | Ga0496105_0247982 | 3300048908 | Bacteria | 1443 |
| 342 | Ga0496106_0005940 | 3300048909 | Bacteria | 9019 |
| 343 | Ga0496106_0008424 | 3300048909 | Bacteria | 7627 |
| 344 | Ga0496106_0013605 | 3300048909 | Bacteria | 6007 |
| 345 | Ga0496106_0131985 | 3300048909 | Bacteria | 1959 |
| 346 | Ga0496106_0385440 | 3300048909 | Bacteria | 1126 |
| 347 | Ga0496107_0015140 | 3300048910 | Bacteria | 5403 |
| 348 | Ga0496107_0056695 | 3300048910 | Bacteria | 2831 |
| 349 | Ga0496107_0091325 | 3300048910 | Bacteria | 2225 |
| 350 | Ga0496107_0755830 | 3300048910 | Unclassified | 713 |
| 351 | Ga0496108_0008355 | 3300048911 | Bacteria | 8397 |
| 352 | Ga0496108_0019842 | 3300048911 | Bacteria | 5522 |
| 353 | Ga0496108_0038637 | 3300048911 | Bacteria | 3976 |
| 354 | Ga0496108_0097668 | 3300048911 | Bacteria | 2503 |
| 355 | Ga0496108_0324334 | 3300048911 | Bacteria | 1342 |
| 356 | Ga0496109_0000766 | 3300048912 | Bacteria | 26715 |
| 357 | Ga0496109_0003421 | 3300048912 | Bacteria | 13266 |
| 358 | Ga0496109_0021363 | 3300048912 | Bacteria | 5722 |
| 359 | Ga0496109_0022999 | 3300048912 | Bacteria | 5527 |
| 360 | Ga0496109_0025633 | 3300048912 | Bacteria | 5255 |
| 361 | Ga0496109_0054448 | 3300048912 | Bacteria | 3650 |
| 362 | Ga0496110_0000307 | 3300048913 | Bacteria | 32320 |
| 363 | Ga0496110_0002398 | 3300048913 | Bacteria | 14041 |
| 364 | Ga0496110_0378444 | 3300048913 | Bacteria | 1290 |
| 365 | Ga0496110_0444707 | 3300048913 | Bacteria | 1181 |
| 366 | Ga0496111_0000405 | 3300048914 | Bacteria | 21591 |
| 367 | Ga0496111_0065381 | 3300048914 | Bacteria | 2639 |
| 368 | Ga0496111_0238815 | 3300048914 | Bacteria | 1349 |
| 369 | Ga0496112_0001055 | 3300048915 | Bacteria | 20328 |
| 370 | Ga0496112_0017128 | 3300048915 | Bacteria | 6804 |
| 371 | Ga0496112_0023346 | 3300048915 | Bacteria | 5908 |
| 372 | Ga0496112_0059117 | 3300048915 | Unclassified | 3777 |
| 373 | Ga0496112_0159288 | 3300048915 | Bacteria | 2224 |
| 374 | Ga0496112_0324627 | 3300048915 | Bacteria | 1483 |
| 375 | Ga0496113_0000323 | 3300048916 | Bacteria | 22774 |
| 376 | Ga0496113_0003061 | 3300048916 | Bacteria | 9915 |
| 377 | Ga0496113_0055717 | 3300048916 | Bacteria | 2965 |
| 378 | Ga0496113_0083958 | 3300048916 | Bacteria | 2444 |
| 379 | Ga0496113_0143935 | 3300048916 | Bacteria | 1877 |
| 380 | Ga0496113_0254630 | 3300048916 | Bacteria | 1402 |
| 381 | Ga0496114_0284814 | 3300048917 | Bacteria | 1457 |
| 382 | Ga0496114_0428300 | 3300048917 | Unclassified | 1172 |
| 383 | Ga0496115_0047145 | 3300048918 | Bacteria | 3445 |
| 384 | Ga0496115_0061809 | 3300048918 | Bacteria | 3020 |
| 385 | Ga0496115_0137725 | 3300048918 | Bacteria | 2013 |
| 386 | Ga0496115_0429093 | 3300048918 | Bacteria | 1070 |
| 387 | Ga0501075_0634996 | 3300049591 | Bacteria | 814 |
| 388 | Ga0501076_0166483 | 3300049592 | Unclassified | 1797 |
| 389 | Ga0501076_0303608 | 3300049592 | Bacteria | 1309 |
| 390 | Ga0501077_0226060 | 3300049593 | Bacteria | 1190 |
| 391 | Ga0501079_0190819 | 3300049741 | Bacteria | 1599 |
| 392 | Ga0501079_0379040 | 3300049741 | Bacteria | 1109 |
| 393 | Ga0501080_0731509 | 3300049742 | Bacteria | 871 |
| 394 | Ga0501081_0310581 | 3300049743 | Bacteria | 1158 |
| 395 | Ga0501081_0344581 | 3300049743 | Bacteria | 1097 |
| 396 | Ga0501081_0394410 | 3300049743 | Bacteria | 1024 |
| 397 | Ga0501083_0000053 | 3300049744 | Bacteria | 83252 |
| 398 | Ga0501083_0207183 | 3300049744 | Bacteria | 1279 |
| 399 | nmdc:mga03683_27317_c1 | 3300050489 | Bacteria | 2258 |
| 400 | nmdc:mga03n38_21837_c1 | 3300050490 | Bacteria | 2582 |
| 401 | nmdc:mga0yw44_3497_c1 | 3300050492 | Bacteria | 6988 |
| 402 | nmdc:mga0yw44_39629_c2 | 3300050492 | Bacteria | 1542 |
| 403 | nmdc:mga0yw44_47211_c1 | 3300050492 | Bacteria | 2590 |
| 404 | nmdc:mga0yw44_622550_c1 | 3300050492 | Bacteria | 733 |
| 405 | nmdc:mga0yw44_9660_c1 | 3300050492 | Bacteria | 4895 |
| 406 | nmdc:mga06z11_63693_c1 | 3300050494 | Bacteria | 1930 |
| 407 | nmdc:mga04h51_26235_c1 | 3300050495 | Bacteria | 1800 |
| 408 | nmdc:mga04h51_29069_c1 | 3300050495 | Bacteria | 1729 |
| 409 | nmdc:mga07m45_72828_c1 | 3300050496 | Bacteria | 1956 |
| 410 | nmdc:mga05p37_48836_c1 | 3300050507 | Bacteria | 5204 |
| 411 | nmdc:mga05p37_509373_c1 | 3300050507 | Bacteria | 1379 |
| 412 | nmdc:mga06r32_156799_c1 | 3300050510 | Bacteria | 2258 |
| 413 | nmdc:mga06r32_165203_c1 | 3300050510 | Bacteria | 2196 |
| 414 | nmdc:mga08y16_197131_c1 | 3300050511 | Bacteria | 2087 |
| 415 | nmdc:mga08y16_664852_c1 | 3300050511 | Archaea | 1045 |
| 416 | nmdc:mga08y16_686780_c1 | 3300050511 | Bacteria | 1025 |
| 417 | nmdc:mga08y16_75239_c1 | 3300050511 | Bacteria | 3520 |
| 418 | nmdc:mga0n895_41739_c1 | 3300050512 | Bacteria | 4461 |
| 419 | nmdc:mga0n895_420450_c1 | 3300050512 | Bacteria | 1351 |
| 420 | nmdc:mga0n895_506282_c1 | 3300050512 | Bacteria | 1216 |
| 421 | nmdc:mga0n895_63761_c1 | 3300050512 | Bacteria | 3644 |
| 422 | nmdc:mga0rr50_80216_c1 | 3300050513 | Bacteria | 2515 |
| 423 | nmdc:mga0a205_230682_c1 | 3300050515 | Bacteria | 1734 |
| 424 | Ga0495601_0071967 | 3300053077 | Bacteria | 2208 |
| 425 | Ga0495601_0140372 | 3300053077 | Bacteria | 1576 |
| 426 | Ga0495655_0005433 | 3300053083 | Unclassified | 2249 |
| 427 | Ga0495655_0048735 | 3300053083 | Bacteria | 1113 |
| 428 | Ga0495619_0044661 | 3300053085 | Bacteria | 2909 |
| 429 | Ga0495619_0269347 | 3300053085 | Bacteria | 1180 |
| 430 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 431 | Ga0500642_0062934 | 3300053130 | Bacteria | 1671 |
| 432 | Ga0500655_007010 | 3300053133 | Bacteria | 2026 |
| 433 | Ga0501084_0255122 | 3300054114 | Bacteria | 1480 |
| 434 | Ga0587080_034213 | 3300059503 | Unclassified | 899 |
| 435 | Ga0530510_0265594 | 3300061734 | Bacteria | 1280 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046460 | Ga0495638_0367765 | Ga0495638_0367765_15_599 | 194 |
| 2 | 3300036401 | Ga0373937_0260348 | Ga0373937_0260348_13_615 | 200 |
| 3 | 3300037068 | Ga0373925_0134722 | Ga0373925_0134722_680_1342 | 200 |
| 4 | 3300009094 | Ga0111539_10016349 | Ga0111539_100163499 | 204 |
| 5 | 3300014326 | Ga0157380_10047029 | Ga0157380_100470294 | 204 |
| 6 | 3300046537 | Ga0495598_0001326 | Ga0495598_0001326_10_624 | 204 |
| 7 | 3300046681 | Ga0495647_0120227 | Ga0495647_0120227_11_625 | 204 |
| 8 | 3300048903 | Ga0496100_0110273 | Ga0496100_0110273_1259_1873 | 204 |
| 9 | 3300048906 | Ga0496103_0421104 | Ga0496103_0421104_223_837 | 204 |
| 10 | 3300048910 | Ga0496107_0755830 | Ga0496107_0755830_60_674 | 204 |
| 11 | 3300050511 | nmdc:mga08y16_664852_c1 | nmdc:mga08y16_664852_c1_139_759 | 204 |
| 12 | 3300050511 | nmdc:mga08y16_686780_c1 | nmdc:mga08y16_686780_c1_381_995 | 204 |
| 13 | 3300053130 | Ga0500642_0062934 | Ga0500642_0062934_788_1444 | 211 |
| 14 | 3300035170 | Ga0373943_0073188 | Ga0373943_0073188_776_1456 | 214 |
| 15 | 3300035695 | Ga0373927_0216921 | Ga0373927_0216921_311_991 | 214 |
| 16 | 3300037068 | Ga0373925_0095652 | Ga0373925_0095652_729_1409 | 214 |
| 17 | 3300049744 | Ga0501083_0000053 | Ga0501083_0000053_35765_36436 | 218 |
| 18 | 3300025936 | Ga0207670_10295432 | Ga0207670_102954322 | 219 |
| 19 | 3300035092 | Ga0373952_0058233 | Ga0373952_0058233_29_688 | 219 |
| 20 | 3300046537 | Ga0495598_0086331 | Ga0495598_0086331_81_740 | 219 |
| 21 | 3300046691 | Ga0495670_0073866 | Ga0495670_0073866_911_1570 | 219 |
| 22 | 3300048903 | Ga0496100_0078940 | Ga0496100_0078940_1180_1839 | 219 |
| 23 | 3300048904 | Ga0496101_0095503 | Ga0496101_0095503_617_1276 | 219 |
| 24 | 3300048904 | Ga0496101_0696755 | Ga0496101_0696755_25_684 | 219 |
| 25 | 3300048905 | Ga0496102_0152819 | Ga0496102_0152819_212_871 | 219 |
| 26 | 3300048906 | Ga0496103_0009597 | Ga0496103_0009597_4263_4922 | 219 |
| 27 | 3300048907 | Ga0496104_0166281 | Ga0496104_0166281_693_1352 | 219 |
| 28 | 3300048908 | Ga0496105_0092475 | Ga0496105_0092475_693_1352 | 219 |
| 29 | 3300048909 | Ga0496106_0008424 | Ga0496106_0008424_6950_7609 | 219 |
| 30 | 3300048910 | Ga0496107_0015140 | Ga0496107_0015140_4067_4726 | 219 |
| 31 | 3300048911 | Ga0496108_0038637 | Ga0496108_0038637_1390_2049 | 219 |
| 32 | 3300048912 | Ga0496109_0025633 | Ga0496109_0025633_832_1491 | 219 |
| 33 | 3300048915 | Ga0496112_0023346 | Ga0496112_0023346_4999_5658 | 219 |
| 34 | 3300048916 | Ga0496113_0083958 | Ga0496113_0083958_340_999 | 219 |
| 35 | 3300048917 | Ga0496114_0284814 | Ga0496114_0284814_19_678 | 219 |
| 36 | 3300048918 | Ga0496115_0061809 | Ga0496115_0061809_1211_1870 | 219 |
| 37 | 3300010159 | Ga0099796_10042038 | Ga0099796_100420383 | 220 |
| 38 | 3300046476 | Ga0495662_0262406 | Ga0495662_0262406_18_683 | 221 |
| 39 | 3300046500 | Ga0495596_0080653 | Ga0495596_0080653_303_968 | 221 |
| 40 | 3300046513 | Ga0495616_0158207 | Ga0495616_0158207_178_843 | 221 |
| 41 | 3300046660 | Ga0495625_0234581 | Ga0495625_0234581_509_1174 | 221 |
| 42 | 3300046674 | Ga0495588_0414141 | Ga0495588_0414141_25_690 | 221 |
| 43 | 3300048906 | Ga0496103_0158179 | Ga0496103_0158179_162_827 | 221 |
| 44 | 3300048913 | Ga0496110_0378444 | Ga0496110_0378444_425_1090 | 221 |
| 45 | 3300050492 | nmdc:mga0yw44_47211_c1 | nmdc:mga0yw44_47211_c1_19_684 | 221 |
| 46 | 3300050512 | nmdc:mga0n895_506282_c1 | nmdc:mga0n895_506282_c1_162_827 | 221 |
| 47 | 3300053085 | Ga0495619_0269347 | Ga0495619_0269347_235_933 | 222 |
| 48 | 3300005353 | Ga0070669_100356130 | Ga0070669_1003561302 | 223 |
| 49 | 3300005354 | Ga0070675_100376294 | Ga0070675_1003762942 | 223 |
| 50 | 3300005518 | Ga0070699_100095779 | Ga0070699_1000957793 | 223 |
| 51 | 3300025926 | Ga0207659_10328611 | Ga0207659_103286112 | 223 |
| 52 | 3300046810 | Ga0495660_0002653 | Ga0495660_0002653_9710_10390 | 223 |
| 53 | 3300053108 | Ga0500562_000001 | Ga0500562_000001_900859_901539 | 223 |
| 54 | 3300053133 | Ga0500655_007010 | Ga0500655_007010_447_1127 | 223 |
| 55 | 3300006038 | Ga0075365_10081034 | Ga0075365_100810342 | 224 |
| 56 | 3300006353 | Ga0075370_10014940 | Ga0075370_100149402 | 224 |
| 57 | 3300050490 | nmdc:mga03n38_21837_c1 | nmdc:mga03n38_21837_c1_1763_2446 | 224 |
| 58 | 3300050495 | nmdc:mga04h51_26235_c1 | nmdc:mga04h51_26235_c1_377_1060 | 224 |
| 59 | 3300050496 | nmdc:mga07m45_72828_c1 | nmdc:mga07m45_72828_c1_584_1267 | 224 |
| 60 | 3300031251 | Ga0265327_10014016 | Ga0265327_100140163 | 225 |
| 61 | 3300035725 | Ga0373947_0058796 | Ga0373947_0058796_119_799 | 225 |
| 62 | 3300037466 | Ga0395898_0526117 | Ga0395898_0526117_411_1100 | 225 |
| 63 | 3300005340 | Ga0070689_100355210 | Ga0070689_1003552101 | 226 |
| 64 | 3300005544 | Ga0070686_100106793 | Ga0070686_1001067933 | 226 |
| 65 | 3300005577 | Ga0068857_100235511 | Ga0068857_1002355112 | 226 |
| 66 | 3300007265 | Ga0099794_10009734 | Ga0099794_100097343 | 226 |
| 67 | 3300007788 | Ga0099795_10002353 | Ga0099795_100023535 | 226 |
| 68 | 3300011119 | Ga0105246_10073164 | Ga0105246_100731643 | 226 |
| 69 | 3300013306 | Ga0163162_10021867 | Ga0163162_100218676 | 226 |
| 70 | 3300014968 | Ga0157379_10134200 | Ga0157379_101342003 | 226 |
| 71 | 3300026023 | Ga0207677_10272859 | Ga0207677_102728592 | 226 |
| 72 | 3300031852 | Ga0307410_10372893 | Ga0307410_103728932 | 226 |
| 73 | 3300032002 | Ga0307416_100191839 | Ga0307416_1001918392 | 226 |
| 74 | 3300032126 | Ga0307415_100070222 | Ga0307415_1000702222 | 226 |
| 75 | 3300049592 | Ga0501076_0166483 | Ga0501076_0166483_652_1338 | 226 |
| 76 | 3300049743 | Ga0501081_0310581 | Ga0501081_0310581_398_1084 | 226 |
| 77 | 3300005336 | Ga0070680_100369525 | Ga0070680_1003695252 | 227 |
| 78 | 3300005345 | Ga0070692_10047711 | Ga0070692_100477112 | 227 |
| 79 | 3300005435 | Ga0070714_100004118 | Ga0070714_1000041186 | 227 |
| 80 | 3300005436 | Ga0070713_100001118 | Ga0070713_1000011187 | 227 |
| 81 | 3300005437 | Ga0070710_10001184 | Ga0070710_100011846 | 227 |
| 82 | 3300005439 | Ga0070711_100008435 | Ga0070711_1000084355 | 227 |
| 83 | 3300005457 | Ga0070662_100373542 | Ga0070662_1003735422 | 227 |
| 84 | 3300005467 | Ga0070706_101122414 | Ga0070706_1011224141 | 227 |
| 85 | 3300006028 | Ga0070717_10001698 | Ga0070717_100016987 | 227 |
| 86 | 3300006163 | Ga0070715_10000121 | Ga0070715_1000012111 | 227 |
| 87 | 3300006173 | Ga0070716_100065679 | Ga0070716_1000656792 | 227 |
| 88 | 3300006175 | Ga0070712_100008593 | Ga0070712_1000085936 | 227 |
| 89 | 3300006847 | Ga0075431_100488215 | Ga0075431_1004882152 | 227 |
| 90 | 3300006852 | Ga0075433_10151629 | Ga0075433_101516293 | 227 |
| 91 | 3300006871 | Ga0075434_100201149 | Ga0075434_1002011492 | 227 |
| 92 | 3300009094 | Ga0111539_10288565 | Ga0111539_102885652 | 227 |
| 93 | 3300025898 | Ga0207692_10000094 | Ga0207692_1000009414 | 227 |
| 94 | 3300025905 | Ga0207685_10026766 | Ga0207685_100267662 | 227 |
| 95 | 3300025906 | Ga0207699_10002950 | Ga0207699_100029508 | 227 |
| 96 | 3300025909 | Ga0207705_10022634 | Ga0207705_100226344 | 227 |
| 97 | 3300025915 | Ga0207693_10013527 | Ga0207693_100135278 | 227 |
| 98 | 3300025916 | Ga0207663_10000575 | Ga0207663_1000057512 | 227 |
| 99 | 3300025928 | Ga0207700_10050297 | Ga0207700_100502973 | 227 |
| 100 | 3300025929 | Ga0207664_10011516 | Ga0207664_100115165 | 227 |
| 101 | 3300025939 | Ga0207665_10014420 | Ga0207665_100144204 | 227 |
| 102 | 3300025944 | Ga0207661_10015655 | Ga0207661_100156553 | 227 |
| 103 | 3300025949 | Ga0207667_10946862 | Ga0207667_109468622 | 227 |
| 104 | 3300037312 | Ga0395899_0089919 | Ga0395899_0089919_1467_2150 | 227 |
| 105 | 3300037418 | Ga0395900_0040729 | Ga0395900_0040729_3566_4249 | 227 |
| 106 | 3300038443 | Ga0395901_0061861 | Ga0395901_0061861_1746_2429 | 227 |
| 107 | 3300039450 | Ga0436363_0801524 | Ga0436363_0801524_1008_1691 | 227 |
| 108 | 3300005334 | Ga0068869_100470181 | Ga0068869_1004701812 | 228 |
| 109 | 3300005355 | Ga0070671_100281588 | Ga0070671_1002815882 | 228 |
| 110 | 3300005548 | Ga0070665_100139404 | Ga0070665_1001394042 | 228 |
| 111 | 3300006178 | Ga0075367_10132176 | Ga0075367_101321762 | 228 |
| 112 | 3300006844 | Ga0075428_100519090 | Ga0075428_1005190902 | 228 |
| 113 | 3300041406 | Ga0439439_0104799 | Ga0439439_0104799_24_713 | 228 |
| 114 | 3300046680 | Ga0495646_0240153 | Ga0495646_0240153_169_855 | 228 |
| 115 | 3300048903 | Ga0496100_0017619 | Ga0496100_0017619_692_1378 | 228 |
| 116 | 3300048905 | Ga0496102_0276683 | Ga0496102_0276683_88_774 | 228 |
| 117 | 3300048907 | Ga0496104_0033526 | Ga0496104_0033526_987_1673 | 228 |
| 118 | 3300048908 | Ga0496105_0247982 | Ga0496105_0247982_703_1389 | 228 |
| 119 | 3300048909 | Ga0496106_0005940 | Ga0496106_0005940_1659_2345 | 228 |
| 120 | 3300048910 | Ga0496107_0056695 | Ga0496107_0056695_1600_2286 | 228 |
| 121 | 3300048911 | Ga0496108_0019842 | Ga0496108_0019842_2224_2910 | 228 |
| 122 | 3300048912 | Ga0496109_0003421 | Ga0496109_0003421_5327_6013 | 228 |
| 123 | 3300048912 | Ga0496109_0022999 | Ga0496109_0022999_3168_3854 | 228 |
| 124 | 3300048913 | Ga0496110_0000307 | Ga0496110_0000307_12919_13605 | 228 |
| 125 | 3300048914 | Ga0496111_0000405 | Ga0496111_0000405_12362_13048 | 228 |
| 126 | 3300048914 | Ga0496111_0238815 | Ga0496111_0238815_41_727 | 228 |
| 127 | 3300048915 | Ga0496112_0017128 | Ga0496112_0017128_1663_2349 | 228 |
| 128 | 3300048916 | Ga0496113_0003061 | Ga0496113_0003061_8932_9618 | 228 |
| 129 | 3300053077 | Ga0495601_0140372 | Ga0495601_0140372_663_1349 | 228 |
| 130 | 3300002070 | JGI24750J21931_1006673 | JGI24750J21931_10066733 | 229 |
| 131 | 3300002244 | JGI24742J22300_10013026 | JGI24742J22300_100130262 | 229 |
| 132 | 3300005328 | Ga0070676_10142013 | Ga0070676_101420133 | 229 |
| 133 | 3300005329 | Ga0070683_100053001 | Ga0070683_1000530013 | 229 |
| 134 | 3300005330 | Ga0070690_100264179 | Ga0070690_1002641791 | 229 |
| 135 | 3300005331 | Ga0070670_100083808 | Ga0070670_1000838083 | 229 |
| 136 | 3300005333 | Ga0070677_10039296 | Ga0070677_100392962 | 229 |
| 137 | 3300005337 | Ga0070682_100063751 | Ga0070682_1000637513 | 229 |
| 138 | 3300005340 | Ga0070689_100104050 | Ga0070689_1001040502 | 229 |
| 139 | 3300005341 | Ga0070691_10104398 | Ga0070691_101043981 | 229 |
| 140 | 3300005343 | Ga0070687_100066062 | Ga0070687_1000660621 | 229 |
| 141 | 3300005344 | Ga0070661_100096227 | Ga0070661_1000962273 | 229 |
| 142 | 3300005345 | Ga0070692_10031896 | Ga0070692_100318963 | 229 |
| 143 | 3300005347 | Ga0070668_100083720 | Ga0070668_1000837203 | 229 |
| 144 | 3300005353 | Ga0070669_100049879 | Ga0070669_1000498793 | 229 |
| 145 | 3300005354 | Ga0070675_100080417 | Ga0070675_1000804173 | 229 |
| 146 | 3300005364 | Ga0070673_100030762 | Ga0070673_1000307622 | 229 |
| 147 | 3300005365 | Ga0070688_100012076 | Ga0070688_1000120765 | 229 |
| 148 | 3300005366 | Ga0070659_100012408 | Ga0070659_1000124085 | 229 |
| 149 | 3300005367 | Ga0070667_100048063 | Ga0070667_1000480634 | 229 |
| 150 | 3300005367 | Ga0070667_100235202 | Ga0070667_1002352021 | 229 |
| 151 | 3300005439 | Ga0070711_100185893 | Ga0070711_1001858932 | 229 |
| 152 | 3300005441 | Ga0070700_100081610 | Ga0070700_1000816102 | 229 |
| 153 | 3300005456 | Ga0070678_100658763 | Ga0070678_1006587631 | 229 |
| 154 | 3300005457 | Ga0070662_100066855 | Ga0070662_1000668553 | 229 |
| 155 | 3300005459 | Ga0068867_100076991 | Ga0068867_1000769912 | 229 |
| 156 | 3300005466 | Ga0070685_10100644 | Ga0070685_101006443 | 229 |
| 157 | 3300005468 | Ga0070707_100188791 | Ga0070707_1001887912 | 229 |
| 158 | 3300005535 | Ga0070684_100228297 | Ga0070684_1002282971 | 229 |
| 159 | 3300005544 | Ga0070686_100055919 | Ga0070686_1000559193 | 229 |
| 160 | 3300005545 | Ga0070695_100532998 | Ga0070695_1005329981 | 229 |
| 161 | 3300005548 | Ga0070665_100022039 | Ga0070665_1000220396 | 229 |
| 162 | 3300005549 | Ga0070704_100170908 | Ga0070704_1001709083 | 229 |
| 163 | 3300005564 | Ga0070664_100111343 | Ga0070664_1001113431 | 229 |
| 164 | 3300005577 | Ga0068857_100208005 | Ga0068857_1002080053 | 229 |
| 165 | 3300005614 | Ga0068856_100067111 | Ga0068856_1000671112 | 229 |
| 166 | 3300005616 | Ga0068852_100181802 | Ga0068852_1001818023 | 229 |
| 167 | 3300005618 | Ga0068864_100012803 | Ga0068864_1000128034 | 229 |
| 168 | 3300005718 | Ga0068866_10017502 | Ga0068866_100175022 | 229 |
| 169 | 3300005719 | Ga0068861_100079988 | Ga0068861_1000799883 | 229 |
| 170 | 3300005719 | Ga0068861_100235993 | Ga0068861_1002359933 | 229 |
| 171 | 3300005840 | Ga0068870_10002002 | Ga0068870_100020028 | 229 |
| 172 | 3300005840 | Ga0068870_10316907 | Ga0068870_103169072 | 229 |
| 173 | 3300005841 | Ga0068863_100020579 | Ga0068863_1000205796 | 229 |
| 174 | 3300005842 | Ga0068858_100324213 | Ga0068858_1003242131 | 229 |
| 175 | 3300005844 | Ga0068862_100015319 | Ga0068862_1000153194 | 229 |
| 176 | 3300005937 | Ga0081455_10019031 | Ga0081455_100190314 | 229 |
| 177 | 3300005937 | Ga0081455_10043942 | Ga0081455_100439423 | 229 |
| 178 | 3300005937 | Ga0081455_10068174 | Ga0081455_100681743 | 229 |
| 179 | 3300005937 | Ga0081455_10189558 | Ga0081455_101895582 | 229 |
| 180 | 3300006028 | Ga0070717_10156192 | Ga0070717_101561922 | 229 |
| 181 | 3300006038 | Ga0075365_10015278 | Ga0075365_100152784 | 229 |
| 182 | 3300006038 | Ga0075365_10065109 | Ga0075365_100651093 | 229 |
| 183 | 3300006038 | Ga0075365_10121789 | Ga0075365_101217892 | 229 |
| 184 | 3300006038 | Ga0075365_10159171 | Ga0075365_101591712 | 229 |
| 185 | 3300006038 | Ga0075365_10197905 | Ga0075365_101979051 | 229 |
| 186 | 3300006042 | Ga0075368_10012815 | Ga0075368_100128154 | 229 |
| 187 | 3300006042 | Ga0075368_10109939 | Ga0075368_101099391 | 229 |
| 188 | 3300006177 | Ga0075362_10008686 | Ga0075362_100086862 | 229 |
| 189 | 3300006178 | Ga0075367_10164807 | Ga0075367_101648072 | 229 |
| 190 | 3300006237 | Ga0097621_100016412 | Ga0097621_1000164125 | 229 |
| 191 | 3300006358 | Ga0068871_100145251 | Ga0068871_1001452513 | 229 |
| 192 | 3300006358 | Ga0068871_100222938 | Ga0068871_1002229383 | 229 |
| 193 | 3300006844 | Ga0075428_100081230 | Ga0075428_1000812303 | 229 |
| 194 | 3300006844 | Ga0075428_100100970 | Ga0075428_1001009703 | 229 |
| 195 | 3300006847 | Ga0075431_100254844 | Ga0075431_1002548443 | 229 |
| 196 | 3300006847 | Ga0075431_100349127 | Ga0075431_1003491273 | 229 |
| 197 | 3300006847 | Ga0075431_100680303 | Ga0075431_1006803031 | 229 |
| 198 | 3300006852 | Ga0075433_10034418 | Ga0075433_100344186 | 229 |
| 199 | 3300006871 | Ga0075434_100009717 | Ga0075434_1000097173 | 229 |
| 200 | 3300006881 | Ga0068865_100037203 | Ga0068865_1000372032 | 229 |
| 201 | 3300006881 | Ga0068865_100151967 | Ga0068865_1001519673 | 229 |
| 202 | 3300007788 | Ga0099795_10002912 | Ga0099795_100029123 | 229 |
| 203 | 3300009094 | Ga0111539_10032107 | Ga0111539_100321074 | 229 |
| 204 | 3300009094 | Ga0111539_10075369 | Ga0111539_100753694 | 229 |
| 205 | 3300009094 | Ga0111539_10796107 | Ga0111539_107961072 | 229 |
| 206 | 3300009098 | Ga0105245_10173413 | Ga0105245_101734133 | 229 |
| 207 | 3300009098 | Ga0105245_10498989 | Ga0105245_104989893 | 229 |
| 208 | 3300009101 | Ga0105247_10006463 | Ga0105247_100064635 | 229 |
| 209 | 3300009147 | Ga0114129_10034551 | Ga0114129_100345515 | 229 |
| 210 | 3300009177 | Ga0105248_10336422 | Ga0105248_103364222 | 229 |
| 211 | 3300009553 | Ga0105249_10120373 | Ga0105249_101203732 | 229 |
| 212 | 3300010375 | Ga0105239_10621471 | Ga0105239_106214712 | 229 |
| 213 | 3300011119 | Ga0105246_10050403 | Ga0105246_100504033 | 229 |
| 214 | 3300011119 | Ga0105246_10483177 | Ga0105246_104831771 | 229 |
| 215 | 3300013104 | Ga0157370_10711643 | Ga0157370_107116431 | 229 |
| 216 | 3300013297 | Ga0157378_10225906 | Ga0157378_102259062 | 229 |
| 217 | 3300013306 | Ga0163162_10200983 | Ga0163162_102009832 | 229 |
| 218 | 3300013306 | Ga0163162_10276916 | Ga0163162_102769162 | 229 |
| 219 | 3300013308 | Ga0157375_10070108 | Ga0157375_100701084 | 229 |
| 220 | 3300013308 | Ga0157375_10136861 | Ga0157375_101368612 | 229 |
| 221 | 3300013308 | Ga0157375_10352526 | Ga0157375_103525263 | 229 |
| 222 | 3300014325 | Ga0163163_10069114 | Ga0163163_100691142 | 229 |
| 223 | 3300014326 | Ga0157380_10005881 | Ga0157380_100058818 | 229 |
| 224 | 3300014326 | Ga0157380_10140731 | Ga0157380_101407312 | 229 |
| 225 | 3300014745 | Ga0157377_10007710 | Ga0157377_100077103 | 229 |
| 226 | 3300014745 | Ga0157377_10339666 | Ga0157377_103396662 | 229 |
| 227 | 3300014968 | Ga0157379_10133487 | Ga0157379_101334872 | 229 |
| 228 | 3300014969 | Ga0157376_10032234 | Ga0157376_100322346 | 229 |
| 229 | 3300014969 | Ga0157376_10319592 | Ga0157376_103195921 | 229 |
| 230 | 3300017792 | Ga0163161_10376867 | Ga0163161_103768672 | 229 |
| 231 | 3300020080 | Ga0206350_11605048 | Ga0206350_116050481 | 229 |
| 232 | 3300025315 | Ga0207697_10037322 | Ga0207697_100373222 | 229 |
| 233 | 3300025321 | Ga0207656_10084462 | Ga0207656_100844622 | 229 |
| 234 | 3300025899 | Ga0207642_10023895 | Ga0207642_100238953 | 229 |
| 235 | 3300025901 | Ga0207688_10000663 | Ga0207688_100006638 | 229 |
| 236 | 3300025903 | Ga0207680_10055526 | Ga0207680_100555262 | 229 |
| 237 | 3300025907 | Ga0207645_10019254 | Ga0207645_100192544 | 229 |
| 238 | 3300025908 | Ga0207643_10000808 | Ga0207643_100008081 | 229 |
| 239 | 3300025908 | Ga0207643_10010809 | Ga0207643_100108093 | 229 |
| 240 | 3300025916 | Ga0207663_10041410 | Ga0207663_100414103 | 229 |
| 241 | 3300025917 | Ga0207660_10285981 | Ga0207660_102859811 | 229 |
| 242 | 3300025918 | Ga0207662_10035677 | Ga0207662_100356775 | 229 |
| 243 | 3300025920 | Ga0207649_10083768 | Ga0207649_100837683 | 229 |
| 244 | 3300025922 | Ga0207646_10061562 | Ga0207646_100615623 | 229 |
| 245 | 3300025923 | Ga0207681_10479802 | Ga0207681_104798021 | 229 |
| 246 | 3300025925 | Ga0207650_10092570 | Ga0207650_100925703 | 229 |
| 247 | 3300025925 | Ga0207650_10109340 | Ga0207650_101093402 | 229 |
| 248 | 3300025926 | Ga0207659_10003344 | Ga0207659_100033442 | 229 |
| 249 | 3300025926 | Ga0207659_10020638 | Ga0207659_100206382 | 229 |
| 250 | 3300025932 | Ga0207690_10101778 | Ga0207690_101017781 | 229 |
| 251 | 3300025933 | Ga0207706_10007308 | Ga0207706_100073084 | 229 |
| 252 | 3300025936 | Ga0207670_10046122 | Ga0207670_100461221 | 229 |
| 253 | 3300025936 | Ga0207670_10112070 | Ga0207670_101120702 | 229 |
| 254 | 3300025937 | Ga0207669_10484513 | Ga0207669_104845131 | 229 |
| 255 | 3300025938 | Ga0207704_10075670 | Ga0207704_100756702 | 229 |
| 256 | 3300025940 | Ga0207691_10026975 | Ga0207691_100269751 | 229 |
| 257 | 3300025941 | Ga0207711_10047767 | Ga0207711_100477674 | 229 |
| 258 | 3300025942 | Ga0207689_10116691 | Ga0207689_101166913 | 229 |
| 259 | 3300025944 | Ga0207661_10090369 | Ga0207661_100903693 | 229 |
| 260 | 3300025945 | Ga0207679_10110607 | Ga0207679_101106073 | 229 |
| 261 | 3300025960 | Ga0207651_10047291 | Ga0207651_100472913 | 229 |
| 262 | 3300025961 | Ga0207712_10015779 | Ga0207712_100157795 | 229 |
| 263 | 3300025972 | Ga0207668_10058626 | Ga0207668_100586263 | 229 |
| 264 | 3300025981 | Ga0207640_10155928 | Ga0207640_101559282 | 229 |
| 265 | 3300025986 | Ga0207658_10046363 | Ga0207658_100463634 | 229 |
| 266 | 3300026035 | Ga0207703_10096819 | Ga0207703_100968191 | 229 |
| 267 | 3300026041 | Ga0207639_10474557 | Ga0207639_104745572 | 229 |
| 268 | 3300026067 | Ga0207678_10022427 | Ga0207678_100224273 | 229 |
| 269 | 3300026075 | Ga0207708_10032444 | Ga0207708_100324443 | 229 |
| 270 | 3300026088 | Ga0207641_10055543 | Ga0207641_100555433 | 229 |
| 271 | 3300026088 | Ga0207641_10112659 | Ga0207641_101126592 | 229 |
| 272 | 3300026089 | Ga0207648_10030869 | Ga0207648_100308694 | 229 |
| 273 | 3300026095 | Ga0207676_10133199 | Ga0207676_101331993 | 229 |
| 274 | 3300026116 | Ga0207674_10186918 | Ga0207674_101869181 | 229 |
| 275 | 3300026118 | Ga0207675_100103623 | Ga0207675_1001036233 | 229 |
| 276 | 3300026118 | Ga0207675_100115017 | Ga0207675_1001150174 | 229 |
| 277 | 3300026118 | Ga0207675_100607676 | Ga0207675_1006076761 | 229 |
| 278 | 3300026121 | Ga0207683_10002624 | Ga0207683_100026248 | 229 |
| 279 | 3300026121 | Ga0207683_10691502 | Ga0207683_106915022 | 229 |
| 280 | 3300026142 | Ga0207698_10630050 | Ga0207698_106300502 | 229 |
| 281 | 3300027866 | Ga0209813_10060549 | Ga0209813_100605491 | 229 |
| 282 | 3300027907 | Ga0207428_10027247 | Ga0207428_100272476 | 229 |
| 283 | 3300028380 | Ga0268265_10030740 | Ga0268265_100307403 | 229 |
| 284 | 3300034819 | Ga0373958_0020322 | Ga0373958_0020322_150_839 | 229 |
| 285 | 3300035083 | Ga0373926_0085342 | Ga0373926_0085342_227_916 | 229 |
| 286 | 3300035170 | Ga0373943_0158256 | Ga0373943_0158256_112_801 | 229 |
| 287 | 3300035171 | Ga0373946_0017468 | Ga0373946_0017468_1461_2150 | 229 |
| 288 | 3300035172 | Ga0373955_0362301 | Ga0373955_0362301_71_760 | 229 |
| 289 | 3300035695 | Ga0373927_0026617 | Ga0373927_0026617_2666_3355 | 229 |
| 290 | 3300035695 | Ga0373927_0214210 | Ga0373927_0214210_432_1121 | 229 |
| 291 | 3300035725 | Ga0373947_0042742 | Ga0373947_0042742_532_1221 | 229 |
| 292 | 3300035725 | Ga0373947_0189140 | Ga0373947_0189140_478_1167 | 229 |
| 293 | 3300035725 | Ga0373947_0260276 | Ga0373947_0260276_41_742 | 229 |
| 294 | 3300035725 | Ga0373947_0281639 | Ga0373947_0281639_79_786 | 229 |
| 295 | 3300037068 | Ga0373925_0051626 | Ga0373925_0051626_1123_1812 | 229 |
| 296 | 3300037068 | Ga0373925_0111443 | Ga0373925_0111443_865_1593 | 229 |
| 297 | 3300037068 | Ga0373925_0264526 | Ga0373925_0264526_64_771 | 229 |
| 298 | 3300037068 | Ga0373925_0446782 | Ga0373925_0446782_132_821 | 229 |
| 299 | 3300039437 | Ga0436365_0714609 | Ga0436365_0714609_163_852 | 229 |
| 300 | 3300042011 | Ga0439454_037417 | Ga0439454_037417_49_768 | 229 |
| 301 | 3300046455 | Ga0495603_0320094 | Ga0495603_0320094_67_756 | 229 |
| 302 | 3300046457 | Ga0495590_0059190 | Ga0495590_0059190_321_1010 | 229 |
| 303 | 3300046457 | Ga0495590_0104214 | Ga0495590_0104214_169_858 | 229 |
| 304 | 3300046458 | Ga0495591_045991 | Ga0495591_045991_208_897 | 229 |
| 305 | 3300046459 | Ga0495629_0197650 | Ga0495629_0197650_41_730 | 229 |
| 306 | 3300046461 | Ga0495641_0119375 | Ga0495641_0119375_318_1025 | 229 |
| 307 | 3300046472 | Ga0495580_0191170 | Ga0495580_0191170_619_1308 | 229 |
| 308 | 3300046472 | Ga0495580_0418180 | Ga0495580_0418180_169_858 | 229 |
| 309 | 3300046473 | Ga0495582_0236150 | Ga0495582_0236150_112_801 | 229 |
| 310 | 3300046474 | Ga0495605_0043170 | Ga0495605_0043170_467_1156 | 229 |
| 311 | 3300046491 | Ga0495584_0044658 | Ga0495584_0044658_403_1092 | 229 |
| 312 | 3300046491 | Ga0495584_0158636 | Ga0495584_0158636_348_1037 | 229 |
| 313 | 3300046500 | Ga0495596_0028591 | Ga0495596_0028591_362_1051 | 229 |
| 314 | 3300046501 | Ga0495607_0107194 | Ga0495607_0107194_447_1136 | 229 |
| 315 | 3300046513 | Ga0495616_0109658 | Ga0495616_0109658_30_719 | 229 |
| 316 | 3300046515 | Ga0495620_0110187 | Ga0495620_0110187_334_1023 | 229 |
| 317 | 3300046517 | Ga0495630_0063328 | Ga0495630_0063328_1732_2439 | 229 |
| 318 | 3300046518 | Ga0495631_0042883 | Ga0495631_0042883_307_996 | 229 |
| 319 | 3300046519 | Ga0495632_0116335 | Ga0495632_0116335_84_773 | 229 |
| 320 | 3300046520 | Ga0495637_0052215 | Ga0495637_0052215_550_1239 | 229 |
| 321 | 3300046523 | Ga0495644_0040114 | Ga0495644_0040114_878_1585 | 229 |
| 322 | 3300046523 | Ga0495644_0063435 | Ga0495644_0063435_328_1017 | 229 |
| 323 | 3300046523 | Ga0495644_0099221 | Ga0495644_0099221_347_1036 | 229 |
| 324 | 3300046525 | Ga0495663_0012213 | Ga0495663_0012213_650_1339 | 229 |
| 325 | 3300046531 | Ga0495665_0078734 | Ga0495665_0078734_1000_1713 | 229 |
| 326 | 3300046533 | Ga0495640_0020582 | Ga0495640_0020582_2994_3683 | 229 |
| 327 | 3300046536 | Ga0495587_0202642 | Ga0495587_0202642_228_917 | 229 |
| 328 | 3300046537 | Ga0495598_0011678 | Ga0495598_0011678_980_1669 | 229 |
| 329 | 3300046538 | Ga0495609_0092196 | Ga0495609_0092196_418_1107 | 229 |
| 330 | 3300046539 | Ga0495621_0021555 | Ga0495621_0021555_1238_1927 | 229 |
| 331 | 3300046558 | Ga0495633_0036982 | Ga0495633_0036982_1051_1740 | 229 |
| 332 | 3300046558 | Ga0495633_0095250 | Ga0495633_0095250_168_875 | 229 |
| 333 | 3300046615 | Ga0495656_0064602 | Ga0495656_0064602_168_857 | 229 |
| 334 | 3300046615 | Ga0495656_0092175 | Ga0495656_0092175_298_1005 | 229 |
| 335 | 3300046616 | Ga0495668_0101324 | Ga0495668_0101324_580_1269 | 229 |
| 336 | 3300046648 | Ga0495611_0028514 | Ga0495611_0028514_636_1325 | 229 |
| 337 | 3300046664 | Ga0495659_0020393 | Ga0495659_0020393_659_1348 | 229 |
| 338 | 3300046664 | Ga0495659_0193852 | Ga0495659_0193852_52_741 | 229 |
| 339 | 3300046665 | Ga0495661_0103019 | Ga0495661_0103019_708_1397 | 229 |
| 340 | 3300046674 | Ga0495588_0094096 | Ga0495588_0094096_752_1441 | 229 |
| 341 | 3300046681 | Ga0495647_0132467 | Ga0495647_0132467_222_911 | 229 |
| 342 | 3300046683 | Ga0495658_0227375 | Ga0495658_0227375_204_893 | 229 |
| 343 | 3300046684 | Ga0495669_0053084 | Ga0495669_0053084_431_1120 | 229 |
| 344 | 3300046689 | Ga0495613_0157931 | Ga0495613_0157931_61_768 | 229 |
| 345 | 3300046690 | Ga0495624_0075579 | Ga0495624_0075579_970_1659 | 229 |
| 346 | 3300046690 | Ga0495624_0132077 | Ga0495624_0132077_346_1035 | 229 |
| 347 | 3300046691 | Ga0495670_0104949 | Ga0495670_0104949_96_785 | 229 |
| 348 | 3300046691 | Ga0495670_0134478 | Ga0495670_0134478_449_1156 | 229 |
| 349 | 3300046692 | Ga0495671_0058363 | Ga0495671_0058363_915_1604 | 229 |
| 350 | 3300046694 | Ga0495649_0335184 | Ga0495649_0335184_24_731 | 229 |
| 351 | 3300046794 | Ga0495589_0049898 | Ga0495589_0049898_904_1593 | 229 |
| 352 | 3300046794 | Ga0495589_0166428 | Ga0495589_0166428_14_703 | 229 |
| 353 | 3300046810 | Ga0495660_0104444 | Ga0495660_0104444_526_1215 | 229 |
| 354 | 3300047315 | Ga0495581_0097110 | Ga0495581_0097110_886_1575 | 229 |
| 355 | 3300047315 | Ga0495581_0382037 | Ga0495581_0382037_61_750 | 229 |
| 356 | 3300047319 | Ga0495674_0222499 | Ga0495674_0222499_56_745 | 229 |
| 357 | 3300047320 | Ga0495672_0030499 | Ga0495672_0030499_864_1553 | 229 |
| 358 | 3300047321 | Ga0495676_0170450 | Ga0495676_0170450_811_1500 | 229 |
| 359 | 3300047445 | Ga0495677_0025841 | Ga0495677_0025841_313_1002 | 229 |
| 360 | 3300047446 | Ga0495679_087792 | Ga0495679_087792_121_810 | 229 |
| 361 | 3300047447 | Ga0495685_068510 | Ga0495685_068510_425_1114 | 229 |
| 362 | 3300047469 | Ga0495673_0119501 | Ga0495673_0119501_333_1022 | 229 |
| 363 | 3300048089 | Ga0495614_0207660 | Ga0495614_0207660_30_719 | 229 |
| 364 | 3300048090 | Ga0495615_0036361 | Ga0495615_0036361_306_995 | 229 |
| 365 | 3300048091 | Ga0495626_0041194 | Ga0495626_0041194_1394_2083 | 229 |
| 366 | 3300048903 | Ga0496100_0037404 | Ga0496100_0037404_710_1399 | 229 |
| 367 | 3300048903 | Ga0496100_0039186 | Ga0496100_0039186_544_1233 | 229 |
| 368 | 3300048904 | Ga0496101_0166353 | Ga0496101_0166353_623_1312 | 229 |
| 369 | 3300048905 | Ga0496102_0253726 | Ga0496102_0253726_529_1218 | 229 |
| 370 | 3300048905 | Ga0496102_0430138 | Ga0496102_0430138_25_714 | 229 |
| 371 | 3300048907 | Ga0496104_0000463 | Ga0496104_0000463_24789_25493 | 229 |
| 372 | 3300048907 | Ga0496104_0007636 | Ga0496104_0007636_8030_8719 | 229 |
| 373 | 3300048907 | Ga0496104_0020467 | Ga0496104_0020467_1578_2273 | 229 |
| 374 | 3300048907 | Ga0496104_0273359 | Ga0496104_0273359_783_1472 | 229 |
| 375 | 3300048908 | Ga0496105_0002565 | Ga0496105_0002565_2300_2989 | 229 |
| 376 | 3300048908 | Ga0496105_0052148 | Ga0496105_0052148_1668_2363 | 229 |
| 377 | 3300048909 | Ga0496106_0013605 | Ga0496106_0013605_1859_2548 | 229 |
| 378 | 3300048909 | Ga0496106_0131985 | Ga0496106_0131985_1197_1886 | 229 |
| 379 | 3300048909 | Ga0496106_0385440 | Ga0496106_0385440_319_1023 | 229 |
| 380 | 3300048910 | Ga0496107_0091325 | Ga0496107_0091325_1523_2212 | 229 |
| 381 | 3300048911 | Ga0496108_0008355 | Ga0496108_0008355_2010_2699 | 229 |
| 382 | 3300048911 | Ga0496108_0097668 | Ga0496108_0097668_988_1683 | 229 |
| 383 | 3300048911 | Ga0496108_0324334 | Ga0496108_0324334_441_1130 | 229 |
| 384 | 3300048912 | Ga0496109_0000766 | Ga0496109_0000766_16016_16705 | 229 |
| 385 | 3300048912 | Ga0496109_0021363 | Ga0496109_0021363_134_823 | 229 |
| 386 | 3300048912 | Ga0496109_0054448 | Ga0496109_0054448_531_1226 | 229 |
| 387 | 3300048913 | Ga0496110_0002398 | Ga0496110_0002398_7654_8343 | 229 |
| 388 | 3300048913 | Ga0496110_0444707 | Ga0496110_0444707_130_819 | 229 |
| 389 | 3300048914 | Ga0496111_0065381 | Ga0496111_0065381_986_1675 | 229 |
| 390 | 3300048915 | Ga0496112_0001055 | Ga0496112_0001055_19417_20106 | 229 |
| 391 | 3300048915 | Ga0496112_0059117 | Ga0496112_0059117_2643_3332 | 229 |
| 392 | 3300048915 | Ga0496112_0159288 | Ga0496112_0159288_1488_2213 | 229 |
| 393 | 3300048915 | Ga0496112_0324627 | Ga0496112_0324627_541_1230 | 229 |
| 394 | 3300048916 | Ga0496113_0000323 | Ga0496113_0000323_16762_17451 | 229 |
| 395 | 3300048916 | Ga0496113_0055717 | Ga0496113_0055717_2133_2858 | 229 |
| 396 | 3300048916 | Ga0496113_0143935 | Ga0496113_0143935_1132_1836 | 229 |
| 397 | 3300048916 | Ga0496113_0254630 | Ga0496113_0254630_15_704 | 229 |
| 398 | 3300048917 | Ga0496114_0428300 | Ga0496114_0428300_451_1140 | 229 |
| 399 | 3300048918 | Ga0496115_0047145 | Ga0496115_0047145_1287_1982 | 229 |
| 400 | 3300048918 | Ga0496115_0137725 | Ga0496115_0137725_1240_1929 | 229 |
| 401 | 3300048918 | Ga0496115_0429093 | Ga0496115_0429093_280_969 | 229 |
| 402 | 3300049591 | Ga0501075_0634996 | Ga0501075_0634996_47_736 | 229 |
| 403 | 3300049592 | Ga0501076_0303608 | Ga0501076_0303608_554_1243 | 229 |
| 404 | 3300049593 | Ga0501077_0226060 | Ga0501077_0226060_91_780 | 229 |
| 405 | 3300049741 | Ga0501079_0190819 | Ga0501079_0190819_154_843 | 229 |
| 406 | 3300049741 | Ga0501079_0379040 | Ga0501079_0379040_195_893 | 229 |
| 407 | 3300049742 | Ga0501080_0731509 | Ga0501080_0731509_47_736 | 229 |
| 408 | 3300049743 | Ga0501081_0344581 | Ga0501081_0344581_319_1008 | 229 |
| 409 | 3300049743 | Ga0501081_0394410 | Ga0501081_0394410_55_753 | 229 |
| 410 | 3300049744 | Ga0501083_0207183 | Ga0501083_0207183_357_1046 | 229 |
| 411 | 3300050489 | nmdc:mga03683_27317_c1 | nmdc:mga03683_27317_c1_880_1569 | 229 |
| 412 | 3300050492 | nmdc:mga0yw44_3497_c1 | nmdc:mga0yw44_3497_c1_3677_4366 | 229 |
| 413 | 3300050492 | nmdc:mga0yw44_39629_c2 | nmdc:mga0yw44_39629_c2_695_1384 | 229 |
| 414 | 3300050492 | nmdc:mga0yw44_622550_c1 | nmdc:mga0yw44_622550_c1_20_709 | 229 |
| 415 | 3300050492 | nmdc:mga0yw44_9660_c1 | nmdc:mga0yw44_9660_c1_1998_2687 | 229 |
| 416 | 3300050494 | nmdc:mga06z11_63693_c1 | nmdc:mga06z11_63693_c1_812_1501 | 229 |
| 417 | 3300050495 | nmdc:mga04h51_29069_c1 | nmdc:mga04h51_29069_c1_644_1333 | 229 |
| 418 | 3300050507 | nmdc:mga05p37_48836_c1 | nmdc:mga05p37_48836_c1_484_1173 | 229 |
| 419 | 3300050507 | nmdc:mga05p37_509373_c1 | nmdc:mga05p37_509373_c1_308_997 | 229 |
| 420 | 3300050510 | nmdc:mga06r32_156799_c1 | nmdc:mga06r32_156799_c1_190_879 | 229 |
| 421 | 3300050510 | nmdc:mga06r32_165203_c1 | nmdc:mga06r32_165203_c1_731_1420 | 229 |
| 422 | 3300050511 | nmdc:mga08y16_197131_c1 | nmdc:mga08y16_197131_c1_1295_1984 | 229 |
| 423 | 3300050511 | nmdc:mga08y16_75239_c1 | nmdc:mga08y16_75239_c1_117_806 | 229 |
| 424 | 3300050512 | nmdc:mga0n895_41739_c1 | nmdc:mga0n895_41739_c1_223_912 | 229 |
| 425 | 3300050512 | nmdc:mga0n895_420450_c1 | nmdc:mga0n895_420450_c1_523_1230 | 229 |
| 426 | 3300050512 | nmdc:mga0n895_63761_c1 | nmdc:mga0n895_63761_c1_2063_2752 | 229 |
| 427 | 3300050513 | nmdc:mga0rr50_80216_c1 | nmdc:mga0rr50_80216_c1_1581_2270 | 229 |
| 428 | 3300050515 | nmdc:mga0a205_230682_c1 | nmdc:mga0a205_230682_c1_579_1286 | 229 |
| 429 | 3300053077 | Ga0495601_0071967 | Ga0495601_0071967_1074_1763 | 229 |
| 430 | 3300053083 | Ga0495655_0005433 | Ga0495655_0005433_1283_1972 | 229 |
| 431 | 3300053083 | Ga0495655_0048735 | Ga0495655_0048735_22_723 | 229 |
| 432 | 3300053085 | Ga0495619_0044661 | Ga0495619_0044661_1910_2599 | 229 |
| 433 | 3300054114 | Ga0501084_0255122 | Ga0501084_0255122_611_1300 | 229 |
| 434 | 3300059503 | Ga0587080_034213 | Ga0587080_034213_120_809 | 229 |
| 435 | 3300061734 | Ga0530510_0265594 | Ga0530510_0265594_343_1032 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1orr-assembly2.cif.gz_D | crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp | 0.728 | 10 | 61 |
| 5tz8-assembly1.cif.gz_B | crystal structure of s. aureus tars | 0.727 | 9 | 129 |
| 7msp-assembly2.cif.gz_B | suns glycosin s-glycosyltransferase | 0.7253 | 4 | 123 |
| 7p5l-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 - apo form | 0.7251 | 4 | 197 |
| 7msn-assembly1.cif.gz_B | suns glycosin s-glycosyltransferase | 0.7248 | 5 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8845 | 4 | 222 | 3.90.550.10 |
| af_O06376_3_236_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8716 | 2 | 224 | 3.90.550.10 |
| af_O06376_3_236_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8467 | 2 | 224 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8449 | 4 | 222 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8289 | 11 | 203 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538DNM5-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9735 | 8 | 120 |
GO:0016757
|
| AF-A0A7V9G772-F1-model_v4 | Glycosyltransferase | 0.9728 | 10 | 93 |
GO:0016757
|
| AF-A0A060CKF0-F1-model_v4 | CAZy families GT2 protein | 0.9629 | 9 | 88 |
GO:0016757
|
| AF-A0A7X7WGD2-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9601 | 8 | 101 |
GO:0016757
|
| AF-A0A7V9G772-F1-model_v4 | Glycosyltransferase | 0.9507 | 10 | 93 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar