F443366

General Info

Members Datasets Scaffolds Average Seq Length
435 180 870 125

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0235745|Ga0373931_0235745_549_950
Length 133
Sequence MSQDKRTLTVGHVAVFERRFTDEDVAAFAHLSGDAGRHHARPDARGRRIVHGLLTATLPTKIGGDLSFLARDMTFEFLRPVFTGDTIRCEATIAAVEPEVGRVRVTFRGSAWNQDGKEVLRFVSNGVVLDEDP

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
159 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 1.38
Rhizosphere 97.47
Stem 0
Stem Tuber 0
Unclassified 42.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0235745 3300035691 Unclassified 1107
2 SwRhRL2b_contig_135009 2162886007 Unclassified 2045
3 MBSR1b_contig_11832384 2162886012 Archaea 927
4 JGI25151J46595_10049101 3300003187 Bacteria 1451
5 rootL2_10005495 3300003322 Bacteria 1361
6 Ga0058860_11558531 3300004801 Bacteria 3572
7 Ga0065704_10025892 3300005289 Bacteria 1275
8 Ga0065704_10071785 3300005289 Bacteria 9933
9 Ga0065712_10196600 3300005290 Unclassified 1109
10 Ga0065712_10790237 3300005290 Unclassified 506
11 Ga0065715_10015333 3300005293 Unclassified 2124
12 Ga0065715_10092376 3300005293 Bacteria 5157
13 Ga0065715_10163322 3300005293 Unclassified 1608
14 Ga0065715_10256947 3300005293 Bacteria 1134
15 Ga0065715_10499290 3300005293 Archaea 781
16 Ga0065715_10795778 3300005293 Unclassified 612
17 Ga0065707_10000960 3300005295 Bacteria 10503
18 Ga0070676_10389163 3300005328 Unclassified 967
19 Ga0070690_100004087 3300005330 Bacteria 8075
20 Ga0070690_100013367 3300005330 Bacteria 4846
21 Ga0070690_100035272 3300005330 Bacteria 3138
22 Ga0070690_100041234 3300005330 Bacteria 2922
23 Ga0070690_100182113 3300005330 Unclassified 1452
24 Ga0070670_100003388 3300005331 Bacteria 13210
25 Ga0070670_100030464 3300005331 Bacteria 4647
26 Ga0070670_100537566 3300005331 Bacteria 1042
27 Ga0070670_101621096 3300005331 Unclassified 595
28 Ga0068869_100041537 3300005334 Bacteria 3294
29 Ga0068869_100204883 3300005334 Bacteria 1557
30 Ga0068869_100265106 3300005334 Unclassified 1376
31 Ga0070666_10105461 3300005335 Unclassified 1947
32 Ga0070666_10243027 3300005335 Unclassified 1273
33 Ga0070680_100030734 3300005336 Bacteria 4315
34 Ga0070680_100577000 3300005336 Unclassified 965
35 Ga0068868_100223696 3300005338 Unclassified 1576
36 Ga0068868_102246020 3300005338 Unclassified 520
37 Ga0070689_100038252 3300005340 Bacteria 3670
38 Ga0070689_100162753 3300005340 Unclassified 1804
39 Ga0070689_100786599 3300005340 Bacteria 836
40 Ga0070691_10124049 3300005341 Bacteria 1303
41 Ga0070687_100015246 3300005343 Bacteria 3470
42 Ga0070687_100047128 3300005343 Bacteria 2209
43 Ga0070687_100112546 3300005343 Bacteria 1543
44 Ga0070692_10037743 3300005345 Bacteria 2458
45 Ga0070692_10716502 3300005345 Unclassified 675
46 Ga0070692_11345230 3300005345 Unclassified 514
47 Ga0070668_100937578 3300005347 Bacteria 775
48 Ga0070669_100001801 3300005353 Bacteria 15414
49 Ga0070669_100003467 3300005353 Bacteria 11374
50 Ga0070675_100212822 3300005354 Bacteria 1681
51 Ga0070675_100273306 3300005354 Bacteria 1483
52 Ga0070675_100463658 3300005354 Unclassified 1137
53 Ga0070671_100001483 3300005355 Bacteria 17524
54 Ga0070671_100046898 3300005355 Bacteria 3594
55 Ga0070674_100187199 3300005356 Unclassified 1590
56 Ga0070674_100581311 3300005356 Unclassified 944
57 Ga0070674_100601768 3300005356 Unclassified 929
58 Ga0070673_100131000 3300005364 Unclassified 2104
59 Ga0070673_100164696 3300005364 Unclassified 1888
60 Ga0070673_100249188 3300005364 Unclassified 1547
61 Ga0070673_100372982 3300005364 Bacteria 1271
62 Ga0070673_100697759 3300005364 Unclassified 932
63 Ga0070673_101225701 3300005364 Unclassified 703
64 Ga0070673_102254525 3300005364 Unclassified 518
65 Ga0070688_100105103 3300005365 Bacteria 1868
66 Ga0070688_100381606 3300005365 Bacteria 1039
67 Ga0070667_100372718 3300005367 Bacteria 1295
68 Ga0070709_10906385 3300005434 Unclassified 697
69 Ga0070701_10195477 3300005438 Unclassified 1192
70 Ga0070705_100728138 3300005440 Unclassified 782
71 Ga0070705_101043609 3300005440 Unclassified 666
72 Ga0070700_100070803 3300005441 Bacteria 2225
73 Ga0070700_100113689 3300005441 Bacteria 1804
74 Ga0070694_100008271 3300005444 Bacteria 6362
75 Ga0070694_100027775 3300005444 Bacteria 3678
76 Ga0070694_100114311 3300005444 Unclassified 1927
77 Ga0070694_100259225 3300005444 Bacteria 1318
78 Ga0070708_100002751 3300005445 Bacteria 13650
79 Ga0070708_100406242 3300005445 Bacteria 1284
80 Ga0070708_100491124 3300005445 Bacteria 1158
81 Ga0070678_100388394 3300005456 Bacteria 1209
82 Ga0070662_100093915 3300005457 Unclassified 2258
83 Ga0070662_100451283 3300005457 Bacteria 1067
84 Ga0070681_10001239 3300005458 Bacteria 22228
85 Ga0068867_100016294 3300005459 Bacteria 5278
86 Ga0068867_100042106 3300005459 Bacteria 3339
87 Ga0068867_100181827 3300005459 Unclassified 1672
88 Ga0070685_10012666 3300005466 Bacteria 4436
89 Ga0070685_10203743 3300005466 Bacteria 1287
90 Ga0070706_100282693 3300005467 Bacteria 1548
91 Ga0070706_100568937 3300005467 Bacteria 1054
92 Ga0070706_100726555 3300005467 Unclassified 920
93 Ga0070707_100026882 3300005468 Bacteria 5469
94 Ga0070707_100087369 3300005468 Bacteria 3016
95 Ga0070707_100848587 3300005468 Bacteria 877
96 Ga0070707_101718375 3300005468 Bacteria 595
97 Ga0070698_100004211 3300005471 Bacteria 15808
98 Ga0070698_100005092 3300005471 Bacteria 14397
99 Ga0070698_101462084 3300005471 Unclassified 635
100 Ga0070699_100007108 3300005518 Bacteria 9725
101 Ga0070699_100270802 3300005518 Bacteria 1520
102 Ga0070679_100005621 3300005530 Bacteria 11612
103 Ga0070697_100045759 3300005536 Bacteria 3547
104 Ga0070697_100078720 3300005536 Bacteria 2713
105 Ga0070697_100879746 3300005536 Unclassified 794
106 Ga0070697_101428537 3300005536 Unclassified 618
107 Ga0068853_100114039 3300005539 Unclassified 2404
108 Ga0070672_100076583 3300005543 Bacteria 2673
109 Ga0070672_100360712 3300005543 Unclassified 1240
110 Ga0070672_101369425 3300005543 Unclassified 632
111 Ga0070686_100408708 3300005544 Unclassified 1034
112 Ga0070686_101074264 3300005544 Unclassified 663
113 Ga0070695_100146328 3300005545 Unclassified 1644
114 Ga0070695_100299053 3300005545 Unclassified 1189
115 Ga0070695_100989146 3300005545 Unclassified 684
116 Ga0070695_101222191 3300005545 Unclassified 619
117 Ga0070696_100212494 3300005546 Bacteria 1448
118 Ga0070696_100580506 3300005546 Unclassified 902
119 Ga0070696_101955941 3300005546 Unclassified 508
120 Ga0070693_100946713 3300005547 Unclassified 648
121 Ga0070704_100006364 3300005549 Bacteria 6958
122 Ga0070704_100073289 3300005549 Unclassified 2494
123 Ga0070704_100218160 3300005549 Bacteria 1549
124 Ga0070704_100238527 3300005549 Bacteria 1487
125 Ga0070704_100259985 3300005549 Unclassified 1430
126 Ga0070704_101647087 3300005549 Unclassified 592
127 Ga0070704_101890337 3300005549 Unclassified 553
128 Ga0070664_100112958 3300005564 Unclassified 2373
129 Ga0068857_100077808 3300005577 Unclassified 2960
130 Ga0068857_100306228 3300005577 Bacteria 1465
131 Ga0068854_100342069 3300005578 Bacteria 1222
132 Ga0068854_100488562 3300005578 Unclassified 1035
133 Ga0068856_100005944 3300005614 Bacteria 12014
134 Ga0070702_100107538 3300005615 Unclassified 1722
135 Ga0070702_100521497 3300005615 Unclassified 876
136 Ga0070702_100691556 3300005615 Bacteria 776
137 Ga0068852_100397091 3300005616 Unclassified 1356
138 Ga0068859_100009641 3300005617 Bacteria 9748
139 Ga0068859_100109477 3300005617 Bacteria 2824
140 Ga0068859_100114560 3300005617 Bacteria 2760
141 Ga0068859_100206755 3300005617 Unclassified 2048
142 Ga0068859_100940121 3300005617 Unclassified 948
143 Ga0068859_102438757 3300005617 Unclassified 576
144 Ga0068864_100032575 3300005618 Bacteria 4429
145 Ga0068864_100230883 3300005618 Unclassified 1711
146 Ga0068864_100273927 3300005618 Bacteria 1573
147 Ga0068864_100349356 3300005618 Bacteria 1395
148 Ga0068864_100824776 3300005618 Bacteria 913
149 Ga0068866_10009478 3300005718 Bacteria 4135
150 Ga0068861_100058482 3300005719 Bacteria 2948
151 Ga0068861_100288457 3300005719 Unclassified 1416
152 Ga0068861_100379622 3300005719 Unclassified 1248
153 Ga0068861_101327778 3300005719 Unclassified 700
154 Ga0068861_101520192 3300005719 Unclassified 657
155 Ga0068863_100099102 3300005841 Bacteria 2768
156 Ga0068863_100270557 3300005841 Bacteria 1645
157 Ga0068863_100276627 3300005841 Bacteria 1626
158 Ga0068863_100476218 3300005841 Unclassified 1227
159 Ga0068858_100379233 3300005842 Unclassified 1357
160 Ga0068858_100477180 3300005842 Unclassified 1203
161 Ga0068858_100511020 3300005842 Bacteria 1161
162 Ga0068858_101084336 3300005842 Unclassified 786
163 Ga0068860_100023776 3300005843 Bacteria 5924
164 Ga0068860_100101792 3300005843 Bacteria 2741
165 Ga0068860_100281674 3300005843 Unclassified 1625
166 Ga0068860_100283395 3300005843 Unclassified 1620
167 Ga0068860_100902198 3300005843 Bacteria 900
168 Ga0068862_100059778 3300005844 Bacteria 3273
169 Ga0068862_100087641 3300005844 Unclassified 2707
170 Ga0068862_100229850 3300005844 Bacteria 1682
171 Ga0068862_100397866 3300005844 Unclassified 1288
172 Ga0081539_10040293 3300005985 Bacteria 2743
173 Ga0075432_10549620 3300006058 Unclassified 521
174 Ga0070716_100373671 3300006173 Archaea 1017
175 Ga0070716_101696991 3300006173 Unclassified 521
176 Ga0097621_100050943 3300006237 Bacteria 3368
177 Ga0097621_100152358 3300006237 Bacteria 1983
178 Ga0068871_100015655 3300006358 Bacteria 5684
179 Ga0075430_100027310 3300006846 Bacteria 4850
180 Ga0075430_101030991 3300006846 Bacteria 678
181 Ga0075431_100017911 3300006847 Bacteria 7205
182 Ga0075433_10306221 3300006852 Bacteria 1406
183 Ga0075434_100175078 3300006871 Bacteria 2165
184 Ga0075429_100066651 3300006880 Bacteria 3135
185 Ga0075429_101162764 3300006880 Unclassified 674
186 Ga0068865_100009527 3300006881 Bacteria 6025
187 Ga0097620_100009642 3300006931 Bacteria 9748
188 Ga0097620_100109474 3300006931 Bacteria 2824
189 Ga0097620_100114558 3300006931 Bacteria 2760
190 Ga0097620_100206756 3300006931 Unclassified 2048
191 Ga0097620_100940262 3300006931 Unclassified 948
192 Ga0097620_102439572 3300006931 Unclassified 576
193 Ga0105251_10164691 3300009011 Unclassified 999
194 Ga0105244_10538794 3300009036 Unclassified 538
195 Ga0105240_10357539 3300009093 Bacteria 1655
196 Ga0105240_10830150 3300009093 Unclassified 999
197 Ga0105240_11058150 3300009093 Unclassified 865
198 Ga0105240_11217216 3300009093 Unclassified 797
199 Ga0111539_10001336 3300009094 Bacteria 32835
200 Ga0111539_10024242 3300009094 Bacteria 7450
201 Ga0111539_10438003 3300009094 Bacteria 1522
202 Ga0111539_11059584 3300009094 Bacteria 942
203 Ga0111539_11678540 3300009094 Unclassified 737
204 Ga0105245_10067629 3300009098 Bacteria 3236
205 Ga0105245_11189726 3300009098 Bacteria 810
206 Ga0105247_10585070 3300009101 Unclassified 826
207 Ga0114129_10165700 3300009147 Bacteria 3016
208 Ga0114129_10206671 3300009147 Bacteria 2656
209 Ga0114129_10916764 3300009147 Bacteria 1109
210 Ga0114129_10976918 3300009147 Bacteria 1068
211 Ga0105243_10012258 3300009148 Bacteria 6483
212 Ga0105243_10075097 3300009148 Bacteria 2743
213 Ga0105243_10241487 3300009148 Unclassified 1608
214 Ga0105243_10274798 3300009148 Bacteria 1515
215 Ga0105243_10310878 3300009148 Bacteria 1432
216 Ga0105243_10441661 3300009148 Unclassified 1218
217 Ga0105243_10724187 3300009148 Bacteria 972
218 Ga0105243_10738036 3300009148 Unclassified 964
219 Ga0105243_10970634 3300009148 Unclassified 850
220 Ga0105243_12047085 3300009148 Bacteria 607
221 Ga0105241_10031115 3300009174 Unclassified 3994
222 Ga0105241_10062781 3300009174 Bacteria 2865
223 Ga0105242_10220632 3300009176 Bacteria 1694
224 Ga0105242_10259535 3300009176 Unclassified 1569
225 Ga0105242_10639997 3300009176 Archaea 1033
226 Ga0105248_10012712 3300009177 Bacteria 9289
227 Ga0105248_10339360 3300009177 Bacteria 1692
228 Ga0105248_13461265 3300009177 Unclassified 501
229 Ga0105237_10052157 3300009545 Bacteria 4107
230 Ga0105237_11720899 3300009545 Unclassified 634
231 Ga0105249_10000112 3300009553 Bacteria 108891
232 Ga0105249_10017766 3300009553 Bacteria 6318
233 Ga0105249_10022529 3300009553 Bacteria 5643
234 Ga0105249_10764746 3300009553 Unclassified 1029
235 Ga0105239_10028682 3300010375 Bacteria 6120
236 Ga0105239_10217665 3300010375 Unclassified 2141
237 Ga0105239_11515353 3300010375 Unclassified 775
238 Ga0105239_12394886 3300010375 Bacteria 615
239 Ga0105246_10044057 3300011119 Bacteria 3030
240 Ga0105246_10407098 3300011119 Bacteria 1131
241 Ga0157373_10169425 3300013100 Bacteria 1537
242 Ga0157373_11123493 3300013100 Bacteria 590
243 Ga0157371_11354987 3300013102 Unclassified 552
244 Ga0157374_10025291 3300013296 Bacteria 5328
245 Ga0157374_10596374 3300013296 Unclassified 1114
246 Ga0157378_10142031 3300013297 Bacteria 2230
247 Ga0157378_10345021 3300013297 Unclassified 1453
248 Ga0157378_10455931 3300013297 Unclassified 1270
249 Ga0157378_10869623 3300013297 Bacteria 931
250 Ga0157378_11345245 3300013297 Unclassified 756
251 Ga0157378_12294348 3300013297 Unclassified 591
252 Ga0163162_10000055 3300013306 Bacteria 109443
253 Ga0163162_10020781 3300013306 Bacteria 6454
254 Ga0163162_10323806 3300013306 Bacteria 1674
255 Ga0163162_10450626 3300013306 Bacteria 1419
256 Ga0163162_10781773 3300013306 Bacteria 1073
257 Ga0163162_12526991 3300013306 Unclassified 591
258 Ga0163162_13128000 3300013306 Unclassified 531
259 Ga0157372_10347352 3300013307 Bacteria 1728
260 Ga0157372_12292315 3300013307 Unclassified 620
261 Ga0157372_13153422 3300013307 Unclassified 526
262 Ga0157375_10076001 3300013308 Unclassified 3384
263 Ga0157375_10129750 3300013308 Bacteria 2639
264 Ga0157375_10138067 3300013308 Unclassified 2563
265 Ga0157375_10190244 3300013308 Unclassified 2207
266 Ga0157375_10675611 3300013308 Bacteria 1188
267 Ga0157375_12154976 3300013308 Bacteria 664
268 Ga0157375_13741417 3300013308 Unclassified 505
269 Ga0163163_10052335 3300014325 Bacteria 4029
270 Ga0163163_10255693 3300014325 Unclassified 1802
271 Ga0163163_10655801 3300014325 Bacteria 1113
272 Ga0157380_10000923 3300014326 Bacteria 18517
273 Ga0157380_10006695 3300014326 Bacteria 8138
274 Ga0157380_10018287 3300014326 Bacteria 5201
275 Ga0157380_10179804 3300014326 Bacteria 1857
276 Ga0157380_10209937 3300014326 Bacteria 1734
277 Ga0157380_10213407 3300014326 Unclassified 1722
278 Ga0157377_10071991 3300014745 Unclassified 2000
279 Ga0157377_10109121 3300014745 Unclassified 1661
280 Ga0157377_10193789 3300014745 Bacteria 1286
281 Ga0157379_10846468 3300014968 Bacteria 865
282 Ga0157379_11991768 3300014968 Unclassified 574
283 Ga0157376_10019299 3300014969 Bacteria 5251
284 Ga0163161_10054596 3300017792 Bacteria 2899
285 Ga0163161_11544077 3300017792 Unclassified 584
286 Ga0209025_1001330 3300025294 Bacteria 33454
287 Ga0207680_10072315 3300025903 Bacteria 2140
288 Ga0207680_10368292 3300025903 Unclassified 1011
289 Ga0207645_10486362 3300025907 Unclassified 835
290 Ga0207684_10100369 3300025910 Bacteria 2473
291 Ga0207684_10579481 3300025910 Unclassified 959
292 Ga0207684_10622172 3300025910 Unclassified 921
293 Ga0207654_10657033 3300025911 Unclassified 751
294 Ga0207707_10000022 3300025912 Bacteria 198808
295 Ga0207695_10415761 3300025913 Bacteria 1229
296 Ga0207671_10504967 3300025914 Bacteria 964
297 Ga0207660_10001872 3300025917 Bacteria 14026
298 Ga0207660_11071897 3300025917 Unclassified 657
299 Ga0207662_10001161 3300025918 Bacteria 12477
300 Ga0207662_10026598 3300025918 Bacteria 3337
301 Ga0207662_10231196 3300025918 Bacteria 1208
302 Ga0207652_10001213 3300025921 Bacteria 23128
303 Ga0207646_10053393 3300025922 Bacteria 3615
304 Ga0207646_10133323 3300025922 Bacteria 2236
305 Ga0207646_10835366 3300025922 Bacteria 819
306 Ga0207681_10006195 3300025923 Bacteria 7339
307 Ga0207681_10243644 3300025923 Unclassified 1400
308 Ga0207681_10654174 3300025923 Unclassified 871
309 Ga0207650_10000712 3300025925 Bacteria 25935
310 Ga0207650_10064611 3300025925 Bacteria 2740
311 Ga0207650_10394514 3300025925 Unclassified 1144
312 Ga0207650_10412870 3300025925 Bacteria 1119
313 Ga0207659_10409697 3300025926 Unclassified 1135
314 Ga0207659_10473847 3300025926 Bacteria 1057
315 Ga0207687_10405017 3300025927 Unclassified 1123
316 Ga0207687_10710870 3300025927 Unclassified 853
317 Ga0207644_10004759 3300025931 Bacteria 8826
318 Ga0207644_10812811 3300025931 Unclassified 782
319 Ga0207706_10062966 3300025933 Unclassified 3266
320 Ga0207706_10172333 3300025933 Bacteria 1901
321 Ga0207706_10294770 3300025933 Unclassified 1414
322 Ga0207686_10139907 3300025934 Bacteria 1671
323 Ga0207686_10867505 3300025934 Bacteria 727
324 Ga0207709_10096231 3300025935 Bacteria 1947
325 Ga0207709_10101218 3300025935 Unclassified 1905
326 Ga0207709_10248242 3300025935 Bacteria 1298
327 Ga0207709_11453448 3300025935 Bacteria 568
328 Ga0207670_10138176 3300025936 Bacteria 1794
329 Ga0207670_10219089 3300025936 Bacteria 1456
330 Ga0207669_10379659 3300025937 Unclassified 1101
331 Ga0207669_11550566 3300025937 Unclassified 565
332 Ga0207704_10028031 3300025938 Bacteria 3118
333 Ga0207704_11032434 3300025938 Bacteria 696
334 Ga0207691_10002711 3300025940 Bacteria 17294
335 Ga0207691_10213991 3300025940 Bacteria 1673
336 Ga0207691_10251319 3300025940 Bacteria 1526
337 Ga0207711_10103396 3300025941 Bacteria 2522
338 Ga0207711_12016975 3300025941 Unclassified 520
339 Ga0207689_10003053 3300025942 Bacteria 15416
340 Ga0207689_10086980 3300025942 Bacteria 2568
341 Ga0207689_10167565 3300025942 Unclassified 1810
342 Ga0207679_10213766 3300025945 Unclassified 1619
343 Ga0207651_10108284 3300025960 Unclassified 2079
344 Ga0207651_10135942 3300025960 Bacteria 1891
345 Ga0207651_10641094 3300025960 Bacteria 932
346 Ga0207712_10077854 3300025961 Bacteria 2405
347 Ga0207712_10087839 3300025961 Bacteria 2281
348 Ga0207712_10117448 3300025961 Bacteria 2006
349 Ga0207712_10806056 3300025961 Unclassified 826
350 Ga0207668_10151586 3300025972 Bacteria 1795
351 Ga0207668_11139623 3300025972 Bacteria 700
352 Ga0207640_10087756 3300025981 Bacteria 2145
353 Ga0207640_10251626 3300025981 Bacteria 1372
354 Ga0207640_10474996 3300025981 Unclassified 1036
355 Ga0207640_11852184 3300025981 Unclassified 546
356 Ga0207677_10046343 3300026023 Bacteria 2910
357 Ga0207677_10170303 3300026023 Unclassified 1702
358 Ga0207677_10835710 3300026023 Bacteria 827
359 Ga0207703_10152815 3300026035 Bacteria 2014
360 Ga0207703_10859467 3300026035 Unclassified 868
361 Ga0207703_11410180 3300026035 Bacteria 670
362 Ga0207639_10074327 3300026041 Unclassified 2668
363 Ga0207708_10037660 3300026075 Bacteria 3684
364 Ga0207708_10056438 3300026075 Bacteria 2996
365 Ga0207708_10130946 3300026075 Bacteria 1961
366 Ga0207708_10762755 3300026075 Bacteria 831
367 Ga0207702_10100804 3300026078 Bacteria 2548
368 Ga0207641_10107089 3300026088 Bacteria 2472
369 Ga0207641_10135548 3300026088 Bacteria 2216
370 Ga0207641_10167356 3300026088 Unclassified 2003
371 Ga0207641_11127684 3300026088 Unclassified 783
372 Ga0207641_11506059 3300026088 Unclassified 674
373 Ga0207648_10009515 3300026089 Bacteria 9298
374 Ga0207648_10072870 3300026089 Bacteria 2993
375 Ga0207648_10262286 3300026089 Unclassified 1542
376 Ga0207648_11952958 3300026089 Unclassified 548
377 Ga0207676_10058162 3300026095 Bacteria 3048
378 Ga0207676_10202580 3300026095 Unclassified 1755
379 Ga0207676_10240129 3300026095 Bacteria 1625
380 Ga0207676_10318871 3300026095 Bacteria 1426
381 Ga0207676_10800392 3300026095 Unclassified 919
382 Ga0207676_10942572 3300026095 Bacteria 848
383 Ga0207674_10323677 3300026116 Bacteria 1491
384 Ga0207674_10759861 3300026116 Bacteria 936
385 Ga0207675_100003870 3300026118 Bacteria 14546
386 Ga0207675_100015968 3300026118 Bacteria 7007
387 Ga0207675_100184596 3300026118 Bacteria 1999
388 Ga0207675_100803028 3300026118 Unclassified 954
389 Ga0207675_101120274 3300026118 Unclassified 807
390 Ga0207675_101619439 3300026118 Unclassified 668
391 Ga0207698_10268809 3300026142 Unclassified 1571
392 Ga0207428_10004743 3300027907 Bacteria 12855
393 Ga0207428_11051260 3300027907 Bacteria 570
394 Ga0268265_10097230 3300028380 Unclassified 2368
395 Ga0268265_10258580 3300028380 Unclassified 1546
396 Ga0268265_10490509 3300028380 Unclassified 1156
397 Ga0268265_10633164 3300028380 Bacteria 1026
398 Ga0268265_11763637 3300028380 Unclassified 625
399 Ga0268264_10060401 3300028381 Bacteria 3177
400 Ga0268264_10671446 3300028381 Unclassified 1027
401 Ga0268264_11078351 3300028381 Unclassified 811
402 Ga0307513_10947600 3300031456 Unclassified 569
403 Ga0307408_101115528 3300031548 Unclassified 732
404 Ga0307408_101986041 3300031548 Bacteria 559
405 Ga0307405_10864402 3300031731 Unclassified 762
406 Ga0307412_11376702 3300031911 Unclassified 638
407 Ga0373935_0922799 3300035692 Bacteria 647
408 Ga0242419_016018 3300038698 Unclassified 606
409 Ga0439462_0112277 3300042015 Bacteria 755
410 Ga0451577_0704067 3300042876 Unclassified 915
411 Ga0453683_0511302 3300044673 Bacteria 780
412 Ga0495610_0367094 3300046512 Unclassified 538
413 Ga0495643_0468192 3300046522 Unclassified 546
414 Ga0495663_0000555 3300046525 Bacteria 13161
415 Ga0495598_0081379 3300046537 Unclassified 1040
416 Ga0495621_0022246 3300046539 Bacteria 2099
417 Ga0495668_0395809 3300046616 Unclassified 759
418 Ga0495669_0076528 3300046684 Bacteria 1532
419 Ga0496102_0177859 3300048905 Bacteria 2004
420 Ga0496104_1548374 3300048907 Unclassified 566
421 Ga0496107_1105573 3300048910 Unclassified 572
422 Ga0496108_0420102 3300048911 Unclassified 1168
423 Ga0496109_0625594 3300048912 Unclassified 1013
424 Ga0496112_1887646 3300048915 Bacteria 509
425 Ga0501225_0232664 3300049705 Unclassified 598
426 nmdc:mga0qj67_126543_c1 3300050509 Unclassified 2068
427 nmdc:mga06r32_111260_c1 3300050510 Bacteria 2695
428 nmdc:mga08y16_1002936_c1 3300050511 Bacteria 815
429 nmdc:mga08y16_1215468_c1 3300050511 Unclassified 724
430 nmdc:mga08y16_1383_c1 3300050511 Bacteria 24251
431 nmdc:mga0n895_262958_c1 3300050512 Bacteria 1751
432 nmdc:mga0a205_1485957_c1 3300050515 Bacteria 526
433 nmdc:mga0a205_150673_c1 3300050515 Unclassified 2225
434 nmdc:mga0a205_23680_c1 3300050515 Bacteria 5824
435 nmdc:mga0a205_31661_c1 3300050515 Bacteria 5069
436 Ga0373931_0235745
437 SwRhRL2b_contig_135009
438 MBSR1b_contig_11832384
439 JGI25151J46595_10049101
440 rootL2_10005495
441 Ga0058860_11558531
442 Ga0065704_10025892
443 Ga0065704_10071785
444 Ga0065712_10196600
445 Ga0065712_10790237
446 Ga0065715_10015333
447 Ga0065715_10092376
448 Ga0065715_10163322
449 Ga0065715_10256947
450 Ga0065715_10499290
451 Ga0065715_10795778
452 Ga0065707_10000960
453 Ga0070676_10389163
454 Ga0070690_100004087
455 Ga0070690_100013367
456 Ga0070690_100035272
457 Ga0070690_100041234
458 Ga0070690_100182113
459 Ga0070670_100003388
460 Ga0070670_100030464
461 Ga0070670_100537566
462 Ga0070670_101621096
463 Ga0068869_100041537
464 Ga0068869_100204883
465 Ga0068869_100265106
466 Ga0070666_10105461
467 Ga0070666_10243027
468 Ga0070680_100030734
469 Ga0070680_100577000
470 Ga0068868_100223696
471 Ga0068868_102246020
472 Ga0070689_100038252
473 Ga0070689_100162753
474 Ga0070689_100786599
475 Ga0070691_10124049
476 Ga0070687_100015246
477 Ga0070687_100047128
478 Ga0070687_100112546
479 Ga0070692_10037743
480 Ga0070692_10716502
481 Ga0070692_11345230
482 Ga0070668_100937578
483 Ga0070669_100001801
484 Ga0070669_100003467
485 Ga0070675_100212822
486 Ga0070675_100273306
487 Ga0070675_100463658
488 Ga0070671_100001483
489 Ga0070671_100046898
490 Ga0070674_100187199
491 Ga0070674_100581311
492 Ga0070674_100601768
493 Ga0070673_100131000
494 Ga0070673_100164696
495 Ga0070673_100249188
496 Ga0070673_100372982
497 Ga0070673_100697759
498 Ga0070673_101225701
499 Ga0070673_102254525
500 Ga0070688_100105103
501 Ga0070688_100381606
502 Ga0070667_100372718
503 Ga0070709_10906385
504 Ga0070701_10195477
505 Ga0070705_100728138
506 Ga0070705_101043609
507 Ga0070700_100070803
508 Ga0070700_100113689
509 Ga0070694_100008271
510 Ga0070694_100027775
511 Ga0070694_100114311
512 Ga0070694_100259225
513 Ga0070708_100002751
514 Ga0070708_100406242
515 Ga0070708_100491124
516 Ga0070678_100388394
517 Ga0070662_100093915
518 Ga0070662_100451283
519 Ga0070681_10001239
520 Ga0068867_100016294
521 Ga0068867_100042106
522 Ga0068867_100181827
523 Ga0070685_10012666
524 Ga0070685_10203743
525 Ga0070706_100282693
526 Ga0070706_100568937
527 Ga0070706_100726555
528 Ga0070707_100026882
529 Ga0070707_100087369
530 Ga0070707_100848587
531 Ga0070707_101718375
532 Ga0070698_100004211
533 Ga0070698_100005092
534 Ga0070698_101462084
535 Ga0070699_100007108
536 Ga0070699_100270802
537 Ga0070679_100005621
538 Ga0070697_100045759
539 Ga0070697_100078720
540 Ga0070697_100879746
541 Ga0070697_101428537
542 Ga0068853_100114039
543 Ga0070672_100076583
544 Ga0070672_100360712
545 Ga0070672_101369425
546 Ga0070686_100408708
547 Ga0070686_101074264
548 Ga0070695_100146328
549 Ga0070695_100299053
550 Ga0070695_100989146
551 Ga0070695_101222191
552 Ga0070696_100212494
553 Ga0070696_100580506
554 Ga0070696_101955941
555 Ga0070693_100946713
556 Ga0070704_100006364
557 Ga0070704_100073289
558 Ga0070704_100218160
559 Ga0070704_100238527
560 Ga0070704_100259985
561 Ga0070704_101647087
562 Ga0070704_101890337
563 Ga0070664_100112958
564 Ga0068857_100077808
565 Ga0068857_100306228
566 Ga0068854_100342069
567 Ga0068854_100488562
568 Ga0068856_100005944
569 Ga0070702_100107538
570 Ga0070702_100521497
571 Ga0070702_100691556
572 Ga0068852_100397091
573 Ga0068859_100009641
574 Ga0068859_100109477
575 Ga0068859_100114560
576 Ga0068859_100206755
577 Ga0068859_100940121
578 Ga0068859_102438757
579 Ga0068864_100032575
580 Ga0068864_100230883
581 Ga0068864_100273927
582 Ga0068864_100349356
583 Ga0068864_100824776
584 Ga0068866_10009478
585 Ga0068861_100058482
586 Ga0068861_100288457
587 Ga0068861_100379622
588 Ga0068861_101327778
589 Ga0068861_101520192
590 Ga0068863_100099102
591 Ga0068863_100270557
592 Ga0068863_100276627
593 Ga0068863_100476218
594 Ga0068858_100379233
595 Ga0068858_100477180
596 Ga0068858_100511020
597 Ga0068858_101084336
598 Ga0068860_100023776
599 Ga0068860_100101792
600 Ga0068860_100281674
601 Ga0068860_100283395
602 Ga0068860_100902198
603 Ga0068862_100059778
604 Ga0068862_100087641
605 Ga0068862_100229850
606 Ga0068862_100397866
607 Ga0081539_10040293
608 Ga0075432_10549620
609 Ga0070716_100373671
610 Ga0070716_101696991
611 Ga0097621_100050943
612 Ga0097621_100152358
613 Ga0068871_100015655
614 Ga0075430_100027310
615 Ga0075430_101030991
616 Ga0075431_100017911
617 Ga0075433_10306221
618 Ga0075434_100175078
619 Ga0075429_100066651
620 Ga0075429_101162764
621 Ga0068865_100009527
622 Ga0097620_100009642
623 Ga0097620_100109474
624 Ga0097620_100114558
625 Ga0097620_100206756
626 Ga0097620_100940262
627 Ga0097620_102439572
628 Ga0105251_10164691
629 Ga0105244_10538794
630 Ga0105240_10357539
631 Ga0105240_10830150
632 Ga0105240_11058150
633 Ga0105240_11217216
634 Ga0111539_10001336
635 Ga0111539_10024242
636 Ga0111539_10438003
637 Ga0111539_11059584
638 Ga0111539_11678540
639 Ga0105245_10067629
640 Ga0105245_11189726
641 Ga0105247_10585070
642 Ga0114129_10165700
643 Ga0114129_10206671
644 Ga0114129_10916764
645 Ga0114129_10976918
646 Ga0105243_10012258
647 Ga0105243_10075097
648 Ga0105243_10241487
649 Ga0105243_10274798
650 Ga0105243_10310878
651 Ga0105243_10441661
652 Ga0105243_10724187
653 Ga0105243_10738036
654 Ga0105243_10970634
655 Ga0105243_12047085
656 Ga0105241_10031115
657 Ga0105241_10062781
658 Ga0105242_10220632
659 Ga0105242_10259535
660 Ga0105242_10639997
661 Ga0105248_10012712
662 Ga0105248_10339360
663 Ga0105248_13461265
664 Ga0105237_10052157
665 Ga0105237_11720899
666 Ga0105249_10000112
667 Ga0105249_10017766
668 Ga0105249_10022529
669 Ga0105249_10764746
670 Ga0105239_10028682
671 Ga0105239_10217665
672 Ga0105239_11515353
673 Ga0105239_12394886
674 Ga0105246_10044057
675 Ga0105246_10407098
676 Ga0157373_10169425
677 Ga0157373_11123493
678 Ga0157371_11354987
679 Ga0157374_10025291
680 Ga0157374_10596374
681 Ga0157378_10142031
682 Ga0157378_10345021
683 Ga0157378_10455931
684 Ga0157378_10869623
685 Ga0157378_11345245
686 Ga0157378_12294348
687 Ga0163162_10000055
688 Ga0163162_10020781
689 Ga0163162_10323806
690 Ga0163162_10450626
691 Ga0163162_10781773
692 Ga0163162_12526991
693 Ga0163162_13128000
694 Ga0157372_10347352
695 Ga0157372_12292315
696 Ga0157372_13153422
697 Ga0157375_10076001
698 Ga0157375_10129750
699 Ga0157375_10138067
700 Ga0157375_10190244
701 Ga0157375_10675611
702 Ga0157375_12154976
703 Ga0157375_13741417
704 Ga0163163_10052335
705 Ga0163163_10255693
706 Ga0163163_10655801
707 Ga0157380_10000923
708 Ga0157380_10006695
709 Ga0157380_10018287
710 Ga0157380_10179804
711 Ga0157380_10209937
712 Ga0157380_10213407
713 Ga0157377_10071991
714 Ga0157377_10109121
715 Ga0157377_10193789
716 Ga0157379_10846468
717 Ga0157379_11991768
718 Ga0157376_10019299
719 Ga0163161_10054596
720 Ga0163161_11544077
721 Ga0209025_1001330
722 Ga0207680_10072315
723 Ga0207680_10368292
724 Ga0207645_10486362
725 Ga0207684_10100369
726 Ga0207684_10579481
727 Ga0207684_10622172
728 Ga0207654_10657033
729 Ga0207707_10000022
730 Ga0207695_10415761
731 Ga0207671_10504967
732 Ga0207660_10001872
733 Ga0207660_11071897
734 Ga0207662_10001161
735 Ga0207662_10026598
736 Ga0207662_10231196
737 Ga0207652_10001213
738 Ga0207646_10053393
739 Ga0207646_10133323
740 Ga0207646_10835366
741 Ga0207681_10006195
742 Ga0207681_10243644
743 Ga0207681_10654174
744 Ga0207650_10000712
745 Ga0207650_10064611
746 Ga0207650_10394514
747 Ga0207650_10412870
748 Ga0207659_10409697
749 Ga0207659_10473847
750 Ga0207687_10405017
751 Ga0207687_10710870
752 Ga0207644_10004759
753 Ga0207644_10812811
754 Ga0207706_10062966
755 Ga0207706_10172333
756 Ga0207706_10294770
757 Ga0207686_10139907
758 Ga0207686_10867505
759 Ga0207709_10096231
760 Ga0207709_10101218
761 Ga0207709_10248242
762 Ga0207709_11453448
763 Ga0207670_10138176
764 Ga0207670_10219089
765 Ga0207669_10379659
766 Ga0207669_11550566
767 Ga0207704_10028031
768 Ga0207704_11032434
769 Ga0207691_10002711
770 Ga0207691_10213991
771 Ga0207691_10251319
772 Ga0207711_10103396
773 Ga0207711_12016975
774 Ga0207689_10003053
775 Ga0207689_10086980
776 Ga0207689_10167565
777 Ga0207679_10213766
778 Ga0207651_10108284
779 Ga0207651_10135942
780 Ga0207651_10641094
781 Ga0207712_10077854
782 Ga0207712_10087839
783 Ga0207712_10117448
784 Ga0207712_10806056
785 Ga0207668_10151586
786 Ga0207668_11139623
787 Ga0207640_10087756
788 Ga0207640_10251626
789 Ga0207640_10474996
790 Ga0207640_11852184
791 Ga0207677_10046343
792 Ga0207677_10170303
793 Ga0207677_10835710
794 Ga0207703_10152815
795 Ga0207703_10859467
796 Ga0207703_11410180
797 Ga0207639_10074327
798 Ga0207708_10037660
799 Ga0207708_10056438
800 Ga0207708_10130946
801 Ga0207708_10762755
802 Ga0207702_10100804
803 Ga0207641_10107089
804 Ga0207641_10135548
805 Ga0207641_10167356
806 Ga0207641_11127684
807 Ga0207641_11506059
808 Ga0207648_10009515
809 Ga0207648_10072870
810 Ga0207648_10262286
811 Ga0207648_11952958
812 Ga0207676_10058162
813 Ga0207676_10202580
814 Ga0207676_10240129
815 Ga0207676_10318871
816 Ga0207676_10800392
817 Ga0207676_10942572
818 Ga0207674_10323677
819 Ga0207674_10759861
820 Ga0207675_100003870
821 Ga0207675_100015968
822 Ga0207675_100184596
823 Ga0207675_100803028
824 Ga0207675_101120274
825 Ga0207675_101619439
826 Ga0207698_10268809
827 Ga0207428_10004743
828 Ga0207428_11051260
829 Ga0268265_10097230
830 Ga0268265_10258580
831 Ga0268265_10490509
832 Ga0268265_10633164
833 Ga0268265_11763637
834 Ga0268264_10060401
835 Ga0268264_10671446
836 Ga0268264_11078351
837 Ga0307513_10947600
838 Ga0307408_101115528
839 Ga0307408_101986041
840 Ga0307405_10864402
841 Ga0307412_11376702
842 Ga0373935_0922799
843 Ga0242419_016018
844 Ga0439462_0112277
845 Ga0451577_0704067
846 Ga0453683_0511302
847 Ga0495610_0367094
848 Ga0495643_0468192
849 Ga0495663_0000555
850 Ga0495598_0081379
851 Ga0495621_0022246
852 Ga0495668_0395809
853 Ga0495669_0076528
854 Ga0496102_0177859
855 Ga0496104_1548374
856 Ga0496107_1105573
857 Ga0496108_0420102
858 Ga0496109_0625594
859 Ga0496112_1887646
860 Ga0501225_0232664
861 nmdc:mga0qj67_126543_c1
862 nmdc:mga06r32_111260_c1
863 nmdc:mga08y16_1002936_c1
864 nmdc:mga08y16_1215468_c1
865 nmdc:mga08y16_1383_c1
866 nmdc:mga0n895_262958_c1
867 nmdc:mga0a205_1485957_c1
868 nmdc:mga0a205_150673_c1
869 nmdc:mga0a205_23680_c1
870 nmdc:mga0a205_31661_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

24

120

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r4u-assembly1.cif.gz_A crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a 0.8801 61 122
4qfw-assembly1.cif.gz_A crystal structure of acyl-coa thioesterase tesb from yersinia pestis 0.8663 61 124
4r4u-assembly2.cif.gz_C crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a 0.8655 61 124
4qfw-assembly2.cif.gz_B crystal structure of acyl-coa thioesterase tesb from yersinia pestis 0.8652 61 124
4r4u-assembly2.cif.gz_D crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a 0.8645 61 124
ID Description Score Start End Superfamily
af_Q9FJI2_19_158_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8919 1 123 3.10.129.10
4gwhA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8693 61 124 2.40.160.210
af_Q9FJI2_19_158_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8659 1 123 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8423 1 124 3.10.129.10
af_O06135_6_288_2.40.160.210 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.839 61 123 2.40.160.210
ID Description Score Start End GO Terms
AF-M0N6Y1-F1-model_v4 (R)-specific enoyl-CoA hydratase 0.9419 1 123
AF-A0A534PHH9-F1-model_v4 Enoyl-CoA hydratase 0.9392 1 123 GO:0006633
GO:0019171
AF-A0A081LBU3-F1-model_v4 Enoyl-CoA hydratase 0.9384 1 123
AF-A0A511WQX4-F1-model_v4 Enoyl-CoA hydratase 0.9366 1 123
AF-A0A1H0G509-F1-model_v4 Acyl dehydratase 0.9337 1 123

Map