F443368

General Info

Members Datasets Scaffolds Average Seq Length
435 267 435 228

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0111443|Ga0373925_0111443_865_1593
Length 242
Sequence MRILIRPIPWKRQMEIVSRAQVYVVIPAYNEGTVLSRVVTEVKRAGYAVVVVDDGSTDATADHAHAAGAAVIRHPFNLGQGAALQTGIDYALTQPAQFVVTFDADGQHRVADISRLTEALVRERADFALGSRFLGQAPNLPPLRRLMLQAATLFTRLTTGLQVTDTHNGLRAMTRRGAAALALRQNRMAHASECLSQIGSSGLRYVEQPVTIEYTAYSLAKGQNLRDAVLILLDLFARRLYR

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
223 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
263 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
264 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 16.09
Rhizosphere 77.24
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1006673 3300002070 Bacteria 1441
2 JGI24742J22300_10013026 3300002244 Bacteria 1391
3 Ga0070676_10142013 3300005328 Bacteria 1530
4 Ga0070683_100053001 3300005329 Bacteria 3759
5 Ga0070690_100264179 3300005330 Bacteria 1222
6 Ga0070670_100083808 3300005331 Bacteria 2739
7 Ga0070677_10039296 3300005333 Unclassified 1856
8 Ga0068869_100470181 3300005334 Bacteria 1045
9 Ga0070680_100369525 3300005336 Bacteria 1220
10 Ga0070682_100063751 3300005337 Bacteria 2338
11 Ga0070689_100104050 3300005340 Bacteria 2251
12 Ga0070689_100355210 3300005340 Bacteria 1230
13 Ga0070691_10104398 3300005341 Bacteria 1411
14 Ga0070687_100066062 3300005343 Bacteria 1926
15 Ga0070661_100096227 3300005344 Bacteria 2197
16 Ga0070692_10031896 3300005345 Bacteria 2645
17 Ga0070692_10047711 3300005345 Bacteria 2217
18 Ga0070668_100083720 3300005347 Bacteria 2504
19 Ga0070669_100049879 3300005353 Bacteria 3056
20 Ga0070669_100356130 3300005353 Bacteria 1189
21 Ga0070675_100080417 3300005354 Bacteria 2716
22 Ga0070675_100376294 3300005354 Bacteria 1263
23 Ga0070671_100281588 3300005355 Bacteria 1414
24 Ga0070673_100030762 3300005364 Bacteria 4023
25 Ga0070688_100012076 3300005365 Bacteria 4825
26 Ga0070659_100012408 3300005366 Bacteria 6318
27 Ga0070667_100048063 3300005367 Bacteria 3591
28 Ga0070667_100235202 3300005367 Bacteria 1635
29 Ga0070714_100004118 3300005435 Bacteria 10932
30 Ga0070713_100001118 3300005436 Bacteria 17119
31 Ga0070710_10001184 3300005437 Bacteria 12311
32 Ga0070711_100008435 3300005439 Bacteria 6312
33 Ga0070711_100185893 3300005439 Bacteria 1593
34 Ga0070700_100081610 3300005441 Bacteria 2089
35 Ga0070678_100658763 3300005456 Bacteria 940
36 Ga0070662_100066855 3300005457 Bacteria 2638
37 Ga0070662_100373542 3300005457 Bacteria 1172
38 Ga0068867_100076991 3300005459 Bacteria 2506
39 Ga0070685_10100644 3300005466 Bacteria 1764
40 Ga0070706_101122414 3300005467 Unclassified 724
41 Ga0070707_100188791 3300005468 Bacteria 2009
42 Ga0070699_100095779 3300005518 Bacteria 2599
43 Ga0070684_100228297 3300005535 Bacteria 1699
44 Ga0070686_100055919 3300005544 Bacteria 2530
45 Ga0070686_100106793 3300005544 Bacteria 1900
46 Ga0070695_100532998 3300005545 Bacteria 913
47 Ga0070665_100022039 3300005548 Bacteria 6409
48 Ga0070665_100139404 3300005548 Bacteria 2429
49 Ga0070704_100170908 3300005549 Bacteria 1729
50 Ga0070664_100111343 3300005564 Bacteria 2390
51 Ga0068857_100208005 3300005577 Bacteria 1785
52 Ga0068857_100235511 3300005577 Bacteria 1675
53 Ga0068856_100067111 3300005614 Bacteria 3545
54 Ga0068852_100181802 3300005616 Bacteria 1978
55 Ga0068864_100012803 3300005618 Bacteria 6935
56 Ga0068866_10017502 3300005718 Bacteria 3223
57 Ga0068861_100079988 3300005719 Bacteria 2556
58 Ga0068861_100235993 3300005719 Unclassified 1553
59 Ga0068870_10002002 3300005840 Bacteria 8433
60 Ga0068870_10316907 3300005840 Bacteria 990
61 Ga0068863_100020579 3300005841 Bacteria 6306
62 Ga0068858_100324213 3300005842 Bacteria 1472
63 Ga0068862_100015319 3300005844 Bacteria 6367
64 Ga0081455_10019031 3300005937 Bacteria 6512
65 Ga0081455_10043942 3300005937 Bacteria 3904
66 Ga0081455_10068174 3300005937 Bacteria 2962
67 Ga0081455_10189558 3300005937 Bacteria 1550
68 Ga0070717_10001698 3300006028 Bacteria 15327
69 Ga0070717_10156192 3300006028 Bacteria 1977
70 Ga0075365_10015278 3300006038 Bacteria 4640
71 Ga0075365_10065109 3300006038 Bacteria 2442
72 Ga0075365_10081034 3300006038 Bacteria 2198
73 Ga0075365_10121789 3300006038 Bacteria 1800
74 Ga0075365_10159171 3300006038 Bacteria 1573
75 Ga0075365_10197905 3300006038 Bacteria 1407
76 Ga0075368_10012815 3300006042 Bacteria 3072
77 Ga0075368_10109939 3300006042 Bacteria 1136
78 Ga0070715_10000121 3300006163 Bacteria 18586
79 Ga0070716_100065679 3300006173 Bacteria 2114
80 Ga0070712_100008593 3300006175 Bacteria 6425
81 Ga0075362_10008686 3300006177 Bacteria 3900
82 Ga0075367_10132176 3300006178 Bacteria 1543
83 Ga0075367_10164807 3300006178 Bacteria 1379
84 Ga0097621_100016412 3300006237 Bacteria 5598
85 Ga0075370_10014940 3300006353 Bacteria 4149
86 Ga0068871_100145251 3300006358 Bacteria 2019
87 Ga0068871_100222938 3300006358 Bacteria 1634
88 Ga0075428_100081230 3300006844 Bacteria 3537
89 Ga0075428_100100970 3300006844 Bacteria 3145
90 Ga0075428_100519090 3300006844 Bacteria 1274
91 Ga0075431_100254844 3300006847 Bacteria 1782
92 Ga0075431_100349127 3300006847 Bacteria 1488
93 Ga0075431_100488215 3300006847 Bacteria 1224
94 Ga0075431_100680303 3300006847 Bacteria 1007
95 Ga0075433_10034418 3300006852 Bacteria 4351
96 Ga0075433_10151629 3300006852 Bacteria 2062
97 Ga0075434_100009717 3300006871 Bacteria 8988
98 Ga0075434_100201149 3300006871 Bacteria 2012
99 Ga0068865_100037203 3300006881 Bacteria 3285
100 Ga0068865_100151967 3300006881 Bacteria 1757
101 Ga0099794_10009734 3300007265 Bacteria 4055
102 Ga0099795_10002353 3300007788 Bacteria 4423
103 Ga0099795_10002912 3300007788 Unclassified 4144
104 Ga0111539_10016349 3300009094 Bacteria 9199
105 Ga0111539_10032107 3300009094 Bacteria 6378
106 Ga0111539_10075369 3300009094 Bacteria 3974
107 Ga0111539_10288565 3300009094 Bacteria 1909
108 Ga0111539_10796107 3300009094 Bacteria 1100
109 Ga0105245_10173413 3300009098 Bacteria 2055
110 Ga0105245_10498989 3300009098 Bacteria 1233
111 Ga0105247_10006463 3300009101 Bacteria 7259
112 Ga0114129_10034551 3300009147 Bacteria 7142
113 Ga0105248_10336422 3300009177 Bacteria 1700
114 Ga0105249_10120373 3300009553 Bacteria 2494
115 Ga0099796_10042038 3300010159 Unclassified 1550
116 Ga0105239_10621471 3300010375 Bacteria 1233
117 Ga0105246_10050403 3300011119 Bacteria 2855
118 Ga0105246_10073164 3300011119 Bacteria 2419
119 Ga0105246_10483177 3300011119 Bacteria 1048
120 Ga0157370_10711643 3300013104 Unclassified 916
121 Ga0157378_10225906 3300013297 Bacteria 1782
122 Ga0163162_10021867 3300013306 Bacteria 6302
123 Ga0163162_10200983 3300013306 Bacteria 2122
124 Ga0163162_10276916 3300013306 Bacteria 1810
125 Ga0157375_10070108 3300013308 Bacteria 3514
126 Ga0157375_10136861 3300013308 Bacteria 2574
127 Ga0157375_10352526 3300013308 Bacteria 1637
128 Ga0163163_10069114 3300014325 Bacteria 3516
129 Ga0157380_10005881 3300014326 Bacteria 8581
130 Ga0157380_10047029 3300014326 Bacteria 3391
131 Ga0157380_10140731 3300014326 Unclassified 2073
132 Ga0157377_10007710 3300014745 Bacteria 5214
133 Ga0157377_10339666 3300014745 Bacteria 1004
134 Ga0157379_10133487 3300014968 Bacteria 2236
135 Ga0157379_10134200 3300014968 Bacteria 2229
136 Ga0157376_10032234 3300014969 Unclassified 4205
137 Ga0157376_10319592 3300014969 Bacteria 1475
138 Ga0163161_10376867 3300017792 Bacteria 1133
139 Ga0206350_11605048 3300020080 Unclassified 800
140 Ga0207697_10037322 3300025315 Bacteria 1990
141 Ga0207656_10084462 3300025321 Bacteria 1432
142 Ga0207692_10000094 3300025898 Bacteria 26409
143 Ga0207642_10023895 3300025899 Bacteria 2449
144 Ga0207688_10000663 3300025901 Bacteria 16993
145 Ga0207680_10055526 3300025903 Bacteria 2387
146 Ga0207685_10026766 3300025905 Unclassified 2010
147 Ga0207699_10002950 3300025906 Bacteria 8092
148 Ga0207645_10019254 3300025907 Bacteria 4477
149 Ga0207643_10000808 3300025908 Bacteria 19021
150 Ga0207643_10010809 3300025908 Bacteria 4922
151 Ga0207705_10022634 3300025909 Bacteria 4481
152 Ga0207693_10013527 3300025915 Bacteria 6577
153 Ga0207663_10000575 3300025916 Bacteria 16196
154 Ga0207663_10041410 3300025916 Bacteria 2807
155 Ga0207660_10285981 3300025917 Bacteria 1310
156 Ga0207662_10035677 3300025918 Bacteria 2905
157 Ga0207649_10083768 3300025920 Bacteria 2071
158 Ga0207646_10061562 3300025922 Bacteria 3350
159 Ga0207681_10479802 3300025923 Bacteria 1015
160 Ga0207650_10092570 3300025925 Bacteria 2313
161 Ga0207650_10109340 3300025925 Bacteria 2138
162 Ga0207659_10003344 3300025926 Bacteria 9616
163 Ga0207659_10020638 3300025926 Bacteria 4358
164 Ga0207659_10328611 3300025926 Bacteria 1263
165 Ga0207700_10050297 3300025928 Unclassified 3105
166 Ga0207664_10011516 3300025929 Bacteria 6293
167 Ga0207690_10101778 3300025932 Bacteria 2053
168 Ga0207706_10007308 3300025933 Bacteria 10214
169 Ga0207670_10046122 3300025936 Bacteria 2893
170 Ga0207670_10112070 3300025936 Bacteria 1968
171 Ga0207670_10295432 3300025936 Unclassified 1267
172 Ga0207669_10484513 3300025937 Bacteria 986
173 Ga0207704_10075670 3300025938 Bacteria 2154
174 Ga0207665_10014420 3300025939 Bacteria 5204
175 Ga0207691_10026975 3300025940 Bacteria 5389
176 Ga0207711_10047767 3300025941 Bacteria 3661
177 Ga0207689_10116691 3300025942 Bacteria 2194
178 Ga0207661_10015655 3300025944 Bacteria 5587
179 Ga0207661_10090369 3300025944 Bacteria 2550
180 Ga0207679_10110607 3300025945 Bacteria 2168
181 Ga0207667_10946862 3300025949 Bacteria 851
182 Ga0207651_10047291 3300025960 Unclassified 2900
183 Ga0207712_10015779 3300025961 Bacteria 4879
184 Ga0207668_10058626 3300025972 Bacteria 2692
185 Ga0207640_10155928 3300025981 Bacteria 1683
186 Ga0207658_10046363 3300025986 Bacteria 3174
187 Ga0207677_10272859 3300026023 Bacteria 1384
188 Ga0207703_10096819 3300026035 Bacteria 2492
189 Ga0207639_10474557 3300026041 Bacteria 1139
190 Ga0207678_10022427 3300026067 Bacteria 5529
191 Ga0207708_10032444 3300026075 Bacteria 3966
192 Ga0207641_10055543 3300026088 Bacteria 3363
193 Ga0207641_10112659 3300026088 Bacteria 2414
194 Ga0207648_10030869 3300026089 Bacteria 4742
195 Ga0207676_10133199 3300026095 Bacteria 2116
196 Ga0207674_10186918 3300026116 Bacteria 2022
197 Ga0207675_100103623 3300026118 Unclassified 2681
198 Ga0207675_100115017 3300026118 Bacteria 2541
199 Ga0207675_100607676 3300026118 Bacteria 1097
200 Ga0207683_10002624 3300026121 Bacteria 15706
201 Ga0207683_10691502 3300026121 Bacteria 945
202 Ga0207698_10630050 3300026142 Bacteria 1060
203 Ga0209813_10060549 3300027866 Bacteria 1207
204 Ga0207428_10027247 3300027907 Bacteria 4759
205 Ga0268265_10030740 3300028380 Bacteria 3871
206 Ga0265327_10014016 3300031251 Bacteria 5278
207 Ga0307410_10372893 3300031852 Bacteria 1146
208 Ga0307416_100191839 3300032002 Bacteria 1928
209 Ga0307415_100070222 3300032126 Bacteria 2459
210 Ga0373958_0020322 3300034819 Bacteria 1222
211 Ga0373926_0085342 3300035083 Unclassified 1171
212 Ga0373952_0058233 3300035092 Bacteria 938
213 Ga0373943_0073188 3300035170 Unclassified 1740
214 Ga0373943_0158256 3300035170 Bacteria 1231
215 Ga0373946_0017468 3300035171 Bacteria 2745
216 Ga0373955_0362301 3300035172 Bacteria 879
217 Ga0373927_0026617 3300035695 Bacteria 3780
218 Ga0373927_0214210 3300035695 Bacteria 1265
219 Ga0373927_0216921 3300035695 Unclassified 1257
220 Ga0373947_0042742 3300035725 Bacteria 2705
221 Ga0373947_0058796 3300035725 Bacteria 2330
222 Ga0373947_0189140 3300035725 Bacteria 1343
223 Ga0373947_0260276 3300035725 Bacteria 1149
224 Ga0373947_0281639 3300035725 Bacteria 1105
225 Ga0373937_0260348 3300036401 Bacteria 1636
226 Ga0373925_0051626 3300037068 Bacteria 3070
227 Ga0373925_0095652 3300037068 Unclassified 2276
228 Ga0373925_0111443 3300037068 Bacteria 2114
229 Ga0373925_0134722 3300037068 Bacteria 1929
230 Ga0373925_0264526 3300037068 Bacteria 1382
231 Ga0373925_0446782 3300037068 Bacteria 1058
232 Ga0395899_0089919 3300037312 Bacteria 2226
233 Ga0395900_0040729 3300037418 Bacteria 4787
234 Ga0395898_0526117 3300037466 Bacteria 1124
235 Ga0395901_0061861 3300038443 Bacteria 3895
236 Ga0436365_0714609 3300039437 Bacteria 1182
237 Ga0436363_0801524 3300039450 Bacteria 2118
238 Ga0439439_0104799 3300041406 Bacteria 780
239 Ga0439454_037417 3300042011 Unclassified 783
240 Ga0495603_0320094 3300046455 Bacteria 890
241 Ga0495590_0059190 3300046457 Bacteria 1340
242 Ga0495590_0104214 3300046457 Bacteria 1009
243 Ga0495591_045991 3300046458 Bacteria 1214
244 Ga0495629_0197650 3300046459 Bacteria 1391
245 Ga0495638_0367765 3300046460 Bacteria 755
246 Ga0495641_0119375 3300046461 Bacteria 1176
247 Ga0495580_0191170 3300046472 Bacteria 1412
248 Ga0495580_0418180 3300046472 Bacteria 902
249 Ga0495582_0236150 3300046473 Bacteria 1047
250 Ga0495605_0043170 3300046474 Bacteria 2236
251 Ga0495662_0262406 3300046476 Bacteria 850
252 Ga0495584_0044658 3300046491 Bacteria 2236
253 Ga0495584_0158636 3300046491 Bacteria 1149
254 Ga0495596_0028591 3300046500 Bacteria 2237
255 Ga0495596_0080653 3300046500 Bacteria 1263
256 Ga0495607_0107194 3300046501 Bacteria 1486
257 Ga0495616_0109658 3300046513 Bacteria 1283
258 Ga0495616_0158207 3300046513 Bacteria 1021
259 Ga0495620_0110187 3300046515 Bacteria 1091
260 Ga0495630_0063328 3300046517 Bacteria 2778
261 Ga0495631_0042883 3300046518 Bacteria 1998
262 Ga0495632_0116335 3300046519 Bacteria 1252
263 Ga0495637_0052215 3300046520 Bacteria 1707
264 Ga0495644_0040114 3300046523 Bacteria 1765
265 Ga0495644_0063435 3300046523 Bacteria 1388
266 Ga0495644_0099221 3300046523 Bacteria 1101
267 Ga0495663_0012213 3300046525 Unclassified 2393
268 Ga0495665_0078734 3300046531 Bacteria 1734
269 Ga0495640_0020582 3300046533 Bacteria 4854
270 Ga0495587_0202642 3300046536 Bacteria 1122
271 Ga0495598_0001326 3300046537 Bacteria 4856
272 Ga0495598_0011678 3300046537 Bacteria 2135
273 Ga0495598_0086331 3300046537 Bacteria 1015
274 Ga0495609_0092196 3300046538 Bacteria 1317
275 Ga0495621_0021555 3300046539 Bacteria 2125
276 Ga0495633_0036982 3300046558 Unclassified 2337
277 Ga0495633_0095250 3300046558 Bacteria 1383
278 Ga0495656_0064602 3300046615 Unclassified 1607
279 Ga0495656_0092175 3300046615 Bacteria 1387
280 Ga0495668_0101324 3300046616 Bacteria 1575
281 Ga0495611_0028514 3300046648 Bacteria 2445
282 Ga0495625_0234581 3300046660 Bacteria 1197
283 Ga0495659_0020393 3300046664 Bacteria 2226
284 Ga0495659_0193852 3300046664 Bacteria 831
285 Ga0495661_0103019 3300046665 Unclassified 1603
286 Ga0495588_0094096 3300046674 Bacteria 1571
287 Ga0495588_0414141 3300046674 Unclassified 707
288 Ga0495646_0240153 3300046680 Bacteria 974
289 Ga0495647_0120227 3300046681 Bacteria 1104
290 Ga0495647_0132467 3300046681 Unclassified 1057
291 Ga0495658_0227375 3300046683 Bacteria 1169
292 Ga0495669_0053084 3300046684 Unclassified 1822
293 Ga0495613_0157931 3300046689 Bacteria 1615
294 Ga0495624_0075579 3300046690 Bacteria 2092
295 Ga0495624_0132077 3300046690 Bacteria 1531
296 Ga0495670_0073866 3300046691 Bacteria 1729
297 Ga0495670_0104949 3300046691 Bacteria 1458
298 Ga0495670_0134478 3300046691 Bacteria 1290
299 Ga0495671_0058363 3300046692 Unclassified 1909
300 Ga0495649_0335184 3300046694 Bacteria 766
301 Ga0495589_0049898 3300046794 Unclassified 2071
302 Ga0495589_0166428 3300046794 Bacteria 1049
303 Ga0495660_0002653 3300046810 Bacteria 11334
304 Ga0495660_0104444 3300046810 Bacteria 1454
305 Ga0495581_0097110 3300047315 Bacteria 1711
306 Ga0495581_0382037 3300047315 Bacteria 822
307 Ga0495674_0222499 3300047319 Bacteria 1560
308 Ga0495672_0030499 3300047320 Bacteria 3381
309 Ga0495676_0170450 3300047321 Bacteria 1532
310 Ga0495677_0025841 3300047445 Bacteria 2130
311 Ga0495679_087792 3300047446 Bacteria 875
312 Ga0495685_068510 3300047447 Bacteria 1191
313 Ga0495673_0119501 3300047469 Bacteria 1045
314 Ga0495614_0207660 3300048089 Bacteria 887
315 Ga0495615_0036361 3300048090 Bacteria 1208
316 Ga0495626_0041194 3300048091 Bacteria 2177
317 Ga0496100_0017619 3300048903 Bacteria 4221
318 Ga0496100_0037404 3300048903 Bacteria 3068
319 Ga0496100_0039186 3300048903 Bacteria 3008
320 Ga0496100_0078940 3300048903 Bacteria 2216
321 Ga0496100_0110273 3300048903 Bacteria 1910
322 Ga0496101_0095503 3300048904 Bacteria 2217
323 Ga0496101_0166353 3300048904 Bacteria 1693
324 Ga0496101_0696755 3300048904 Bacteria 802
325 Ga0496102_0152819 3300048905 Bacteria 2169
326 Ga0496102_0253726 3300048905 Bacteria 1658
327 Ga0496102_0276683 3300048905 Bacteria 1582
328 Ga0496102_0430138 3300048905 Bacteria 1239
329 Ga0496103_0009597 3300048906 Bacteria 5729
330 Ga0496103_0158179 3300048906 Unclassified 1453
331 Ga0496103_0421104 3300048906 Bacteria 857
332 Ga0496104_0000463 3300048907 Bacteria 34981
333 Ga0496104_0007636 3300048907 Bacteria 9575
334 Ga0496104_0020467 3300048907 Bacteria 6064
335 Ga0496104_0033526 3300048907 Bacteria 4785
336 Ga0496104_0166281 3300048907 Bacteria 2115
337 Ga0496104_0273359 3300048907 Bacteria 1602
338 Ga0496105_0002565 3300048908 Bacteria 13193
339 Ga0496105_0052148 3300048908 Bacteria 3378
340 Ga0496105_0092475 3300048908 Bacteria 2497
341 Ga0496105_0247982 3300048908 Bacteria 1443
342 Ga0496106_0005940 3300048909 Bacteria 9019
343 Ga0496106_0008424 3300048909 Bacteria 7627
344 Ga0496106_0013605 3300048909 Bacteria 6007
345 Ga0496106_0131985 3300048909 Bacteria 1959
346 Ga0496106_0385440 3300048909 Bacteria 1126
347 Ga0496107_0015140 3300048910 Bacteria 5403
348 Ga0496107_0056695 3300048910 Bacteria 2831
349 Ga0496107_0091325 3300048910 Bacteria 2225
350 Ga0496107_0755830 3300048910 Unclassified 713
351 Ga0496108_0008355 3300048911 Bacteria 8397
352 Ga0496108_0019842 3300048911 Bacteria 5522
353 Ga0496108_0038637 3300048911 Bacteria 3976
354 Ga0496108_0097668 3300048911 Bacteria 2503
355 Ga0496108_0324334 3300048911 Bacteria 1342
356 Ga0496109_0000766 3300048912 Bacteria 26715
357 Ga0496109_0003421 3300048912 Bacteria 13266
358 Ga0496109_0021363 3300048912 Bacteria 5722
359 Ga0496109_0022999 3300048912 Bacteria 5527
360 Ga0496109_0025633 3300048912 Bacteria 5255
361 Ga0496109_0054448 3300048912 Bacteria 3650
362 Ga0496110_0000307 3300048913 Bacteria 32320
363 Ga0496110_0002398 3300048913 Bacteria 14041
364 Ga0496110_0378444 3300048913 Bacteria 1290
365 Ga0496110_0444707 3300048913 Bacteria 1181
366 Ga0496111_0000405 3300048914 Bacteria 21591
367 Ga0496111_0065381 3300048914 Bacteria 2639
368 Ga0496111_0238815 3300048914 Bacteria 1349
369 Ga0496112_0001055 3300048915 Bacteria 20328
370 Ga0496112_0017128 3300048915 Bacteria 6804
371 Ga0496112_0023346 3300048915 Bacteria 5908
372 Ga0496112_0059117 3300048915 Unclassified 3777
373 Ga0496112_0159288 3300048915 Bacteria 2224
374 Ga0496112_0324627 3300048915 Bacteria 1483
375 Ga0496113_0000323 3300048916 Bacteria 22774
376 Ga0496113_0003061 3300048916 Bacteria 9915
377 Ga0496113_0055717 3300048916 Bacteria 2965
378 Ga0496113_0083958 3300048916 Bacteria 2444
379 Ga0496113_0143935 3300048916 Bacteria 1877
380 Ga0496113_0254630 3300048916 Bacteria 1402
381 Ga0496114_0284814 3300048917 Bacteria 1457
382 Ga0496114_0428300 3300048917 Unclassified 1172
383 Ga0496115_0047145 3300048918 Bacteria 3445
384 Ga0496115_0061809 3300048918 Bacteria 3020
385 Ga0496115_0137725 3300048918 Bacteria 2013
386 Ga0496115_0429093 3300048918 Bacteria 1070
387 Ga0501075_0634996 3300049591 Bacteria 814
388 Ga0501076_0166483 3300049592 Unclassified 1797
389 Ga0501076_0303608 3300049592 Bacteria 1309
390 Ga0501077_0226060 3300049593 Bacteria 1190
391 Ga0501079_0190819 3300049741 Bacteria 1599
392 Ga0501079_0379040 3300049741 Bacteria 1109
393 Ga0501080_0731509 3300049742 Bacteria 871
394 Ga0501081_0310581 3300049743 Bacteria 1158
395 Ga0501081_0344581 3300049743 Bacteria 1097
396 Ga0501081_0394410 3300049743 Bacteria 1024
397 Ga0501083_0000053 3300049744 Bacteria 83252
398 Ga0501083_0207183 3300049744 Bacteria 1279
399 nmdc:mga03683_27317_c1 3300050489 Bacteria 2258
400 nmdc:mga03n38_21837_c1 3300050490 Bacteria 2582
401 nmdc:mga0yw44_3497_c1 3300050492 Bacteria 6988
402 nmdc:mga0yw44_39629_c2 3300050492 Bacteria 1542
403 nmdc:mga0yw44_47211_c1 3300050492 Bacteria 2590
404 nmdc:mga0yw44_622550_c1 3300050492 Bacteria 733
405 nmdc:mga0yw44_9660_c1 3300050492 Bacteria 4895
406 nmdc:mga06z11_63693_c1 3300050494 Bacteria 1930
407 nmdc:mga04h51_26235_c1 3300050495 Bacteria 1800
408 nmdc:mga04h51_29069_c1 3300050495 Bacteria 1729
409 nmdc:mga07m45_72828_c1 3300050496 Bacteria 1956
410 nmdc:mga05p37_48836_c1 3300050507 Bacteria 5204
411 nmdc:mga05p37_509373_c1 3300050507 Bacteria 1379
412 nmdc:mga06r32_156799_c1 3300050510 Bacteria 2258
413 nmdc:mga06r32_165203_c1 3300050510 Bacteria 2196
414 nmdc:mga08y16_197131_c1 3300050511 Bacteria 2087
415 nmdc:mga08y16_664852_c1 3300050511 Archaea 1045
416 nmdc:mga08y16_686780_c1 3300050511 Bacteria 1025
417 nmdc:mga08y16_75239_c1 3300050511 Bacteria 3520
418 nmdc:mga0n895_41739_c1 3300050512 Bacteria 4461
419 nmdc:mga0n895_420450_c1 3300050512 Bacteria 1351
420 nmdc:mga0n895_506282_c1 3300050512 Bacteria 1216
421 nmdc:mga0n895_63761_c1 3300050512 Bacteria 3644
422 nmdc:mga0rr50_80216_c1 3300050513 Bacteria 2515
423 nmdc:mga0a205_230682_c1 3300050515 Bacteria 1734
424 Ga0495601_0071967 3300053077 Bacteria 2208
425 Ga0495601_0140372 3300053077 Bacteria 1576
426 Ga0495655_0005433 3300053083 Unclassified 2249
427 Ga0495655_0048735 3300053083 Bacteria 1113
428 Ga0495619_0044661 3300053085 Bacteria 2909
429 Ga0495619_0269347 3300053085 Bacteria 1180
430 Ga0500562_000001 3300053108 Bacteria 1178987
431 Ga0500642_0062934 3300053130 Bacteria 1671
432 Ga0500655_007010 3300053133 Bacteria 2026
433 Ga0501084_0255122 3300054114 Bacteria 1480
434 Ga0587080_034213 3300059503 Unclassified 899
435 Ga0530510_0265594 3300061734 Bacteria 1280

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0367765 Ga0495638_0367765_15_599 194
2 3300036401 Ga0373937_0260348 Ga0373937_0260348_13_615 200
3 3300037068 Ga0373925_0134722 Ga0373925_0134722_680_1342 200
4 3300009094 Ga0111539_10016349 Ga0111539_100163499 204
5 3300014326 Ga0157380_10047029 Ga0157380_100470294 204
6 3300046537 Ga0495598_0001326 Ga0495598_0001326_10_624 204
7 3300046681 Ga0495647_0120227 Ga0495647_0120227_11_625 204
8 3300048903 Ga0496100_0110273 Ga0496100_0110273_1259_1873 204
9 3300048906 Ga0496103_0421104 Ga0496103_0421104_223_837 204
10 3300048910 Ga0496107_0755830 Ga0496107_0755830_60_674 204
11 3300050511 nmdc:mga08y16_664852_c1 nmdc:mga08y16_664852_c1_139_759 204
12 3300050511 nmdc:mga08y16_686780_c1 nmdc:mga08y16_686780_c1_381_995 204
13 3300053130 Ga0500642_0062934 Ga0500642_0062934_788_1444 211
14 3300035170 Ga0373943_0073188 Ga0373943_0073188_776_1456 214
15 3300035695 Ga0373927_0216921 Ga0373927_0216921_311_991 214
16 3300037068 Ga0373925_0095652 Ga0373925_0095652_729_1409 214
17 3300049744 Ga0501083_0000053 Ga0501083_0000053_35765_36436 218
18 3300025936 Ga0207670_10295432 Ga0207670_102954322 219
19 3300035092 Ga0373952_0058233 Ga0373952_0058233_29_688 219
20 3300046537 Ga0495598_0086331 Ga0495598_0086331_81_740 219
21 3300046691 Ga0495670_0073866 Ga0495670_0073866_911_1570 219
22 3300048903 Ga0496100_0078940 Ga0496100_0078940_1180_1839 219
23 3300048904 Ga0496101_0095503 Ga0496101_0095503_617_1276 219
24 3300048904 Ga0496101_0696755 Ga0496101_0696755_25_684 219
25 3300048905 Ga0496102_0152819 Ga0496102_0152819_212_871 219
26 3300048906 Ga0496103_0009597 Ga0496103_0009597_4263_4922 219
27 3300048907 Ga0496104_0166281 Ga0496104_0166281_693_1352 219
28 3300048908 Ga0496105_0092475 Ga0496105_0092475_693_1352 219
29 3300048909 Ga0496106_0008424 Ga0496106_0008424_6950_7609 219
30 3300048910 Ga0496107_0015140 Ga0496107_0015140_4067_4726 219
31 3300048911 Ga0496108_0038637 Ga0496108_0038637_1390_2049 219
32 3300048912 Ga0496109_0025633 Ga0496109_0025633_832_1491 219
33 3300048915 Ga0496112_0023346 Ga0496112_0023346_4999_5658 219
34 3300048916 Ga0496113_0083958 Ga0496113_0083958_340_999 219
35 3300048917 Ga0496114_0284814 Ga0496114_0284814_19_678 219
36 3300048918 Ga0496115_0061809 Ga0496115_0061809_1211_1870 219
37 3300010159 Ga0099796_10042038 Ga0099796_100420383 220
38 3300046476 Ga0495662_0262406 Ga0495662_0262406_18_683 221
39 3300046500 Ga0495596_0080653 Ga0495596_0080653_303_968 221
40 3300046513 Ga0495616_0158207 Ga0495616_0158207_178_843 221
41 3300046660 Ga0495625_0234581 Ga0495625_0234581_509_1174 221
42 3300046674 Ga0495588_0414141 Ga0495588_0414141_25_690 221
43 3300048906 Ga0496103_0158179 Ga0496103_0158179_162_827 221
44 3300048913 Ga0496110_0378444 Ga0496110_0378444_425_1090 221
45 3300050492 nmdc:mga0yw44_47211_c1 nmdc:mga0yw44_47211_c1_19_684 221
46 3300050512 nmdc:mga0n895_506282_c1 nmdc:mga0n895_506282_c1_162_827 221
47 3300053085 Ga0495619_0269347 Ga0495619_0269347_235_933 222
48 3300005353 Ga0070669_100356130 Ga0070669_1003561302 223
49 3300005354 Ga0070675_100376294 Ga0070675_1003762942 223
50 3300005518 Ga0070699_100095779 Ga0070699_1000957793 223
51 3300025926 Ga0207659_10328611 Ga0207659_103286112 223
52 3300046810 Ga0495660_0002653 Ga0495660_0002653_9710_10390 223
53 3300053108 Ga0500562_000001 Ga0500562_000001_900859_901539 223
54 3300053133 Ga0500655_007010 Ga0500655_007010_447_1127 223
55 3300006038 Ga0075365_10081034 Ga0075365_100810342 224
56 3300006353 Ga0075370_10014940 Ga0075370_100149402 224
57 3300050490 nmdc:mga03n38_21837_c1 nmdc:mga03n38_21837_c1_1763_2446 224
58 3300050495 nmdc:mga04h51_26235_c1 nmdc:mga04h51_26235_c1_377_1060 224
59 3300050496 nmdc:mga07m45_72828_c1 nmdc:mga07m45_72828_c1_584_1267 224
60 3300031251 Ga0265327_10014016 Ga0265327_100140163 225
61 3300035725 Ga0373947_0058796 Ga0373947_0058796_119_799 225
62 3300037466 Ga0395898_0526117 Ga0395898_0526117_411_1100 225
63 3300005340 Ga0070689_100355210 Ga0070689_1003552101 226
64 3300005544 Ga0070686_100106793 Ga0070686_1001067933 226
65 3300005577 Ga0068857_100235511 Ga0068857_1002355112 226
66 3300007265 Ga0099794_10009734 Ga0099794_100097343 226
67 3300007788 Ga0099795_10002353 Ga0099795_100023535 226
68 3300011119 Ga0105246_10073164 Ga0105246_100731643 226
69 3300013306 Ga0163162_10021867 Ga0163162_100218676 226
70 3300014968 Ga0157379_10134200 Ga0157379_101342003 226
71 3300026023 Ga0207677_10272859 Ga0207677_102728592 226
72 3300031852 Ga0307410_10372893 Ga0307410_103728932 226
73 3300032002 Ga0307416_100191839 Ga0307416_1001918392 226
74 3300032126 Ga0307415_100070222 Ga0307415_1000702222 226
75 3300049592 Ga0501076_0166483 Ga0501076_0166483_652_1338 226
76 3300049743 Ga0501081_0310581 Ga0501081_0310581_398_1084 226
77 3300005336 Ga0070680_100369525 Ga0070680_1003695252 227
78 3300005345 Ga0070692_10047711 Ga0070692_100477112 227
79 3300005435 Ga0070714_100004118 Ga0070714_1000041186 227
80 3300005436 Ga0070713_100001118 Ga0070713_1000011187 227
81 3300005437 Ga0070710_10001184 Ga0070710_100011846 227
82 3300005439 Ga0070711_100008435 Ga0070711_1000084355 227
83 3300005457 Ga0070662_100373542 Ga0070662_1003735422 227
84 3300005467 Ga0070706_101122414 Ga0070706_1011224141 227
85 3300006028 Ga0070717_10001698 Ga0070717_100016987 227
86 3300006163 Ga0070715_10000121 Ga0070715_1000012111 227
87 3300006173 Ga0070716_100065679 Ga0070716_1000656792 227
88 3300006175 Ga0070712_100008593 Ga0070712_1000085936 227
89 3300006847 Ga0075431_100488215 Ga0075431_1004882152 227
90 3300006852 Ga0075433_10151629 Ga0075433_101516293 227
91 3300006871 Ga0075434_100201149 Ga0075434_1002011492 227
92 3300009094 Ga0111539_10288565 Ga0111539_102885652 227
93 3300025898 Ga0207692_10000094 Ga0207692_1000009414 227
94 3300025905 Ga0207685_10026766 Ga0207685_100267662 227
95 3300025906 Ga0207699_10002950 Ga0207699_100029508 227
96 3300025909 Ga0207705_10022634 Ga0207705_100226344 227
97 3300025915 Ga0207693_10013527 Ga0207693_100135278 227
98 3300025916 Ga0207663_10000575 Ga0207663_1000057512 227
99 3300025928 Ga0207700_10050297 Ga0207700_100502973 227
100 3300025929 Ga0207664_10011516 Ga0207664_100115165 227
101 3300025939 Ga0207665_10014420 Ga0207665_100144204 227
102 3300025944 Ga0207661_10015655 Ga0207661_100156553 227
103 3300025949 Ga0207667_10946862 Ga0207667_109468622 227
104 3300037312 Ga0395899_0089919 Ga0395899_0089919_1467_2150 227
105 3300037418 Ga0395900_0040729 Ga0395900_0040729_3566_4249 227
106 3300038443 Ga0395901_0061861 Ga0395901_0061861_1746_2429 227
107 3300039450 Ga0436363_0801524 Ga0436363_0801524_1008_1691 227
108 3300005334 Ga0068869_100470181 Ga0068869_1004701812 228
109 3300005355 Ga0070671_100281588 Ga0070671_1002815882 228
110 3300005548 Ga0070665_100139404 Ga0070665_1001394042 228
111 3300006178 Ga0075367_10132176 Ga0075367_101321762 228
112 3300006844 Ga0075428_100519090 Ga0075428_1005190902 228
113 3300041406 Ga0439439_0104799 Ga0439439_0104799_24_713 228
114 3300046680 Ga0495646_0240153 Ga0495646_0240153_169_855 228
115 3300048903 Ga0496100_0017619 Ga0496100_0017619_692_1378 228
116 3300048905 Ga0496102_0276683 Ga0496102_0276683_88_774 228
117 3300048907 Ga0496104_0033526 Ga0496104_0033526_987_1673 228
118 3300048908 Ga0496105_0247982 Ga0496105_0247982_703_1389 228
119 3300048909 Ga0496106_0005940 Ga0496106_0005940_1659_2345 228
120 3300048910 Ga0496107_0056695 Ga0496107_0056695_1600_2286 228
121 3300048911 Ga0496108_0019842 Ga0496108_0019842_2224_2910 228
122 3300048912 Ga0496109_0003421 Ga0496109_0003421_5327_6013 228
123 3300048912 Ga0496109_0022999 Ga0496109_0022999_3168_3854 228
124 3300048913 Ga0496110_0000307 Ga0496110_0000307_12919_13605 228
125 3300048914 Ga0496111_0000405 Ga0496111_0000405_12362_13048 228
126 3300048914 Ga0496111_0238815 Ga0496111_0238815_41_727 228
127 3300048915 Ga0496112_0017128 Ga0496112_0017128_1663_2349 228
128 3300048916 Ga0496113_0003061 Ga0496113_0003061_8932_9618 228
129 3300053077 Ga0495601_0140372 Ga0495601_0140372_663_1349 228
130 3300002070 JGI24750J21931_1006673 JGI24750J21931_10066733 229
131 3300002244 JGI24742J22300_10013026 JGI24742J22300_100130262 229
132 3300005328 Ga0070676_10142013 Ga0070676_101420133 229
133 3300005329 Ga0070683_100053001 Ga0070683_1000530013 229
134 3300005330 Ga0070690_100264179 Ga0070690_1002641791 229
135 3300005331 Ga0070670_100083808 Ga0070670_1000838083 229
136 3300005333 Ga0070677_10039296 Ga0070677_100392962 229
137 3300005337 Ga0070682_100063751 Ga0070682_1000637513 229
138 3300005340 Ga0070689_100104050 Ga0070689_1001040502 229
139 3300005341 Ga0070691_10104398 Ga0070691_101043981 229
140 3300005343 Ga0070687_100066062 Ga0070687_1000660621 229
141 3300005344 Ga0070661_100096227 Ga0070661_1000962273 229
142 3300005345 Ga0070692_10031896 Ga0070692_100318963 229
143 3300005347 Ga0070668_100083720 Ga0070668_1000837203 229
144 3300005353 Ga0070669_100049879 Ga0070669_1000498793 229
145 3300005354 Ga0070675_100080417 Ga0070675_1000804173 229
146 3300005364 Ga0070673_100030762 Ga0070673_1000307622 229
147 3300005365 Ga0070688_100012076 Ga0070688_1000120765 229
148 3300005366 Ga0070659_100012408 Ga0070659_1000124085 229
149 3300005367 Ga0070667_100048063 Ga0070667_1000480634 229
150 3300005367 Ga0070667_100235202 Ga0070667_1002352021 229
151 3300005439 Ga0070711_100185893 Ga0070711_1001858932 229
152 3300005441 Ga0070700_100081610 Ga0070700_1000816102 229
153 3300005456 Ga0070678_100658763 Ga0070678_1006587631 229
154 3300005457 Ga0070662_100066855 Ga0070662_1000668553 229
155 3300005459 Ga0068867_100076991 Ga0068867_1000769912 229
156 3300005466 Ga0070685_10100644 Ga0070685_101006443 229
157 3300005468 Ga0070707_100188791 Ga0070707_1001887912 229
158 3300005535 Ga0070684_100228297 Ga0070684_1002282971 229
159 3300005544 Ga0070686_100055919 Ga0070686_1000559193 229
160 3300005545 Ga0070695_100532998 Ga0070695_1005329981 229
161 3300005548 Ga0070665_100022039 Ga0070665_1000220396 229
162 3300005549 Ga0070704_100170908 Ga0070704_1001709083 229
163 3300005564 Ga0070664_100111343 Ga0070664_1001113431 229
164 3300005577 Ga0068857_100208005 Ga0068857_1002080053 229
165 3300005614 Ga0068856_100067111 Ga0068856_1000671112 229
166 3300005616 Ga0068852_100181802 Ga0068852_1001818023 229
167 3300005618 Ga0068864_100012803 Ga0068864_1000128034 229
168 3300005718 Ga0068866_10017502 Ga0068866_100175022 229
169 3300005719 Ga0068861_100079988 Ga0068861_1000799883 229
170 3300005719 Ga0068861_100235993 Ga0068861_1002359933 229
171 3300005840 Ga0068870_10002002 Ga0068870_100020028 229
172 3300005840 Ga0068870_10316907 Ga0068870_103169072 229
173 3300005841 Ga0068863_100020579 Ga0068863_1000205796 229
174 3300005842 Ga0068858_100324213 Ga0068858_1003242131 229
175 3300005844 Ga0068862_100015319 Ga0068862_1000153194 229
176 3300005937 Ga0081455_10019031 Ga0081455_100190314 229
177 3300005937 Ga0081455_10043942 Ga0081455_100439423 229
178 3300005937 Ga0081455_10068174 Ga0081455_100681743 229
179 3300005937 Ga0081455_10189558 Ga0081455_101895582 229
180 3300006028 Ga0070717_10156192 Ga0070717_101561922 229
181 3300006038 Ga0075365_10015278 Ga0075365_100152784 229
182 3300006038 Ga0075365_10065109 Ga0075365_100651093 229
183 3300006038 Ga0075365_10121789 Ga0075365_101217892 229
184 3300006038 Ga0075365_10159171 Ga0075365_101591712 229
185 3300006038 Ga0075365_10197905 Ga0075365_101979051 229
186 3300006042 Ga0075368_10012815 Ga0075368_100128154 229
187 3300006042 Ga0075368_10109939 Ga0075368_101099391 229
188 3300006177 Ga0075362_10008686 Ga0075362_100086862 229
189 3300006178 Ga0075367_10164807 Ga0075367_101648072 229
190 3300006237 Ga0097621_100016412 Ga0097621_1000164125 229
191 3300006358 Ga0068871_100145251 Ga0068871_1001452513 229
192 3300006358 Ga0068871_100222938 Ga0068871_1002229383 229
193 3300006844 Ga0075428_100081230 Ga0075428_1000812303 229
194 3300006844 Ga0075428_100100970 Ga0075428_1001009703 229
195 3300006847 Ga0075431_100254844 Ga0075431_1002548443 229
196 3300006847 Ga0075431_100349127 Ga0075431_1003491273 229
197 3300006847 Ga0075431_100680303 Ga0075431_1006803031 229
198 3300006852 Ga0075433_10034418 Ga0075433_100344186 229
199 3300006871 Ga0075434_100009717 Ga0075434_1000097173 229
200 3300006881 Ga0068865_100037203 Ga0068865_1000372032 229
201 3300006881 Ga0068865_100151967 Ga0068865_1001519673 229
202 3300007788 Ga0099795_10002912 Ga0099795_100029123 229
203 3300009094 Ga0111539_10032107 Ga0111539_100321074 229
204 3300009094 Ga0111539_10075369 Ga0111539_100753694 229
205 3300009094 Ga0111539_10796107 Ga0111539_107961072 229
206 3300009098 Ga0105245_10173413 Ga0105245_101734133 229
207 3300009098 Ga0105245_10498989 Ga0105245_104989893 229
208 3300009101 Ga0105247_10006463 Ga0105247_100064635 229
209 3300009147 Ga0114129_10034551 Ga0114129_100345515 229
210 3300009177 Ga0105248_10336422 Ga0105248_103364222 229
211 3300009553 Ga0105249_10120373 Ga0105249_101203732 229
212 3300010375 Ga0105239_10621471 Ga0105239_106214712 229
213 3300011119 Ga0105246_10050403 Ga0105246_100504033 229
214 3300011119 Ga0105246_10483177 Ga0105246_104831771 229
215 3300013104 Ga0157370_10711643 Ga0157370_107116431 229
216 3300013297 Ga0157378_10225906 Ga0157378_102259062 229
217 3300013306 Ga0163162_10200983 Ga0163162_102009832 229
218 3300013306 Ga0163162_10276916 Ga0163162_102769162 229
219 3300013308 Ga0157375_10070108 Ga0157375_100701084 229
220 3300013308 Ga0157375_10136861 Ga0157375_101368612 229
221 3300013308 Ga0157375_10352526 Ga0157375_103525263 229
222 3300014325 Ga0163163_10069114 Ga0163163_100691142 229
223 3300014326 Ga0157380_10005881 Ga0157380_100058818 229
224 3300014326 Ga0157380_10140731 Ga0157380_101407312 229
225 3300014745 Ga0157377_10007710 Ga0157377_100077103 229
226 3300014745 Ga0157377_10339666 Ga0157377_103396662 229
227 3300014968 Ga0157379_10133487 Ga0157379_101334872 229
228 3300014969 Ga0157376_10032234 Ga0157376_100322346 229
229 3300014969 Ga0157376_10319592 Ga0157376_103195921 229
230 3300017792 Ga0163161_10376867 Ga0163161_103768672 229
231 3300020080 Ga0206350_11605048 Ga0206350_116050481 229
232 3300025315 Ga0207697_10037322 Ga0207697_100373222 229
233 3300025321 Ga0207656_10084462 Ga0207656_100844622 229
234 3300025899 Ga0207642_10023895 Ga0207642_100238953 229
235 3300025901 Ga0207688_10000663 Ga0207688_100006638 229
236 3300025903 Ga0207680_10055526 Ga0207680_100555262 229
237 3300025907 Ga0207645_10019254 Ga0207645_100192544 229
238 3300025908 Ga0207643_10000808 Ga0207643_100008081 229
239 3300025908 Ga0207643_10010809 Ga0207643_100108093 229
240 3300025916 Ga0207663_10041410 Ga0207663_100414103 229
241 3300025917 Ga0207660_10285981 Ga0207660_102859811 229
242 3300025918 Ga0207662_10035677 Ga0207662_100356775 229
243 3300025920 Ga0207649_10083768 Ga0207649_100837683 229
244 3300025922 Ga0207646_10061562 Ga0207646_100615623 229
245 3300025923 Ga0207681_10479802 Ga0207681_104798021 229
246 3300025925 Ga0207650_10092570 Ga0207650_100925703 229
247 3300025925 Ga0207650_10109340 Ga0207650_101093402 229
248 3300025926 Ga0207659_10003344 Ga0207659_100033442 229
249 3300025926 Ga0207659_10020638 Ga0207659_100206382 229
250 3300025932 Ga0207690_10101778 Ga0207690_101017781 229
251 3300025933 Ga0207706_10007308 Ga0207706_100073084 229
252 3300025936 Ga0207670_10046122 Ga0207670_100461221 229
253 3300025936 Ga0207670_10112070 Ga0207670_101120702 229
254 3300025937 Ga0207669_10484513 Ga0207669_104845131 229
255 3300025938 Ga0207704_10075670 Ga0207704_100756702 229
256 3300025940 Ga0207691_10026975 Ga0207691_100269751 229
257 3300025941 Ga0207711_10047767 Ga0207711_100477674 229
258 3300025942 Ga0207689_10116691 Ga0207689_101166913 229
259 3300025944 Ga0207661_10090369 Ga0207661_100903693 229
260 3300025945 Ga0207679_10110607 Ga0207679_101106073 229
261 3300025960 Ga0207651_10047291 Ga0207651_100472913 229
262 3300025961 Ga0207712_10015779 Ga0207712_100157795 229
263 3300025972 Ga0207668_10058626 Ga0207668_100586263 229
264 3300025981 Ga0207640_10155928 Ga0207640_101559282 229
265 3300025986 Ga0207658_10046363 Ga0207658_100463634 229
266 3300026035 Ga0207703_10096819 Ga0207703_100968191 229
267 3300026041 Ga0207639_10474557 Ga0207639_104745572 229
268 3300026067 Ga0207678_10022427 Ga0207678_100224273 229
269 3300026075 Ga0207708_10032444 Ga0207708_100324443 229
270 3300026088 Ga0207641_10055543 Ga0207641_100555433 229
271 3300026088 Ga0207641_10112659 Ga0207641_101126592 229
272 3300026089 Ga0207648_10030869 Ga0207648_100308694 229
273 3300026095 Ga0207676_10133199 Ga0207676_101331993 229
274 3300026116 Ga0207674_10186918 Ga0207674_101869181 229
275 3300026118 Ga0207675_100103623 Ga0207675_1001036233 229
276 3300026118 Ga0207675_100115017 Ga0207675_1001150174 229
277 3300026118 Ga0207675_100607676 Ga0207675_1006076761 229
278 3300026121 Ga0207683_10002624 Ga0207683_100026248 229
279 3300026121 Ga0207683_10691502 Ga0207683_106915022 229
280 3300026142 Ga0207698_10630050 Ga0207698_106300502 229
281 3300027866 Ga0209813_10060549 Ga0209813_100605491 229
282 3300027907 Ga0207428_10027247 Ga0207428_100272476 229
283 3300028380 Ga0268265_10030740 Ga0268265_100307403 229
284 3300034819 Ga0373958_0020322 Ga0373958_0020322_150_839 229
285 3300035083 Ga0373926_0085342 Ga0373926_0085342_227_916 229
286 3300035170 Ga0373943_0158256 Ga0373943_0158256_112_801 229
287 3300035171 Ga0373946_0017468 Ga0373946_0017468_1461_2150 229
288 3300035172 Ga0373955_0362301 Ga0373955_0362301_71_760 229
289 3300035695 Ga0373927_0026617 Ga0373927_0026617_2666_3355 229
290 3300035695 Ga0373927_0214210 Ga0373927_0214210_432_1121 229
291 3300035725 Ga0373947_0042742 Ga0373947_0042742_532_1221 229
292 3300035725 Ga0373947_0189140 Ga0373947_0189140_478_1167 229
293 3300035725 Ga0373947_0260276 Ga0373947_0260276_41_742 229
294 3300035725 Ga0373947_0281639 Ga0373947_0281639_79_786 229
295 3300037068 Ga0373925_0051626 Ga0373925_0051626_1123_1812 229
296 3300037068 Ga0373925_0111443 Ga0373925_0111443_865_1593 229
297 3300037068 Ga0373925_0264526 Ga0373925_0264526_64_771 229
298 3300037068 Ga0373925_0446782 Ga0373925_0446782_132_821 229
299 3300039437 Ga0436365_0714609 Ga0436365_0714609_163_852 229
300 3300042011 Ga0439454_037417 Ga0439454_037417_49_768 229
301 3300046455 Ga0495603_0320094 Ga0495603_0320094_67_756 229
302 3300046457 Ga0495590_0059190 Ga0495590_0059190_321_1010 229
303 3300046457 Ga0495590_0104214 Ga0495590_0104214_169_858 229
304 3300046458 Ga0495591_045991 Ga0495591_045991_208_897 229
305 3300046459 Ga0495629_0197650 Ga0495629_0197650_41_730 229
306 3300046461 Ga0495641_0119375 Ga0495641_0119375_318_1025 229
307 3300046472 Ga0495580_0191170 Ga0495580_0191170_619_1308 229
308 3300046472 Ga0495580_0418180 Ga0495580_0418180_169_858 229
309 3300046473 Ga0495582_0236150 Ga0495582_0236150_112_801 229
310 3300046474 Ga0495605_0043170 Ga0495605_0043170_467_1156 229
311 3300046491 Ga0495584_0044658 Ga0495584_0044658_403_1092 229
312 3300046491 Ga0495584_0158636 Ga0495584_0158636_348_1037 229
313 3300046500 Ga0495596_0028591 Ga0495596_0028591_362_1051 229
314 3300046501 Ga0495607_0107194 Ga0495607_0107194_447_1136 229
315 3300046513 Ga0495616_0109658 Ga0495616_0109658_30_719 229
316 3300046515 Ga0495620_0110187 Ga0495620_0110187_334_1023 229
317 3300046517 Ga0495630_0063328 Ga0495630_0063328_1732_2439 229
318 3300046518 Ga0495631_0042883 Ga0495631_0042883_307_996 229
319 3300046519 Ga0495632_0116335 Ga0495632_0116335_84_773 229
320 3300046520 Ga0495637_0052215 Ga0495637_0052215_550_1239 229
321 3300046523 Ga0495644_0040114 Ga0495644_0040114_878_1585 229
322 3300046523 Ga0495644_0063435 Ga0495644_0063435_328_1017 229
323 3300046523 Ga0495644_0099221 Ga0495644_0099221_347_1036 229
324 3300046525 Ga0495663_0012213 Ga0495663_0012213_650_1339 229
325 3300046531 Ga0495665_0078734 Ga0495665_0078734_1000_1713 229
326 3300046533 Ga0495640_0020582 Ga0495640_0020582_2994_3683 229
327 3300046536 Ga0495587_0202642 Ga0495587_0202642_228_917 229
328 3300046537 Ga0495598_0011678 Ga0495598_0011678_980_1669 229
329 3300046538 Ga0495609_0092196 Ga0495609_0092196_418_1107 229
330 3300046539 Ga0495621_0021555 Ga0495621_0021555_1238_1927 229
331 3300046558 Ga0495633_0036982 Ga0495633_0036982_1051_1740 229
332 3300046558 Ga0495633_0095250 Ga0495633_0095250_168_875 229
333 3300046615 Ga0495656_0064602 Ga0495656_0064602_168_857 229
334 3300046615 Ga0495656_0092175 Ga0495656_0092175_298_1005 229
335 3300046616 Ga0495668_0101324 Ga0495668_0101324_580_1269 229
336 3300046648 Ga0495611_0028514 Ga0495611_0028514_636_1325 229
337 3300046664 Ga0495659_0020393 Ga0495659_0020393_659_1348 229
338 3300046664 Ga0495659_0193852 Ga0495659_0193852_52_741 229
339 3300046665 Ga0495661_0103019 Ga0495661_0103019_708_1397 229
340 3300046674 Ga0495588_0094096 Ga0495588_0094096_752_1441 229
341 3300046681 Ga0495647_0132467 Ga0495647_0132467_222_911 229
342 3300046683 Ga0495658_0227375 Ga0495658_0227375_204_893 229
343 3300046684 Ga0495669_0053084 Ga0495669_0053084_431_1120 229
344 3300046689 Ga0495613_0157931 Ga0495613_0157931_61_768 229
345 3300046690 Ga0495624_0075579 Ga0495624_0075579_970_1659 229
346 3300046690 Ga0495624_0132077 Ga0495624_0132077_346_1035 229
347 3300046691 Ga0495670_0104949 Ga0495670_0104949_96_785 229
348 3300046691 Ga0495670_0134478 Ga0495670_0134478_449_1156 229
349 3300046692 Ga0495671_0058363 Ga0495671_0058363_915_1604 229
350 3300046694 Ga0495649_0335184 Ga0495649_0335184_24_731 229
351 3300046794 Ga0495589_0049898 Ga0495589_0049898_904_1593 229
352 3300046794 Ga0495589_0166428 Ga0495589_0166428_14_703 229
353 3300046810 Ga0495660_0104444 Ga0495660_0104444_526_1215 229
354 3300047315 Ga0495581_0097110 Ga0495581_0097110_886_1575 229
355 3300047315 Ga0495581_0382037 Ga0495581_0382037_61_750 229
356 3300047319 Ga0495674_0222499 Ga0495674_0222499_56_745 229
357 3300047320 Ga0495672_0030499 Ga0495672_0030499_864_1553 229
358 3300047321 Ga0495676_0170450 Ga0495676_0170450_811_1500 229
359 3300047445 Ga0495677_0025841 Ga0495677_0025841_313_1002 229
360 3300047446 Ga0495679_087792 Ga0495679_087792_121_810 229
361 3300047447 Ga0495685_068510 Ga0495685_068510_425_1114 229
362 3300047469 Ga0495673_0119501 Ga0495673_0119501_333_1022 229
363 3300048089 Ga0495614_0207660 Ga0495614_0207660_30_719 229
364 3300048090 Ga0495615_0036361 Ga0495615_0036361_306_995 229
365 3300048091 Ga0495626_0041194 Ga0495626_0041194_1394_2083 229
366 3300048903 Ga0496100_0037404 Ga0496100_0037404_710_1399 229
367 3300048903 Ga0496100_0039186 Ga0496100_0039186_544_1233 229
368 3300048904 Ga0496101_0166353 Ga0496101_0166353_623_1312 229
369 3300048905 Ga0496102_0253726 Ga0496102_0253726_529_1218 229
370 3300048905 Ga0496102_0430138 Ga0496102_0430138_25_714 229
371 3300048907 Ga0496104_0000463 Ga0496104_0000463_24789_25493 229
372 3300048907 Ga0496104_0007636 Ga0496104_0007636_8030_8719 229
373 3300048907 Ga0496104_0020467 Ga0496104_0020467_1578_2273 229
374 3300048907 Ga0496104_0273359 Ga0496104_0273359_783_1472 229
375 3300048908 Ga0496105_0002565 Ga0496105_0002565_2300_2989 229
376 3300048908 Ga0496105_0052148 Ga0496105_0052148_1668_2363 229
377 3300048909 Ga0496106_0013605 Ga0496106_0013605_1859_2548 229
378 3300048909 Ga0496106_0131985 Ga0496106_0131985_1197_1886 229
379 3300048909 Ga0496106_0385440 Ga0496106_0385440_319_1023 229
380 3300048910 Ga0496107_0091325 Ga0496107_0091325_1523_2212 229
381 3300048911 Ga0496108_0008355 Ga0496108_0008355_2010_2699 229
382 3300048911 Ga0496108_0097668 Ga0496108_0097668_988_1683 229
383 3300048911 Ga0496108_0324334 Ga0496108_0324334_441_1130 229
384 3300048912 Ga0496109_0000766 Ga0496109_0000766_16016_16705 229
385 3300048912 Ga0496109_0021363 Ga0496109_0021363_134_823 229
386 3300048912 Ga0496109_0054448 Ga0496109_0054448_531_1226 229
387 3300048913 Ga0496110_0002398 Ga0496110_0002398_7654_8343 229
388 3300048913 Ga0496110_0444707 Ga0496110_0444707_130_819 229
389 3300048914 Ga0496111_0065381 Ga0496111_0065381_986_1675 229
390 3300048915 Ga0496112_0001055 Ga0496112_0001055_19417_20106 229
391 3300048915 Ga0496112_0059117 Ga0496112_0059117_2643_3332 229
392 3300048915 Ga0496112_0159288 Ga0496112_0159288_1488_2213 229
393 3300048915 Ga0496112_0324627 Ga0496112_0324627_541_1230 229
394 3300048916 Ga0496113_0000323 Ga0496113_0000323_16762_17451 229
395 3300048916 Ga0496113_0055717 Ga0496113_0055717_2133_2858 229
396 3300048916 Ga0496113_0143935 Ga0496113_0143935_1132_1836 229
397 3300048916 Ga0496113_0254630 Ga0496113_0254630_15_704 229
398 3300048917 Ga0496114_0428300 Ga0496114_0428300_451_1140 229
399 3300048918 Ga0496115_0047145 Ga0496115_0047145_1287_1982 229
400 3300048918 Ga0496115_0137725 Ga0496115_0137725_1240_1929 229
401 3300048918 Ga0496115_0429093 Ga0496115_0429093_280_969 229
402 3300049591 Ga0501075_0634996 Ga0501075_0634996_47_736 229
403 3300049592 Ga0501076_0303608 Ga0501076_0303608_554_1243 229
404 3300049593 Ga0501077_0226060 Ga0501077_0226060_91_780 229
405 3300049741 Ga0501079_0190819 Ga0501079_0190819_154_843 229
406 3300049741 Ga0501079_0379040 Ga0501079_0379040_195_893 229
407 3300049742 Ga0501080_0731509 Ga0501080_0731509_47_736 229
408 3300049743 Ga0501081_0344581 Ga0501081_0344581_319_1008 229
409 3300049743 Ga0501081_0394410 Ga0501081_0394410_55_753 229
410 3300049744 Ga0501083_0207183 Ga0501083_0207183_357_1046 229
411 3300050489 nmdc:mga03683_27317_c1 nmdc:mga03683_27317_c1_880_1569 229
412 3300050492 nmdc:mga0yw44_3497_c1 nmdc:mga0yw44_3497_c1_3677_4366 229
413 3300050492 nmdc:mga0yw44_39629_c2 nmdc:mga0yw44_39629_c2_695_1384 229
414 3300050492 nmdc:mga0yw44_622550_c1 nmdc:mga0yw44_622550_c1_20_709 229
415 3300050492 nmdc:mga0yw44_9660_c1 nmdc:mga0yw44_9660_c1_1998_2687 229
416 3300050494 nmdc:mga06z11_63693_c1 nmdc:mga06z11_63693_c1_812_1501 229
417 3300050495 nmdc:mga04h51_29069_c1 nmdc:mga04h51_29069_c1_644_1333 229
418 3300050507 nmdc:mga05p37_48836_c1 nmdc:mga05p37_48836_c1_484_1173 229
419 3300050507 nmdc:mga05p37_509373_c1 nmdc:mga05p37_509373_c1_308_997 229
420 3300050510 nmdc:mga06r32_156799_c1 nmdc:mga06r32_156799_c1_190_879 229
421 3300050510 nmdc:mga06r32_165203_c1 nmdc:mga06r32_165203_c1_731_1420 229
422 3300050511 nmdc:mga08y16_197131_c1 nmdc:mga08y16_197131_c1_1295_1984 229
423 3300050511 nmdc:mga08y16_75239_c1 nmdc:mga08y16_75239_c1_117_806 229
424 3300050512 nmdc:mga0n895_41739_c1 nmdc:mga0n895_41739_c1_223_912 229
425 3300050512 nmdc:mga0n895_420450_c1 nmdc:mga0n895_420450_c1_523_1230 229
426 3300050512 nmdc:mga0n895_63761_c1 nmdc:mga0n895_63761_c1_2063_2752 229
427 3300050513 nmdc:mga0rr50_80216_c1 nmdc:mga0rr50_80216_c1_1581_2270 229
428 3300050515 nmdc:mga0a205_230682_c1 nmdc:mga0a205_230682_c1_579_1286 229
429 3300053077 Ga0495601_0071967 Ga0495601_0071967_1074_1763 229
430 3300053083 Ga0495655_0005433 Ga0495655_0005433_1283_1972 229
431 3300053083 Ga0495655_0048735 Ga0495655_0048735_22_723 229
432 3300053085 Ga0495619_0044661 Ga0495619_0044661_1910_2599 229
433 3300054114 Ga0501084_0255122 Ga0501084_0255122_611_1300 229
434 3300059503 Ga0587080_034213 Ga0587080_034213_120_809 229
435 3300061734 Ga0530510_0265594 Ga0530510_0265594_343_1032 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

23

180

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1orr-assembly2.cif.gz_D crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.728 10 61
5tz8-assembly1.cif.gz_B crystal structure of s. aureus tars 0.727 9 129
7msp-assembly2.cif.gz_B suns glycosin s-glycosyltransferase 0.7253 4 123
7p5l-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 - apo form 0.7251 4 197
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.7248 5 123
ID Description Score Start End Superfamily
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8845 4 222 3.90.550.10
af_O06376_3_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8716 2 224 3.90.550.10
af_O06376_3_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8467 2 224 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8449 4 222 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8289 11 203 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A538DNM5-F1-model_v4 Glycosyltransferase family 2 protein 0.9735 8 120 GO:0016757
AF-A0A7V9G772-F1-model_v4 Glycosyltransferase 0.9728 10 93 GO:0016757
AF-A0A060CKF0-F1-model_v4 CAZy families GT2 protein 0.9629 9 88 GO:0016757
AF-A0A7X7WGD2-F1-model_v4 Glycosyltransferase family 2 protein 0.9601 8 101 GO:0016757
AF-A0A7V9G772-F1-model_v4 Glycosyltransferase 0.9507 10 93 GO:0016757

Feature Viewer

pLDDT pTM Quality
77.59 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map