F443278

General Info

Members Datasets Scaffolds Average Seq Length
435 244 422 250

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100055526|Ga0068867_1000555263
Length 270
Sequence MACAPSSLMTQWVGENCIMPIEYARRLTGRERTTGSNWHLGCALAFIAGATNAGAFLAVKGYTSHMTGIVSSMADNLVLGNIRLVAGALGAVASFMAGAAACAVLVNYARRRQLKSEFALPLLLEAALLLVFGIIGAQLATTQGFFVSVTVMLLCFAMGLQNAVITKISRAEIRTTHVTGLVTDIGIELGKLVYWNRTQGDSFPRVAADRKRMLLLSLLVSSFLFGGVLGALGFQHSGYATTIPLAAILVLVASVPAADDIRDRFARSDA

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
4 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
5 2643221641 Nocardioides sp. Root122 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2643221696 Nocardioides sp. Root140 Isolate Unclassified
8 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
9 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
10 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
11 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
12 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
116 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
120 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
121 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
122 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
123 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.23
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.59
Nodule 0.46
Rhizoplane 4.14
Rhizosphere 81.15
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1002875 3300002774 Bacteria 4167
2 JGI25151J46595_10030488 3300003187 Bacteria 2120
3 rootH1_10041165 3300003316 Bacteria 4867
4 rootH2_10210797 3300003320 Bacteria 2413
5 rootL2_10005583 3300003322 Bacteria 7535
6 rootH1_10063116 3300003323 Bacteria 10245
7 Ga0055525_1000001 3300003759 Bacteria 1016948
8 Ga0055537_1003430 3300003773 Bacteria 4876
9 Ga0065165_1007436 3300005262 Bacteria 5380
10 Ga0070658_10859276 3300005327 Bacteria 788
11 Ga0070683_100004702 3300005329 Bacteria 11286
12 Ga0070666_10493257 3300005335 Bacteria 887
13 Ga0070680_100014853 3300005336 Bacteria 6092
14 Ga0070660_100000973 3300005339 Bacteria 19145
15 Ga0070660_100030933 3300005339 Bacteria 4018
16 Ga0070660_100033766 3300005339 Bacteria 3859
17 Ga0070660_100225054 3300005339 Bacteria 1525
18 Ga0070661_100012725 3300005344 Bacteria 5889
19 Ga0070659_100000937 3300005366 Bacteria 21435
20 Ga0070659_100066807 3300005366 Bacteria 2850
21 Ga0070659_100109218 3300005366 Bacteria 2232
22 Ga0070663_100068946 3300005455 Bacteria 2568
23 Ga0070662_100102695 3300005457 Bacteria 2167
24 Ga0070681_10144482 3300005458 Bacteria 2308
25 Ga0068867_100055526 3300005459 Bacteria 2929
26 Ga0070679_100132500 3300005530 Bacteria 2474
27 Ga0070679_100542848 3300005530 Bacteria 1106
28 Ga0070684_100472977 3300005535 Bacteria 1159
29 Ga0068853_100000035 3300005539 Bacteria 109060
30 Ga0068855_100053700 3300005563 Bacteria 4739
31 Ga0068855_100252808 3300005563 Bacteria 1965
32 Ga0068855_100306299 3300005563 Bacteria 1758
33 Ga0070664_100125190 3300005564 Bacteria 2253
34 Ga0070664_100146544 3300005564 Bacteria 2082
35 Ga0068857_100173546 3300005577 Bacteria 1960
36 Ga0068854_100000069 3300005578 Bacteria 74316
37 Ga0068854_100001306 3300005578 Bacteria 15027
38 Ga0068852_100046504 3300005616 Bacteria 3699
39 Ga0075363_100237743 3300006048 Bacteria 1047
40 Ga0075367_10195904 3300006178 Bacteria 1262
41 Ga0075366_10058283 3300006195 Bacteria 2294
42 Ga0075370_10134487 3300006353 Bacteria 1444
43 Ga0068865_100171405 3300006881 Bacteria 1664
44 Ga0079104_1000009 3300006946 Bacteria 367015
45 Ga0105240_10033125 3300009093 Bacteria 6679
46 Ga0105240_10132901 3300009093 Bacteria 2982
47 Ga0105240_10212452 3300009093 Bacteria 2260
48 Ga0105240_10286794 3300009093 Bacteria 1889
49 Ga0105240_10339433 3300009093 Bacteria 1707
50 Ga0105245_10278118 3300009098 Unclassified 1635
51 Ga0105243_10068896 3300009148 Bacteria 2852
52 Ga0105237_10131506 3300009545 Bacteria 2497
53 Ga0105238_10229452 3300009551 Bacteria 1833
54 Ga0105238_10544372 3300009551 Bacteria 1165
55 Ga0105239_10617420 3300010375 Bacteria 1237
56 Ga0105246_10296521 3300011119 Bacteria 1303
57 Ga0157370_10040012 3300013104 Bacteria 4528
58 Ga0157370_10047948 3300013104 Bacteria 4093
59 Ga0157370_10048393 3300013104 Bacteria 4074
60 Ga0157370_10086808 3300013104 Bacteria 2939
61 Ga0157370_10303956 3300013104 Bacteria 1472
62 Ga0157369_10001044 3300013105 Bacteria 35014
63 Ga0157369_10014063 3300013105 Bacteria 9040
64 Ga0157374_10019610 3300013296 Bacteria 5986
65 Ga0157378_10290720 3300013297 Bacteria 1578
66 Ga0163162_10455335 3300013306 Bacteria 1411
67 Ga0157372_10021381 3300013307 Bacteria 6990
68 Ga0157372_10077911 3300013307 Bacteria 3745
69 Ga0157372_10159152 3300013307 Bacteria 2609
70 Ga0157372_10691053 3300013307 Bacteria 1187
71 Ga0157372_10827906 3300013307 Bacteria 1075
72 Ga0157376_10043548 3300014969 Bacteria 3684
73 Ga0182007_10055421 3300015262 Bacteria 1303
74 Ga0206353_10212152 3300020082 Bacteria 983
75 Ga0213872_10126597 3300021361 Bacteria 1127
76 Ga0209563_100007 3300025230 Bacteria 1579402
77 Ga0207425_1007649 3300025245 Bacteria 2831
78 Ga0209148_1000360 3300025254 Bacteria 57908
79 Ga0209129_1015770 3300025258 Bacteria 1541
80 Ga0209565_1000389 3300025263 Bacteria 37285
81 Ga0209673_1006016 3300025273 Bacteria 5966
82 Ga0209675_1002138 3300025291 Bacteria 10424
83 Ga0209675_1020969 3300025291 Bacteria 1753
84 Ga0209025_1006244 3300025294 Bacteria 9339
85 Ga0209025_1041498 3300025294 Bacteria 1969
86 Ga0209758_1005187 3300025297 Bacteria 10244
87 Ga0209758_1040975 3300025297 Bacteria 1739
88 Ga0209050_1000517 3300025298 Bacteria 64833
89 Ga0209051_1015127 3300025303 Bacteria 3564
90 Ga0207680_10452751 3300025903 Bacteria 911
91 Ga0207647_10062455 3300025904 Bacteria 2270
92 Ga0207705_10001284 3300025909 Bacteria 20151
93 Ga0207705_10029594 3300025909 Bacteria 3904
94 Ga0207705_10123813 3300025909 Bacteria 1920
95 Ga0207705_10125674 3300025909 Bacteria 1906
96 Ga0207705_10676260 3300025909 Unclassified 803
97 Ga0207654_10550198 3300025911 Bacteria 820
98 Ga0207707_10296691 3300025912 Bacteria 1398
99 Ga0207695_10010402 3300025913 Bacteria 11384
100 Ga0207695_10287745 3300025913 Bacteria 1536
101 Ga0207695_10301031 3300025913 Bacteria 1495
102 Ga0207695_10323273 3300025913 Bacteria 1432
103 Ga0207660_10033304 3300025917 Bacteria 3563
104 Ga0207657_10002355 3300025919 Bacteria 20470
105 Ga0207657_10002797 3300025919 Bacteria 18785
106 Ga0207657_10006088 3300025919 Bacteria 12550
107 Ga0207657_10042324 3300025919 Bacteria 4020
108 Ga0207652_10068767 3300025921 Bacteria 3073
109 Ga0207694_10123409 3300025924 Bacteria 2070
110 Ga0207694_10250534 3300025924 Bacteria 1449
111 Ga0207687_10071076 3300025927 Bacteria 2486
112 Ga0207690_10001677 3300025932 Bacteria 13654
113 Ga0207690_10026428 3300025932 Bacteria 3655
114 Ga0207706_10032753 3300025933 Bacteria 4626
115 Ga0207686_10056871 3300025934 Bacteria 2461
116 Ga0207709_10033369 3300025935 Bacteria 3022
117 Ga0207709_10160432 3300025935 Bacteria 1568
118 Ga0207704_10088420 3300025938 Bacteria 2027
119 Ga0207704_10088652 3300025938 Bacteria 2025
120 Ga0207679_10131199 3300025945 Bacteria 2011
121 Ga0207679_10570362 3300025945 Bacteria 1017
122 Ga0207667_10036492 3300025949 Bacteria 5268
123 Ga0207667_10193079 3300025949 Bacteria 2089
124 Ga0207640_10000057 3300025981 Bacteria 93580
125 Ga0207640_10160837 3300025981 Bacteria 1661
126 Ga0207639_10000016 3300026041 Bacteria 262939
127 Ga0207639_10427755 3300026041 Bacteria 1198
128 Ga0207678_10009534 3300026067 Bacteria 8541
129 Ga0207678_10712673 3300026067 Bacteria 883
130 Ga0207702_10122794 3300026078 Bacteria 2327
131 Ga0207648_10098062 3300026089 Bacteria 2565
132 Ga0207674_10001317 3300026116 Bacteria 32318
133 Ga0207698_10034266 3300026142 Bacteria 3699
134 Ga0207698_10056777 3300026142 Bacteria 3024
135 Ga0209281_1000023 3300027111 Bacteria 519955
136 Ga0307515_10025287 3300028794 Bacteria 10283
137 Ga0307405_10010367 3300031731 Bacteria 4825
138 Ga0307413_10193320 3300031824 Bacteria 1463
139 Ga0307410_10101823 3300031852 Bacteria 2060
140 Ga0307409_100086400 3300031995 Bacteria 2553
141 Ga0307409_100337143 3300031995 Bacteria 1417
142 Ga0307409_100467657 3300031995 Bacteria 1221
143 Ga0307416_100029897 3300032002 Bacteria 4079
144 Ga0307411_10721587 3300032005 Bacteria 870
145 Ga0307415_100250489 3300032126 Bacteria 1439
146 Ga0307510_10120013 3300033180 Bacteria 2337
147 Ga0395899_0000007 3300037312 Bacteria 629129
148 Ga0395899_0001520 3300037312 Bacteria 19611
149 Ga0395899_0011569 3300037312 Bacteria 6755
150 Ga0395899_0053246 3300037312 Bacteria 2997
151 Ga0395899_0066991 3300037312 Bacteria 2635
152 Ga0395899_0091473 3300037312 Bacteria 2204
153 Ga0395900_0000178 3300037418 Bacteria 102491
154 Ga0395900_0000393 3300037418 Bacteria 63296
155 Ga0395900_0140065 3300037418 Bacteria 2477
156 Ga0395900_0346981 3300037418 Bacteria 1458
157 Ga0395900_0699221 3300037418 Bacteria 947
158 Ga0395900_0787376 3300037418 Bacteria 879
159 Ga0395898_0000276 3300037466 Bacteria 124774
160 Ga0395898_0052495 3300037466 Bacteria 3983
161 Ga0395898_0577419 3300037466 Bacteria 1066
162 Ga0395905_0112994 3300037471 Bacteria 2551
163 Ga0395905_0120394 3300037471 Bacteria 2467
164 Ga0395905_0151673 3300037471 Bacteria 2180
165 Ga0395905_0237531 3300037471 Bacteria 1703
166 Ga0395905_0364644 3300037471 Bacteria 1337
167 Ga0395901_0000054 3300038443 Bacteria 160505
168 Ga0395901_0048485 3300038443 Bacteria 4411
169 Ga0395901_0064548 3300038443 Bacteria 3812
170 Ga0395901_0123040 3300038443 Bacteria 2726
171 Ga0395901_0328082 3300038443 Bacteria 1582
172 Ga0395901_0447496 3300038443 Bacteria 1321
173 Ga0439447_054087 3300041407 Bacteria 953
174 Ga0439466_0026388 3300041411 Bacteria 2020
175 Ga0439465_0012004 3300041413 Bacteria 2712
176 Ga0439465_0121353 3300041413 Bacteria 916
177 Ga0439431_0000667 3300041997 Bacteria 7320
178 Ga0439433_0004024 3300041999 Bacteria 3161
179 Ga0439442_002010 3300042002 Bacteria 3997
180 Ga0439445_0000073 3300042004 Bacteria 15200
181 Ga0439448_0006941 3300042005 Bacteria 3266
182 Ga0439448_0016066 3300042005 Bacteria 2274
183 Ga0439448_0030901 3300042005 Bacteria 1700
184 Ga0439432_000321 3300042006 Bacteria 17394
185 Ga0439449_0038770 3300042007 Bacteria 1771
186 Ga0439452_003138 3300042010 Bacteria 5858
187 Ga0439462_0008024 3300042015 Bacteria 2656
188 Ga0439446_0000994 3300042156 Bacteria 6177
189 Ga0439458_0006137 3300042157 Bacteria 2681
190 Ga0439458_0009394 3300042157 Bacteria 2177
191 Ga0439434_0001190 3300042435 Bacteria 7499
192 Ga0466969_0004730 3300044656 Bacteria 7244
193 Ga0466969_0012995 3300044656 Bacteria 4384
194 Ga0466969_0027097 3300044656 Bacteria 2935
195 Ga0466969_0058855 3300044656 Bacteria 1869
196 Ga0466972_0026943 3300044658 Bacteria 2846
197 Ga0466973_0032692 3300044659 Bacteria 4960
198 Ga0466965_0005162 3300044683 Bacteria 5862
199 Ga0466965_0005185 3300044683 Bacteria 5852
200 Ga0466965_0010799 3300044683 Bacteria 4270
201 Ga0466965_0019676 3300044683 Bacteria 3241
202 Ga0466965_0024436 3300044683 Bacteria 2923
203 Ga0466965_0079900 3300044683 Bacteria 1652
204 Ga0466966_0001053 3300044684 Bacteria 17605
205 Ga0466966_0034952 3300044684 Bacteria 3248
206 Ga0466966_0075467 3300044684 Bacteria 2106
207 Ga0466966_0096744 3300044684 Bacteria 1828
208 Ga0466966_0122645 3300044684 Bacteria 1595
209 Ga0466961_0000040 3300044693 Bacteria 78691
210 Ga0466961_0000056 3300044693 Bacteria 67114
211 Ga0466963_0009472 3300044694 Bacteria 5865
212 Ga0466963_0364349 3300044694 Bacteria 1018
213 Ga0466964_0000947 3300044706 Bacteria 9599
214 Ga0466964_0004099 3300044706 Bacteria 5363
215 Ga0466964_0109755 3300044706 Bacteria 1229
216 Ga0466971_0012417 3300044719 Bacteria 3732
217 Ga0466968_0000280 3300044735 Bacteria 16266
218 Ga0466968_0064068 3300044735 Bacteria 1589
219 Ga0466970_0020723 3300044765 Bacteria 3419
220 Ga0466970_0084241 3300044765 Bacteria 1721
221 Ga0466957_0000210 3300044842 Bacteria 27371
222 Ga0466957_0000464 3300044842 Bacteria 20116
223 Ga0466957_0045427 3300044842 Bacteria 2664
224 Ga0466957_0225412 3300044842 Bacteria 1239
225 Ga0466960_0025156 3300044901 Bacteria 2692
226 Ga0466959_0014125 3300045049 Bacteria 5795
227 Ga0466959_0056895 3300045049 Bacteria 2852
228 Ga0466959_0105284 3300045049 Bacteria 2017
229 Ga0466959_0121056 3300045049 Bacteria 1860
230 Ga0466958_0000378 3300045836 Bacteria 18120
231 Ga0466958_0021762 3300045836 Bacteria 3750
232 Ga0466958_0038331 3300045836 Bacteria 2875
233 Ga0466958_0078631 3300045836 Bacteria 2027
234 Ga0466967_0032485 3300045976 Bacteria 4408
235 Ga0466967_0071025 3300045976 Bacteria 3116
236 Ga0466967_0440308 3300045976 Bacteria 1272
237 Ga0495603_0049335 3300046455 Bacteria 2506
238 Ga0495590_0008318 3300046457 Bacteria 3964
239 Ga0495638_0100673 3300046460 Unclassified 1729
240 Ga0495638_0282946 3300046460 Bacteria 900
241 Ga0495650_0000037 3300046471 Bacteria 390090
242 Ga0495605_0000260 3300046474 Bacteria 61729
243 Ga0495605_0026856 3300046474 Bacteria 2988
244 Ga0495605_0134954 3300046474 Bacteria 1110
245 Ga0495584_0005714 3300046491 Bacteria 6566
246 Ga0495584_0006768 3300046491 Bacteria 5989
247 Ga0495585_0130169 3300046492 Bacteria 1325
248 Ga0495594_0141357 3300046499 Bacteria 1365
249 Ga0495596_0005712 3300046500 Bacteria 5837
250 Ga0495596_0009315 3300046500 Bacteria 4321
251 Ga0495607_0000932 3300046501 Bacteria 27199
252 Ga0495607_0001681 3300046501 Bacteria 19067
253 Ga0495607_0002669 3300046501 Bacteria 14271
254 Ga0495607_0002743 3300046501 Bacteria 14044
255 Ga0495607_0045013 3300046501 Bacteria 2598
256 Ga0495583_0001694 3300046506 Bacteria 21286
257 Ga0495583_0027707 3300046506 Bacteria 2793
258 Ga0495583_0177816 3300046506 Bacteria 872
259 Ga0495606_0003649 3300046507 Bacteria 16140
260 Ga0495606_0006521 3300046507 Bacteria 10740
261 Ga0495606_0179170 3300046507 Bacteria 1223
262 Ga0495616_0000272 3300046513 Bacteria 41986
263 Ga0495616_0021612 3300046513 Bacteria 3480
264 Ga0495616_0033710 3300046513 Bacteria 2665
265 Ga0495616_0041945 3300046513 Bacteria 2331
266 Ga0495616_0077369 3300046513 Bacteria 1597
267 Ga0495631_0041623 3300046518 Bacteria 2032
268 Ga0495631_0056039 3300046518 Bacteria 1716
269 Ga0495631_0081945 3300046518 Bacteria 1391
270 Ga0495631_0092184 3300046518 Bacteria 1304
271 Ga0495632_0000235 3300046519 Bacteria 55317
272 Ga0495632_0001939 3300046519 Bacteria 16513
273 Ga0495632_0185903 3300046519 Bacteria 950
274 Ga0495643_0003728 3300046522 Bacteria 11029
275 Ga0495643_0004549 3300046522 Bacteria 9658
276 Ga0495644_0108502 3300046523 Bacteria 1052
277 Ga0495648_0012207 3300046524 Bacteria 6421
278 Ga0495648_0050851 3300046524 Bacteria 2529
279 Ga0495666_0025305 3300046526 Bacteria 2931
280 Ga0495642_0004108 3300046528 Bacteria 5679
281 Ga0495642_0007234 3300046528 Bacteria 4259
282 Ga0495642_0030450 3300046528 Bacteria 2158
283 Ga0495665_0029061 3300046531 Bacteria 2962
284 Ga0495587_0031346 3300046536 Bacteria 3220
285 Ga0495609_0000009 3300046538 Bacteria 354860
286 Ga0495609_0004929 3300046538 Bacteria 7166
287 Ga0495609_0008713 3300046538 Bacteria 4946
288 Ga0495609_0123863 3300046538 Bacteria 1110
289 Ga0495597_0000354 3300046542 Bacteria 40920
290 Ga0495645_0074120 3300046543 Bacteria 2451
291 Ga0495633_0006154 3300046558 Bacteria 7176
292 Ga0495656_0014780 3300046615 Bacteria 2934
293 Ga0495656_0019037 3300046615 Bacteria 2645
294 Ga0495656_0034756 3300046615 Bacteria 2066
295 Ga0495668_0046400 3300046616 Bacteria 2413
296 Ga0495625_0052400 3300046660 Bacteria 2922
297 Ga0495661_0000368 3300046665 Bacteria 48926
298 Ga0495661_0002174 3300046665 Bacteria 15309
299 Ga0495661_0011050 3300046665 Bacteria 6133
300 Ga0495661_0011052 3300046665 Bacteria 6133
301 Ga0495661_0022784 3300046665 Bacteria 4071
302 Ga0495588_0000077 3300046674 Bacteria 215338
303 Ga0495588_0060666 3300046674 Bacteria 1957
304 Ga0495623_0081403 3300046679 Bacteria 2002
305 Ga0495669_0087802 3300046684 Bacteria 1433
306 Ga0495669_0096829 3300046684 Bacteria 1367
307 Ga0495670_0240700 3300046691 Bacteria 963
308 Ga0495671_0006045 3300046692 Bacteria 7035
309 Ga0495671_0008004 3300046692 Bacteria 5974
310 Ga0495589_0000037 3300046794 Bacteria 150603
311 Ga0495589_0000183 3300046794 Bacteria 55547
312 Ga0495589_0056908 3300046794 Bacteria 1924
313 Ga0495660_0000096 3300046810 Bacteria 94790
314 Ga0495660_0007889 3300046810 Bacteria 6250
315 Ga0495581_0020388 3300047315 Bacteria 3847
316 Ga0495672_0001295 3300047320 Bacteria 24958
317 Ga0495672_0013418 3300047320 Bacteria 5654
318 Ga0495676_0068361 3300047321 Bacteria 2745
319 Ga0495683_0003346 3300047323 Bacteria 9375
320 Ga0495683_0089224 3300047323 Bacteria 1495
321 Ga0495687_000437 3300047443 Bacteria 51548
322 Ga0495687_000686 3300047443 Bacteria 38422
323 Ga0495687_001003 3300047443 Bacteria 28202
324 Ga0495687_008828 3300047443 Bacteria 5715
325 Ga0495677_0000011 3300047445 Bacteria 149837
326 Ga0495677_0000662 3300047445 Bacteria 13933
327 Ga0495677_0004582 3300047445 Bacteria 5283
328 Ga0495677_0005420 3300047445 Bacteria 4835
329 Ga0495677_0006060 3300047445 Bacteria 4572
330 Ga0495681_0002214 3300047470 Bacteria 14005
331 Ga0495686_0000583 3300047472 Bacteria 51722
332 Ga0495686_0000675 3300047472 Bacteria 46177
333 Ga0495686_0139597 3300047472 Bacteria 1431
334 Ga0495686_0149832 3300047472 Bacteria 1370
335 Ga0495626_0000016 3300048091 Bacteria 232214
336 Ga0495626_0010263 3300048091 Bacteria 5013
337 Ga0495626_0022016 3300048091 Bacteria 3152
338 Ga0495626_0043348 3300048091 Bacteria 2111
339 Ga0496100_0195355 3300048903 Bacteria 1471
340 Ga0496101_0200791 3300048904 Bacteria 1541
341 Ga0496101_0297785 3300048904 Bacteria 1263
342 Ga0496102_0041613 3300048905 Bacteria 4161
343 Ga0496105_0113662 3300048908 Bacteria 2234
344 Ga0496106_0009623 3300048909 Bacteria 7138
345 Ga0496107_0019712 3300048910 Bacteria 4759
346 Ga0496107_0102764 3300048910 Bacteria 2096
347 Ga0496109_0006566 3300048912 Bacteria 9794
348 Ga0496109_0190968 3300048912 Bacteria 1925
349 Ga0496109_0284707 3300048912 Bacteria 1558
350 Ga0496111_0156237 3300048914 Bacteria 1693
351 Ga0496112_0077373 3300048915 Bacteria 3290
352 Ga0496113_0011289 3300048916 Bacteria 5951
353 Ga0496113_0014102 3300048916 Bacteria 5440
354 Ga0496113_0382744 3300048916 Bacteria 1129
355 Ga0496114_0053767 3300048917 Bacteria 3357
356 Ga0496115_0121637 3300048918 Bacteria 2148
357 Ga0496122_0005530 3300048925 Bacteria 15007
358 Ga0496122_0007479 3300048925 Bacteria 12123
359 Ga0496122_0012816 3300048925 Bacteria 8291
360 Ga0496123_0004067 3300048926 Bacteria 15752
361 Ga0496123_0041227 3300048926 Bacteria 3203
362 Ga0496123_0207182 3300048926 Bacteria 1000
363 Ga0496124_0038700 3300048927 Bacteria 4139
364 Ga0496124_0046023 3300048927 Bacteria 3738
365 Ga0496124_0052747 3300048927 Bacteria 3453
366 Ga0496124_0060130 3300048927 Bacteria 3189
367 Ga0496125_0004935 3300048928 Bacteria 15102
368 Ga0496125_0159851 3300048928 Bacteria 1532
369 Ga0496126_0000946 3300048929 Bacteria 49911
370 Ga0495678_022512 3300049459 Bacteria 2753
371 Ga0495678_023412 3300049459 Bacteria 2684
372 Ga0495682_0018979 3300049460 Bacteria 2588
373 Ga0501031_0001240 3300049568 Bacteria 15638
374 Ga0501032_0027372 3300049569 Bacteria 3917
375 Ga0501033_0003041 3300049570 Bacteria 13951
376 Ga0501033_0114250 3300049570 Bacteria 1963
377 Ga0501034_0067051 3300049571 Bacteria 3603
378 Ga0501036_0080352 3300049572 Bacteria 2756
379 Ga0501036_0182479 3300049572 Bacteria 1766
380 Ga0501038_0001051 3300049574 Bacteria 24887
381 Ga0501039_0065943 3300049575 Bacteria 2810
382 Ga0501039_0086158 3300049575 Bacteria 2446
383 Ga0501040_0001922 3300049576 Bacteria 13353
384 Ga0501042_0002450 3300049578 Bacteria 11396
385 Ga0501043_0003421 3300049579 Bacteria 13041
386 Ga0501046_0000036 3300049580 Bacteria 159823
387 Ga0501046_0006711 3300049580 Bacteria 10164
388 Ga0501047_0000701 3300049581 Bacteria 34901
389 Ga0501048_0085681 3300049582 Bacteria 2222
390 Ga0501048_0206641 3300049582 Bacteria 1392
391 Ga0501071_0000561 3300049587 Bacteria 19162
392 Ga0501074_0037737 3300049590 Bacteria 3501
393 Ga0501074_0070700 3300049590 Bacteria 2509
394 Ga0501075_0002515 3300049591 Bacteria 12227
395 Ga0501077_0005899 3300049593 Bacteria 7471
396 Ga0501079_0086014 3300049741 Bacteria 2433
397 Ga0501079_0323632 3300049741 Bacteria 1207
398 Ga0501080_0013009 3300049742 Bacteria 7640
399 Ga0501080_0018092 3300049742 Bacteria 6524
400 Ga0501035_0001422 3300049822 Bacteria 24504
401 Ga0501035_0004206 3300049822 Bacteria 13677
402 Ga0501035_0073909 3300049822 Bacteria 3016
403 Ga0501044_0050035 3300049823 Bacteria 4313
404 Ga0501044_0069357 3300049823 Bacteria 3589
405 Ga0501044_0097166 3300049823 Bacteria 2967
406 Ga0501044_0125903 3300049823 Bacteria 2560
407 Ga0501045_0002119 3300049824 Bacteria 13433
408 Ga0501045_0302580 3300049824 Bacteria 1190
409 nmdc:mga03n38_193219_c1 3300050490 Bacteria 1049
410 nmdc:mga03n38_383845_c1 3300050490 Bacteria 770
411 nmdc:mga0k408_18556_c1 3300050493 Bacteria 3884
412 nmdc:mga06z11_150827_c1 3300050494 Bacteria 1321
413 nmdc:mga04h51_34160_c1 3300050495 Bacteria 1623
414 Ga0500578_0000306 3300053086 Bacteria 60068
415 Ga0500643_027847 3300053087 Bacteria 1752
416 Ga0500634_0041924 3300053161 Bacteria 2484
417 Ga0500645_000206 3300053730 Bacteria 45626
418 Ga0500645_001556 3300053730 Bacteria 11419
419 Ga0501082_0003606 3300060353 Bacteria 13517
420 Ga0466962_0028955 3300061719 Bacteria 2652
421 Ga0466962_0077770 3300061719 Bacteria 1586
422 Ga0530510_0012543 3300061734 Bacteria 5956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0100673 Ga0495638_0100673_123_725 200
2 3300031731 Ga0307405_10010367 Ga0307405_100103672 216
3 3300032002 Ga0307416_100029897 Ga0307416_1000298973 216
4 3300049568 Ga0501031_0001240 Ga0501031_0001240_14635_15453 224
5 3300049572 Ga0501036_0182479 Ga0501036_0182479_59_877 224
6 3300049575 Ga0501039_0086158 Ga0501039_0086158_1488_2306 224
7 3300049576 Ga0501040_0001922 Ga0501040_0001922_2411_3229 224
8 3300049578 Ga0501042_0002450 Ga0501042_0002450_8649_9467 224
9 3300049580 Ga0501046_0006711 Ga0501046_0006711_5913_6731 224
10 3300049587 Ga0501071_0000561 Ga0501071_0000561_6952_7770 224
11 3300049590 Ga0501074_0037737 Ga0501074_0037737_2323_3141 224
12 3300049591 Ga0501075_0002515 Ga0501075_0002515_7247_8065 224
13 3300049593 Ga0501077_0005899 Ga0501077_0005899_2616_3434 224
14 3300049741 Ga0501079_0086014 Ga0501079_0086014_119_937 224
15 3300049742 Ga0501080_0018092 Ga0501080_0018092_4441_5259 224
16 3300049823 Ga0501044_0097166 Ga0501044_0097166_1314_2132 224
17 3300049824 Ga0501045_0002119 Ga0501045_0002119_9819_10637 224
18 3300060353 Ga0501082_0003606 Ga0501082_0003606_10436_11254 224
19 3300061734 Ga0530510_0012543 Ga0530510_0012543_3686_4504 224
20 3300038443 Ga0395901_0048485 Ga0395901_0048485_2123_2827 226
21 3300041407 Ga0439447_054087 Ga0439447_054087_74_784 229
22 3300048091 Ga0495626_0022016 Ga0495626_0022016_553_1302 229
23 3300020082 Ga0206353_10212152 Ga0206353_102121522 230
24 3300046501 Ga0495607_0002743 Ga0495607_0002743_11381_12130 230
25 3300046519 Ga0495632_0001939 Ga0495632_0001939_13920_14669 230
26 3300046665 Ga0495661_0002174 Ga0495661_0002174_2510_3259 230
27 3300046679 Ga0495623_0081403 Ga0495623_0081403_1173_1928 230
28 3300047445 Ga0495677_0006060 Ga0495677_0006060_1942_2691 230
29 3300005616 Ga0068852_100046504 Ga0068852_1000465041 232
30 3300013104 Ga0157370_10086808 Ga0157370_100868082 232
31 3300013105 Ga0157369_10001044 Ga0157369_1000104423 232
32 3300026142 Ga0207698_10034266 Ga0207698_100342661 232
33 3300046474 Ga0495605_0134954 Ga0495605_0134954_192_935 232
34 3300046501 Ga0495607_0045013 Ga0495607_0045013_249_992 232
35 3300046513 Ga0495616_0041945 Ga0495616_0041945_662_1405 232
36 3300046518 Ga0495631_0056039 Ga0495631_0056039_760_1503 232
37 3300046523 Ga0495644_0108502 Ga0495644_0108502_118_861 232
38 3300046524 Ga0495648_0050851 Ga0495648_0050851_665_1408 232
39 3300046538 Ga0495609_0008713 Ga0495609_0008713_3705_4448 232
40 3300046616 Ga0495668_0046400 Ga0495668_0046400_1582_2325 232
41 3300046691 Ga0495670_0240700 Ga0495670_0240700_196_939 232
42 3300047323 Ga0495683_0089224 Ga0495683_0089224_254_997 232
43 3300049459 Ga0495678_023412 Ga0495678_023412_1226_1969 232
44 3300049460 Ga0495682_0018979 Ga0495682_0018979_183_926 232
45 3300046519 Ga0495632_0185903 Ga0495632_0185903_171_914 233
46 3300009098 Ga0105245_10278118 Ga0105245_102781182 235
47 3300031995 Ga0307409_100467657 Ga0307409_1004676572 236
48 3300047472 Ga0495686_0000583 Ga0495686_0000583_16475_17191 236
49 iso_pu_bacteria 2643221561 2643823875 237
50 iso_pu_bacteria 2643221696 2644533151 237
51 3300021361 Ga0213872_10126597 Ga0213872_101265972 238
52 3300048929 Ga0496126_0000946 Ga0496126_0000946_10413_11144 239
53 3300044683 Ga0466965_0010799 Ga0466965_0010799_1741_2532 240
54 3300048916 Ga0496113_0382744 Ga0496113_0382744_238_1029 240
55 3300048927 Ga0496124_0060130 Ga0496124_0060130_967_1758 240
56 3300049582 Ga0501048_0085681 Ga0501048_0085681_1367_2137 240
57 iso_pu_bacteria 2808606365 2808874784 240
58 iso_pu_bacteria 2884215851 2884218945 240
59 iso_pu_bacteria 2919446982 2919447086 240
60 3300003320 rootH2_10210797 rootH2_102107973 241
61 3300031824 Ga0307413_10193320 Ga0307413_101933202 241
62 3300031995 Ga0307409_100337143 Ga0307409_1003371432 241
63 3300032005 Ga0307411_10721587 Ga0307411_107215871 241
64 3300049569 Ga0501032_0027372 Ga0501032_0027372_1449_2180 241
65 3300049570 Ga0501033_0003041 Ga0501033_0003041_12939_13670 241
66 3300049571 Ga0501034_0067051 Ga0501034_0067051_1127_1858 241
67 3300049572 Ga0501036_0080352 Ga0501036_0080352_1521_2252 241
68 3300049574 Ga0501038_0001051 Ga0501038_0001051_12143_12874 241
69 3300049575 Ga0501039_0065943 Ga0501039_0065943_752_1483 241
70 3300049579 Ga0501043_0003421 Ga0501043_0003421_12074_12805 241
71 3300049580 Ga0501046_0000036 Ga0501046_0000036_33103_33834 241
72 3300049581 Ga0501047_0000701 Ga0501047_0000701_12117_12848 241
73 3300049582 Ga0501048_0206641 Ga0501048_0206641_607_1338 241
74 3300049590 Ga0501074_0070700 Ga0501074_0070700_930_1661 241
75 3300049741 Ga0501079_0323632 Ga0501079_0323632_131_862 241
76 3300049742 Ga0501080_0013009 Ga0501080_0013009_6875_7606 241
77 3300049822 Ga0501035_0004206 Ga0501035_0004206_1985_2716 241
78 3300049822 Ga0501035_0073909 Ga0501035_0073909_809_1540 241
79 3300049823 Ga0501044_0050035 Ga0501044_0050035_1891_2622 241
80 3300049823 Ga0501044_0069357 Ga0501044_0069357_843_1574 241
81 3300049824 Ga0501045_0302580 Ga0501045_0302580_338_1102 241
82 3300050490 nmdc:mga03n38_383845_c1 nmdc:mga03n38_383845_c1_30_755 241
83 3300009093 Ga0105240_10286794 Ga0105240_102867942 242
84 3300025913 Ga0207695_10323273 Ga0207695_103232732 242
85 3300033180 Ga0307510_10120013 Ga0307510_101200133 242
86 3300042005 Ga0439448_0016066 Ga0439448_0016066_700_1497 242
87 iso_pu_bacteria 2643221567 2643853362 242
88 iso_pu_bacteria 2643221624 2644137322 242
89 3300005327 Ga0070658_10859276 Ga0070658_108592761 243
90 3300005339 Ga0070660_100000973 Ga0070660_10000097316 243
91 3300005366 Ga0070659_100000937 Ga0070659_1000009376 243
92 3300005530 Ga0070679_100542848 Ga0070679_1005428482 243
93 3300005539 Ga0068853_100000035 Ga0068853_1000000355 243
94 3300005563 Ga0068855_100053700 Ga0068855_1000537004 243
95 3300005578 Ga0068854_100000069 Ga0068854_10000006951 243
96 3300009093 Ga0105240_10033125 Ga0105240_100331255 243
97 3300009093 Ga0105240_10212452 Ga0105240_102124523 243
98 3300009093 Ga0105240_10339433 Ga0105240_103394332 243
99 3300013104 Ga0157370_10040012 Ga0157370_100400124 243
100 3300013104 Ga0157370_10047948 Ga0157370_100479481 243
101 3300013104 Ga0157370_10048393 Ga0157370_100483933 243
102 3300013104 Ga0157370_10303956 Ga0157370_103039562 243
103 3300013307 Ga0157372_10021381 Ga0157372_100213815 243
104 3300013307 Ga0157372_10691053 Ga0157372_106910532 243
105 3300013307 Ga0157372_10827906 Ga0157372_108279062 243
106 3300025254 Ga0209148_1000360 Ga0209148_100036054 243
107 3300025909 Ga0207705_10125674 Ga0207705_101256741 243
108 3300025909 Ga0207705_10676260 Ga0207705_106762601 243
109 3300025913 Ga0207695_10010402 Ga0207695_1001040211 243
110 3300025913 Ga0207695_10287745 Ga0207695_102877452 243
111 3300025919 Ga0207657_10002355 Ga0207657_100023555 243
112 3300025932 Ga0207690_10001677 Ga0207690_100016775 243
113 3300025981 Ga0207640_10000057 Ga0207640_1000005770 243
114 3300026041 Ga0207639_10000016 Ga0207639_10000016148 243
115 3300037312 Ga0395899_0091473 Ga0395899_0091473_304_1059 243
116 3300037418 Ga0395900_0699221 Ga0395900_0699221_83_838 243
117 3300037466 Ga0395898_0577419 Ga0395898_0577419_228_983 243
118 3300037471 Ga0395905_0364644 Ga0395905_0364644_445_1200 243
119 3300044656 Ga0466969_0027097 Ga0466969_0027097_934_1695 243
120 3300044656 Ga0466969_0058855 Ga0466969_0058855_581_1351 243
121 3300044658 Ga0466972_0026943 Ga0466972_0026943_1269_2024 243
122 3300044683 Ga0466965_0005185 Ga0466965_0005185_226_996 243
123 3300044683 Ga0466965_0019676 Ga0466965_0019676_1218_1973 243
124 3300044683 Ga0466965_0024436 Ga0466965_0024436_1561_2331 243
125 3300044683 Ga0466965_0079900 Ga0466965_0079900_34_795 243
126 3300044684 Ga0466966_0001053 Ga0466966_0001053_1644_2405 243
127 3300044684 Ga0466966_0096744 Ga0466966_0096744_838_1608 243
128 3300044693 Ga0466961_0000056 Ga0466961_0000056_49179_49952 243
129 3300044706 Ga0466964_0004099 Ga0466964_0004099_1864_2619 243
130 3300044735 Ga0466968_0000280 Ga0466968_0000280_1700_2455 243
131 3300044765 Ga0466970_0084241 Ga0466970_0084241_566_1336 243
132 3300044842 Ga0466957_0045427 Ga0466957_0045427_1071_1826 243
133 3300044842 Ga0466957_0225412 Ga0466957_0225412_450_1223 243
134 3300045049 Ga0466959_0056895 Ga0466959_0056895_1170_1931 243
135 3300045049 Ga0466959_0105284 Ga0466959_0105284_971_1726 243
136 3300045049 Ga0466959_0121056 Ga0466959_0121056_342_1088 243
137 3300045836 Ga0466958_0021762 Ga0466958_0021762_673_1443 243
138 3300045836 Ga0466958_0038331 Ga0466958_0038331_1791_2552 243
139 3300046457 Ga0495590_0008318 Ga0495590_0008318_2882_3637 243
140 3300046471 Ga0495650_0000037 Ga0495650_0000037_102519_103262 243
141 3300046474 Ga0495605_0000260 Ga0495605_0000260_24955_25710 243
142 3300046491 Ga0495584_0005714 Ga0495584_0005714_4020_4775 243
143 3300046501 Ga0495607_0000932 Ga0495607_0000932_6753_7508 243
144 3300046501 Ga0495607_0002669 Ga0495607_0002669_1531_2286 243
145 3300046507 Ga0495606_0006521 Ga0495606_0006521_8014_8769 243
146 3300046507 Ga0495606_0179170 Ga0495606_0179170_257_1012 243
147 3300046513 Ga0495616_0033710 Ga0495616_0033710_963_1718 243
148 3300046522 Ga0495643_0003728 Ga0495643_0003728_396_1151 243
149 3300046522 Ga0495643_0004549 Ga0495643_0004549_8812_9567 243
150 3300046524 Ga0495648_0012207 Ga0495648_0012207_1939_2694 243
151 3300046543 Ga0495645_0074120 Ga0495645_0074120_1677_2426 243
152 3300046615 Ga0495656_0014780 Ga0495656_0014780_1244_1999 243
153 3300046665 Ga0495661_0011050 Ga0495661_0011050_4941_5696 243
154 3300046674 Ga0495588_0000077 Ga0495588_0000077_76432_77187 243
155 3300046794 Ga0495589_0000183 Ga0495589_0000183_29838_30593 243
156 3300046810 Ga0495660_0000096 Ga0495660_0000096_30404_31159 243
157 3300047320 Ga0495672_0013418 Ga0495672_0013418_2801_3556 243
158 3300047323 Ga0495683_0003346 Ga0495683_0003346_663_1418 243
159 3300047443 Ga0495687_000437 Ga0495687_000437_42825_43580 243
160 3300047443 Ga0495687_000686 Ga0495687_000686_29539_30294 243
161 3300047445 Ga0495677_0000662 Ga0495677_0000662_9568_10323 243
162 3300047445 Ga0495677_0005420 Ga0495677_0005420_3449_4204 243
163 3300047472 Ga0495686_0139597 Ga0495686_0139597_556_1311 243
164 3300048091 Ga0495626_0000016 Ga0495626_0000016_114124_114879 243
165 3300048925 Ga0496122_0012816 Ga0496122_0012816_702_1457 243
166 3300048926 Ga0496123_0041227 Ga0496123_0041227_2232_2987 243
167 3300048927 Ga0496124_0038700 Ga0496124_0038700_1541_2380 243
168 3300048927 Ga0496124_0052747 Ga0496124_0052747_33_788 243
169 3300048928 Ga0496125_0159851 Ga0496125_0159851_146_901 243
170 3300053087 Ga0500643_027847 Ga0500643_027847_910_1653 243
171 3300061719 Ga0466962_0028955 Ga0466962_0028955_39_812 243
172 3300061719 Ga0466962_0077770 Ga0466962_0077770_340_1101 243
173 iso_pu_bacteria 2855386786 2855388808 243
174 iso_pu_bacteria 8047673197 8047673865 243
175 3300003322 rootL2_10005583 rootL2_100055831 244
176 3300003323 rootH1_10063116 rootH1_100631167 244
177 3300005335 Ga0070666_10493257 Ga0070666_104932571 244
178 3300005339 Ga0070660_100225054 Ga0070660_1002250542 244
179 3300005366 Ga0070659_100066807 Ga0070659_1000668072 244
180 3300005457 Ga0070662_100102695 Ga0070662_1001026951 244
181 3300005563 Ga0068855_100306299 Ga0068855_1003062992 244
182 3300005564 Ga0070664_100125190 Ga0070664_1001251902 244
183 3300009551 Ga0105238_10544372 Ga0105238_105443722 244
184 3300010375 Ga0105239_10617420 Ga0105239_106174202 244
185 3300013296 Ga0157374_10019610 Ga0157374_100196107 244
186 3300013297 Ga0157378_10290720 Ga0157378_102907202 244
187 3300013306 Ga0163162_10455335 Ga0163162_104553352 244
188 3300013307 Ga0157372_10159152 Ga0157372_101591522 244
189 3300014969 Ga0157376_10043548 Ga0157376_100435483 244
190 3300015262 Ga0182007_10055421 Ga0182007_100554212 244
191 3300025903 Ga0207680_10452751 Ga0207680_104527511 244
192 3300025913 Ga0207695_10301031 Ga0207695_103010312 244
193 3300025919 Ga0207657_10042324 Ga0207657_100423242 244
194 3300025924 Ga0207694_10250534 Ga0207694_102505342 244
195 3300025933 Ga0207706_10032753 Ga0207706_100327534 244
196 3300025938 Ga0207704_10088420 Ga0207704_100884202 244
197 3300025945 Ga0207679_10570362 Ga0207679_105703622 244
198 3300026067 Ga0207678_10712673 Ga0207678_107126731 244
199 3300026142 Ga0207698_10056777 Ga0207698_100567773 244
200 3300037312 Ga0395899_0001520 Ga0395899_0001520_1860_2618 244
201 3300037312 Ga0395899_0053246 Ga0395899_0053246_1651_2409 244
202 3300037312 Ga0395899_0066991 Ga0395899_0066991_895_1653 244
203 3300037418 Ga0395900_0140065 Ga0395900_0140065_1300_2058 244
204 3300037418 Ga0395900_0346981 Ga0395900_0346981_429_1187 244
205 3300037466 Ga0395898_0052495 Ga0395898_0052495_2060_2818 244
206 3300037471 Ga0395905_0112994 Ga0395905_0112994_1195_1953 244
207 3300037471 Ga0395905_0120394 Ga0395905_0120394_124_867 244
208 3300037471 Ga0395905_0151673 Ga0395905_0151673_165_908 244
209 3300037471 Ga0395905_0237531 Ga0395905_0237531_934_1692 244
210 3300038443 Ga0395901_0064548 Ga0395901_0064548_2154_2897 244
211 3300038443 Ga0395901_0123040 Ga0395901_0123040_1615_2373 244
212 3300038443 Ga0395901_0328082 Ga0395901_0328082_613_1371 244
213 3300038443 Ga0395901_0447496 Ga0395901_0447496_60_818 244
214 3300041413 Ga0439465_0121353 Ga0439465_0121353_29_787 244
215 3300042005 Ga0439448_0030901 Ga0439448_0030901_735_1493 244
216 3300042007 Ga0439449_0038770 Ga0439449_0038770_729_1487 244
217 3300042157 Ga0439458_0009394 Ga0439458_0009394_807_1565 244
218 3300044684 Ga0466966_0075467 Ga0466966_0075467_92_850 244
219 3300044694 Ga0466963_0364349 Ga0466963_0364349_184_942 244
220 3300045976 Ga0466967_0032485 Ga0466967_0032485_899_1657 244
221 3300045976 Ga0466967_0440308 Ga0466967_0440308_274_1032 244
222 3300046460 Ga0495638_0282946 Ga0495638_0282946_50_793 244
223 3300046538 Ga0495609_0004929 Ga0495609_0004929_4347_5090 244
224 3300046538 Ga0495609_0123863 Ga0495609_0123863_318_1061 244
225 3300046660 Ga0495625_0052400 Ga0495625_0052400_877_1620 244
226 3300046665 Ga0495661_0022784 Ga0495661_0022784_1972_2715 244
227 3300047472 Ga0495686_0149832 Ga0495686_0149832_323_1063 244
228 3300048909 Ga0496106_0009623 Ga0496106_0009623_4334_5092 244
229 3300048910 Ga0496107_0019712 Ga0496107_0019712_2371_3129 244
230 3300048910 Ga0496107_0102764 Ga0496107_0102764_1118_1876 244
231 3300048912 Ga0496109_0190968 Ga0496109_0190968_1119_1877 244
232 3300048912 Ga0496109_0284707 Ga0496109_0284707_302_1060 244
233 3300048914 Ga0496111_0156237 Ga0496111_0156237_592_1350 244
234 3300048916 Ga0496113_0011289 Ga0496113_0011289_1319_2077 244
235 3300048917 Ga0496114_0053767 Ga0496114_0053767_2396_3154 244
236 3300048925 Ga0496122_0007479 Ga0496122_0007479_9060_9818 244
237 3300048926 Ga0496123_0207182 Ga0496123_0207182_79_822 244
238 3300048927 Ga0496124_0046023 Ga0496124_0046023_2023_2781 244
239 3300003759 Ga0055525_1000001 Ga0055525_1000001466 245
240 3300005329 Ga0070683_100004702 Ga0070683_1000047028 245
241 3300005336 Ga0070680_100014853 Ga0070680_1000148534 245
242 3300005339 Ga0070660_100030933 Ga0070660_1000309332 245
243 3300005339 Ga0070660_100033766 Ga0070660_1000337662 245
244 3300005344 Ga0070661_100012725 Ga0070661_1000127256 245
245 3300005366 Ga0070659_100109218 Ga0070659_1001092182 245
246 3300005455 Ga0070663_100068946 Ga0070663_1000689462 245
247 3300005458 Ga0070681_10144482 Ga0070681_101444823 245
248 3300005530 Ga0070679_100132500 Ga0070679_1001325002 245
249 3300005535 Ga0070684_100472977 Ga0070684_1004729771 245
250 3300005563 Ga0068855_100252808 Ga0068855_1002528082 245
251 3300005564 Ga0070664_100146544 Ga0070664_1001465442 245
252 3300005577 Ga0068857_100173546 Ga0068857_1001735462 245
253 3300005578 Ga0068854_100001306 Ga0068854_1000013068 245
254 3300009093 Ga0105240_10132901 Ga0105240_101329012 245
255 3300009545 Ga0105237_10131506 Ga0105237_101315063 245
256 3300009551 Ga0105238_10229452 Ga0105238_102294522 245
257 3300011119 Ga0105246_10296521 Ga0105246_102965212 245
258 3300013105 Ga0157369_10014063 Ga0157369_100140634 245
259 3300013307 Ga0157372_10077911 Ga0157372_100779112 245
260 3300025230 Ga0209563_100007 Ga0209563_100007631 245
261 3300025904 Ga0207647_10062455 Ga0207647_100624553 245
262 3300025909 Ga0207705_10001284 Ga0207705_1000128415 245
263 3300025909 Ga0207705_10029594 Ga0207705_100295942 245
264 3300025909 Ga0207705_10123813 Ga0207705_101238131 245
265 3300025911 Ga0207654_10550198 Ga0207654_105501981 245
266 3300025912 Ga0207707_10296691 Ga0207707_102966912 245
267 3300025917 Ga0207660_10033304 Ga0207660_100333044 245
268 3300025919 Ga0207657_10002797 Ga0207657_100027979 245
269 3300025919 Ga0207657_10006088 Ga0207657_100060883 245
270 3300025921 Ga0207652_10068767 Ga0207652_100687672 245
271 3300025924 Ga0207694_10123409 Ga0207694_101234092 245
272 3300025927 Ga0207687_10071076 Ga0207687_100710762 245
273 3300025932 Ga0207690_10026428 Ga0207690_100264284 245
274 3300025934 Ga0207686_10056871 Ga0207686_100568711 245
275 3300025935 Ga0207709_10033369 Ga0207709_100333692 245
276 3300025945 Ga0207679_10131199 Ga0207679_101311992 245
277 3300025949 Ga0207667_10036492 Ga0207667_100364924 245
278 3300025949 Ga0207667_10193079 Ga0207667_101930792 245
279 3300025981 Ga0207640_10160837 Ga0207640_101608372 245
280 3300026041 Ga0207639_10427755 Ga0207639_104277551 245
281 3300026067 Ga0207678_10009534 Ga0207678_100095347 245
282 3300026078 Ga0207702_10122794 Ga0207702_101227942 245
283 3300026116 Ga0207674_10001317 Ga0207674_100013178 245
284 3300037312 Ga0395899_0011569 Ga0395899_0011569_4821_5582 245
285 3300037418 Ga0395900_0000393 Ga0395900_0000393_55241_56002 245
286 3300037418 Ga0395900_0787376 Ga0395900_0787376_47_808 245
287 3300042005 Ga0439448_0006941 Ga0439448_0006941_1655_2416 245
288 3300042157 Ga0439458_0006137 Ga0439458_0006137_1039_1800 245
289 3300044684 Ga0466966_0034952 Ga0466966_0034952_595_1356 245
290 3300044706 Ga0466964_0000947 Ga0466964_0000947_5259_6020 245
291 3300044706 Ga0466964_0109755 Ga0466964_0109755_303_1064 245
292 3300045836 Ga0466958_0078631 Ga0466958_0078631_682_1443 245
293 3300045976 Ga0466967_0071025 Ga0466967_0071025_613_1374 245
294 3300046455 Ga0495603_0049335 Ga0495603_0049335_1382_2143 245
295 3300046474 Ga0495605_0026856 Ga0495605_0026856_649_1410 245
296 3300046491 Ga0495584_0006768 Ga0495584_0006768_816_1577 245
297 3300046492 Ga0495585_0130169 Ga0495585_0130169_491_1252 245
298 3300046499 Ga0495594_0141357 Ga0495594_0141357_349_1110 245
299 3300046501 Ga0495607_0001681 Ga0495607_0001681_16481_17242 245
300 3300046506 Ga0495583_0177816 Ga0495583_0177816_40_801 245
301 3300046507 Ga0495606_0003649 Ga0495606_0003649_2975_3736 245
302 3300046513 Ga0495616_0000272 Ga0495616_0000272_39211_39972 245
303 3300046518 Ga0495631_0041623 Ga0495631_0041623_819_1580 245
304 3300046526 Ga0495666_0025305 Ga0495666_0025305_1599_2360 245
305 3300046528 Ga0495642_0004108 Ga0495642_0004108_4135_4896 245
306 3300046528 Ga0495642_0030450 Ga0495642_0030450_295_1056 245
307 3300046531 Ga0495665_0029061 Ga0495665_0029061_383_1144 245
308 3300046536 Ga0495587_0031346 Ga0495587_0031346_1156_1911 245
309 3300046538 Ga0495609_0000009 Ga0495609_0000009_254985_255746 245
310 3300046542 Ga0495597_0000354 Ga0495597_0000354_8388_9149 245
311 3300046665 Ga0495661_0000368 Ga0495661_0000368_1970_2731 245
312 3300046674 Ga0495588_0060666 Ga0495588_0060666_384_1145 245
313 3300046794 Ga0495589_0000037 Ga0495589_0000037_99117_99878 245
314 3300047315 Ga0495581_0020388 Ga0495581_0020388_1008_1805 245
315 3300047321 Ga0495676_0068361 Ga0495676_0068361_1030_1791 245
316 3300047443 Ga0495687_001003 Ga0495687_001003_1955_2716 245
317 3300047445 Ga0495677_0000011 Ga0495677_0000011_49960_50721 245
318 3300048091 Ga0495626_0010263 Ga0495626_0010263_4241_5002 245
319 3300048904 Ga0496101_0297785 Ga0496101_0297785_216_1004 245
320 3300048905 Ga0496102_0041613 Ga0496102_0041613_637_1398 245
321 3300048908 Ga0496105_0113662 Ga0496105_0113662_833_1594 245
322 3300048918 Ga0496115_0121637 Ga0496115_0121637_576_1337 245
323 3300049570 Ga0501033_0114250 Ga0501033_0114250_441_1184 245
324 3300049823 Ga0501044_0125903 Ga0501044_0125903_942_1685 245
325 iso_pu_bacteria 2808606418 2809145328 245
326 3300003316 rootH1_10041165 rootH1_100411652 246
327 3300031852 Ga0307410_10101823 Ga0307410_101018232 246
328 3300037312 Ga0395899_0000007 Ga0395899_0000007_275187_275945 246
329 3300037418 Ga0395900_0000178 Ga0395900_0000178_80923_81681 246
330 3300037466 Ga0395898_0000276 Ga0395898_0000276_81049_81807 246
331 3300038443 Ga0395901_0000054 Ga0395901_0000054_110515_111276 246
332 3300044656 Ga0466969_0004730 Ga0466969_0004730_4555_5310 246
333 3300044656 Ga0466969_0012995 Ga0466969_0012995_3209_3985 246
334 3300044659 Ga0466973_0032692 Ga0466973_0032692_3984_4739 246
335 3300044683 Ga0466965_0005162 Ga0466965_0005162_3599_4354 246
336 3300044684 Ga0466966_0122645 Ga0466966_0122645_242_1009 246
337 3300044693 Ga0466961_0000040 Ga0466961_0000040_17380_18135 246
338 3300044694 Ga0466963_0009472 Ga0466963_0009472_1940_2695 246
339 3300044719 Ga0466971_0012417 Ga0466971_0012417_1668_2423 246
340 3300044735 Ga0466968_0064068 Ga0466968_0064068_500_1246 246
341 3300044765 Ga0466970_0020723 Ga0466970_0020723_2495_3250 246
342 3300044842 Ga0466957_0000210 Ga0466957_0000210_1734_2489 246
343 3300044842 Ga0466957_0000464 Ga0466957_0000464_17238_18143 246
344 3300044901 Ga0466960_0025156 Ga0466960_0025156_1510_2277 246
345 3300045049 Ga0466959_0014125 Ga0466959_0014125_2906_3661 246
346 3300045836 Ga0466958_0000378 Ga0466958_0000378_15179_15934 246
347 3300046519 Ga0495632_0000235 Ga0495632_0000235_1810_2562 246
348 3300046615 Ga0495656_0019037 Ga0495656_0019037_47_814 246
349 3300046665 Ga0495661_0011052 Ga0495661_0011052_867_1634 246
350 3300046810 Ga0495660_0007889 Ga0495660_0007889_4307_5059 246
351 3300047320 Ga0495672_0001295 Ga0495672_0001295_1827_2576 246
352 3300047472 Ga0495686_0000675 Ga0495686_0000675_103_852 246
353 3300048091 Ga0495626_0043348 Ga0495626_0043348_744_1496 246
354 3300048903 Ga0496100_0195355 Ga0496100_0195355_405_1154 246
355 3300048904 Ga0496101_0200791 Ga0496101_0200791_597_1370 246
356 3300048912 Ga0496109_0006566 Ga0496109_0006566_405_1178 246
357 3300048915 Ga0496112_0077373 Ga0496112_0077373_653_1426 246
358 3300048916 Ga0496113_0014102 Ga0496113_0014102_1157_1930 246
359 3300048925 Ga0496122_0005530 Ga0496122_0005530_1960_2733 246
360 3300048926 Ga0496123_0004067 Ga0496123_0004067_2330_3103 246
361 3300048928 Ga0496125_0004935 Ga0496125_0004935_1705_2478 246
362 3300049459 Ga0495678_022512 Ga0495678_022512_164_916 246
363 3300049822 Ga0501035_0001422 Ga0501035_0001422_10436_11197 246
364 3300005459 Ga0068867_100055526 Ga0068867_1000555263 247
365 3300006048 Ga0075363_100237743 Ga0075363_1002377431 247
366 3300006178 Ga0075367_10195904 Ga0075367_101959041 247
367 3300006195 Ga0075366_10058283 Ga0075366_100582832 247
368 3300006881 Ga0068865_100171405 Ga0068865_1001714052 247
369 3300009148 Ga0105243_10068896 Ga0105243_100688964 247
370 3300025935 Ga0207709_10160432 Ga0207709_101604322 247
371 3300025938 Ga0207704_10088652 Ga0207704_100886522 247
372 3300026089 Ga0207648_10098062 Ga0207648_100980623 247
373 3300028794 Ga0307515_10025287 Ga0307515_100252873 247
374 3300031995 Ga0307409_100086400 Ga0307409_1000864003 247
375 3300032126 Ga0307415_100250489 Ga0307415_1002504893 247
376 3300046692 Ga0495671_0006045 Ga0495671_0006045_733_1488 247
377 3300050490 nmdc:mga03n38_193219_c1 nmdc:mga03n38_193219_c1_114_902 247
378 3300050493 nmdc:mga0k408_18556_c1 nmdc:mga0k408_18556_c1_39_827 247
379 3300050494 nmdc:mga06z11_150827_c1 nmdc:mga06z11_150827_c1_412_1200 247
380 3300050495 nmdc:mga04h51_34160_c1 nmdc:mga04h51_34160_c1_729_1517 247
381 3300053086 Ga0500578_0000306 Ga0500578_0000306_40116_40967 247
382 iso_pu_bacteria 2643221641 2644228349 247
383 3300046500 Ga0495596_0005712 Ga0495596_0005712_4901_5659 248
384 3300046500 Ga0495596_0009315 Ga0495596_0009315_1777_2535 248
385 3300046506 Ga0495583_0001694 Ga0495583_0001694_12739_13497 248
386 3300046506 Ga0495583_0027707 Ga0495583_0027707_1160_1918 248
387 3300046513 Ga0495616_0021612 Ga0495616_0021612_2100_2858 248
388 3300046513 Ga0495616_0077369 Ga0495616_0077369_662_1420 248
389 3300046518 Ga0495631_0081945 Ga0495631_0081945_327_1085 248
390 3300046518 Ga0495631_0092184 Ga0495631_0092184_251_1009 248
391 3300046528 Ga0495642_0007234 Ga0495642_0007234_1763_2521 248
392 3300046558 Ga0495633_0006154 Ga0495633_0006154_4661_5422 248
393 3300046615 Ga0495656_0034756 Ga0495656_0034756_174_932 248
394 3300046684 Ga0495669_0087802 Ga0495669_0087802_88_846 248
395 3300046684 Ga0495669_0096829 Ga0495669_0096829_421_1179 248
396 3300046692 Ga0495671_0008004 Ga0495671_0008004_4464_5222 248
397 3300046794 Ga0495589_0056908 Ga0495589_0056908_499_1257 248
398 3300047443 Ga0495687_008828 Ga0495687_008828_3042_3800 248
399 3300047445 Ga0495677_0004582 Ga0495677_0004582_595_1356 248
400 3300047470 Ga0495681_0002214 Ga0495681_0002214_1866_2627 248
401 3300053161 Ga0500634_0041924 Ga0500634_0041924_1477_2238 248
402 iso_pu_bacteria 2643221556 2643802277 249
403 iso_pu_bacteria 2643221684 2644475785 249
404 3300005262 Ga0065165_1007436 Ga0065165_10074365 251
405 3300025273 Ga0209673_1006016 Ga0209673_10060162 251
406 3300025298 Ga0209050_1000517 Ga0209050_100051746 251
407 3300025303 Ga0209051_1015127 Ga0209051_10151272 251
408 3300041411 Ga0439466_0026388 Ga0439466_0026388_938_1723 252
409 3300041413 Ga0439465_0012004 Ga0439465_0012004_635_1420 252
410 3300041997 Ga0439431_0000667 Ga0439431_0000667_3492_4277 252
411 3300041999 Ga0439433_0004024 Ga0439433_0004024_1486_2271 252
412 3300042002 Ga0439442_002010 Ga0439442_002010_1185_1970 252
413 3300042004 Ga0439445_0000073 Ga0439445_0000073_3140_3925 252
414 3300042006 Ga0439432_000321 Ga0439432_000321_13377_14162 252
415 3300042010 Ga0439452_003138 Ga0439452_003138_3042_3827 252
416 3300042015 Ga0439462_0008024 Ga0439462_0008024_961_1746 252
417 3300042156 Ga0439446_0000994 Ga0439446_0000994_870_1655 252
418 3300042435 Ga0439434_0001190 Ga0439434_0001190_3835_4620 252
419 3300006946 Ga0079104_1000009 Ga0079104_1000009167 254
420 3300027111 Ga0209281_1000023 Ga0209281_1000023220 254
421 3300002774 JGI25150J39212_1002875 JGI25150J39212_10028752 256
422 3300003187 JGI25151J46595_10030488 JGI25151J46595_100304882 256
423 3300003773 Ga0055537_1003430 Ga0055537_10034306 256
424 3300006353 Ga0075370_10134487 Ga0075370_101344872 256
425 3300025245 Ga0207425_1007649 Ga0207425_10076493 256
426 3300025258 Ga0209129_1015770 Ga0209129_10157702 256
427 3300025263 Ga0209565_1000389 Ga0209565_100038918 256
428 3300025291 Ga0209675_1002138 Ga0209675_10021386 256
429 3300025291 Ga0209675_1020969 Ga0209675_10209691 256
430 3300025294 Ga0209025_1006244 Ga0209025_10062442 256
431 3300025294 Ga0209025_1041498 Ga0209025_10414982 256
432 3300025297 Ga0209758_1005187 Ga0209758_100518716 256
433 3300025297 Ga0209758_1040975 Ga0209758_10409751 256
434 3300053730 Ga0500645_000206 Ga0500645_000206_17859_18635 256
435 3300053730 Ga0500645_001556 Ga0500645_001556_3027_3803 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06912

DUF1275

Protein of unknown function (DUF1275)

40

255

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sc4-assembly1.cif.gz_A human oct1 bound to metformin in inward-open conformation 0.5804 12 234
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.5714 12 233
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.5683 12 234
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.5459 12 234
8bvt-assembly1.cif.gz_A cryo-em structure of rat slc22a6 bound to probenecid 0.5441 12 236
ID Description Score Start End Superfamily
af_I1J4L0_137_499_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6228 18 233 1.20.1250.20
af_O96186_278_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6184 21 238 1.20.1250.20
af_Q9C0U9_90_295_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6159 14 236 1.20.1250.20
af_O96186_278_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6044 21 238 1.20.1250.20
af_P0AA78_214_424_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5984 12 234 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V8FP06-F1-model_v4 DUF1275 domain-containing protein 0.9616 1 243 GO:0016020
AF-A0A1V2H3H7-F1-model_v4 DUF1275 family protein 0.9579 17 233 GO:0016020
AF-A0A4Q3WPV9-F1-model_v4 DUF1275 domain-containing protein 0.9524 7 239 GO:0016020
AF-A0A4Q3WPE7-F1-model_v4 DUF1275 domain-containing protein 0.9522 8 237 GO:0016020
AF-A0A838BIA8-F1-model_v4 DUF1275 domain-containing protein 0.9493 1 249 GO:0016020

Feature Viewer

pLDDT pTM Quality
84.2 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map