F443257

General Info

Members Datasets Scaffolds Average Seq Length
435 246 870 145

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10044165|Ga0070676_100441652
Length 162
Sequence VSDLAPGGGAPNEVRDDMITTETELDLKQFVEGGDGISIIRSGGSVRGWNGIRYRAGLSAKNVGATKLSMNVATIPPGGVAYAHIHVDFEVMLYILQGHVRHEYGPGLKKVIENQAGDFIFIEPGVPHEVFNMSDVEPVVAVVARSDASEWENIVPYDRKTE

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
204 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
210 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
211 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
221 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
222 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
223 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
230 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
231 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
234 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 2.07
Rhizosphere 97.24
Stem 0
Stem Tuber 0
Unclassified 10.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10044165 3300005328 Bacteria 2592
2 Ga0058860_11844873 3300004801 Bacteria 652
3 Ga0065712_10135020 3300005290 Bacteria 1461
4 Ga0065707_10330981 3300005295 Bacteria 949
5 Ga0070658_10036281 3300005327 Bacteria 3974
6 Ga0070683_100137494 3300005329 Bacteria 2314
7 Ga0070683_100166166 3300005329 Bacteria 2094
8 Ga0070690_100086121 3300005330 Bacteria 2062
9 Ga0070670_100008076 3300005331 Bacteria 8949
10 Ga0070670_100115259 3300005331 Bacteria 2316
11 Ga0070670_100284971 3300005331 Bacteria 1443
12 Ga0070677_10040124 3300005333 Bacteria 1841
13 Ga0068869_100115664 3300005334 Bacteria 2045
14 Ga0070666_10035762 3300005335 Bacteria 3294
15 Ga0070680_100400452 3300005336 Bacteria 1170
16 Ga0070682_100770679 3300005337 Bacteria 779
17 Ga0068868_100005742 3300005338 Bacteria 8734
18 Ga0070660_100438452 3300005339 Bacteria 1083
19 Ga0070689_100045297 3300005340 Bacteria 3387
20 Ga0070689_100127639 3300005340 Bacteria 2037
21 Ga0070687_100062806 3300005343 Bacteria 1968
22 Ga0070661_100007122 3300005344 Bacteria 7713
23 Ga0070661_100020968 3300005344 Bacteria 4665
24 Ga0070661_100327282 3300005344 Bacteria 1198
25 Ga0070668_100006373 3300005347 Bacteria 8744
26 Ga0070668_100009927 3300005347 Bacteria 7051
27 Ga0070668_100310987 3300005347 Bacteria 1324
28 Ga0070669_100008994 3300005353 Bacteria 7125
29 Ga0070669_100010632 3300005353 Bacteria 6534
30 Ga0070675_100000995 3300005354 Bacteria 20319
31 Ga0070675_100019071 3300005354 Bacteria 5464
32 Ga0070675_100548912 3300005354 Bacteria 1045
33 Ga0070671_100023190 3300005355 Bacteria 5076
34 Ga0070671_100332897 3300005355 Bacteria 1294
35 Ga0070674_100267497 3300005356 Bacteria 1349
36 Ga0070674_101265285 3300005356 Bacteria 657
37 Ga0070673_100217372 3300005364 Bacteria 1653
38 Ga0070673_101344125 3300005364 Unclassified 672
39 Ga0070688_100004556 3300005365 Bacteria 7228
40 Ga0070688_101803891 3300005365 Bacteria 502
41 Ga0070659_100017293 3300005366 Bacteria 5423
42 Ga0070659_100037691 3300005366 Bacteria 3770
43 Ga0070667_100159379 3300005367 Bacteria 1986
44 Ga0070667_101047735 3300005367 Bacteria 762
45 Ga0070667_101230363 3300005367 Bacteria 701
46 Ga0070703_10233808 3300005406 Bacteria 738
47 Ga0070714_100178098 3300005435 Bacteria 1933
48 Ga0070713_101203399 3300005436 Bacteria 733
49 Ga0070701_10083844 3300005438 Bacteria 1732
50 Ga0070711_100040781 3300005439 Unclassified 3133
51 Ga0070711_100126629 3300005439 Bacteria 1897
52 Ga0070705_101078111 3300005440 Bacteria 656
53 Ga0070700_100130335 3300005441 Bacteria 1696
54 Ga0070700_100150914 3300005441 Bacteria 1589
55 Ga0070663_100071494 3300005455 Bacteria 2525
56 Ga0070662_100245835 3300005457 Bacteria 1436
57 Ga0070662_100293024 3300005457 Bacteria 1320
58 Ga0070662_100658218 3300005457 Bacteria 884
59 Ga0070681_10009963 3300005458 Bacteria 9369
60 Ga0068867_100056139 3300005459 Bacteria 2913
61 Ga0068867_100137762 3300005459 Bacteria 1905
62 Ga0068867_100881922 3300005459 Bacteria 804
63 Ga0070685_10018451 3300005466 Bacteria 3752
64 Ga0070685_10029062 3300005466 Bacteria 3069
65 Ga0070707_101084062 3300005468 Unclassified 767
66 Ga0070707_101667476 3300005468 Bacteria 605
67 Ga0070698_100628720 3300005471 Bacteria 1014
68 Ga0070699_100000753 3300005518 Bacteria 29961
69 Ga0070699_100048893 3300005518 Bacteria 3660
70 Ga0070679_100004240 3300005530 Bacteria 13232
71 Ga0070684_100770066 3300005535 Bacteria 899
72 Ga0070697_100546344 3300005536 Bacteria 1016
73 Ga0068853_100450479 3300005539 Bacteria 1210
74 Ga0068853_100452540 3300005539 Bacteria 1208
75 Ga0068853_100855029 3300005539 Bacteria 873
76 Ga0070672_100023472 3300005543 Bacteria 4547
77 Ga0070672_100073728 3300005543 Bacteria 2721
78 Ga0070686_100091697 3300005544 Bacteria 2033
79 Ga0070695_100954278 3300005545 Unclassified 695
80 Ga0070695_101394795 3300005545 Bacteria 581
81 Ga0070693_100525985 3300005547 Bacteria 843
82 Ga0070665_100001056 3300005548 Bacteria 34472
83 Ga0070665_100280403 3300005548 Bacteria 1668
84 Ga0070704_100380534 3300005549 Bacteria 1199
85 Ga0068855_100106554 3300005563 Archaea 3221
86 Ga0070664_100001141 3300005564 Bacteria 21015
87 Ga0070664_100019321 3300005564 Bacteria 5606
88 Ga0070664_100064215 3300005564 Bacteria 3131
89 Ga0068857_100001387 3300005577 Bacteria 19108
90 Ga0068857_100009806 3300005577 Bacteria 8317
91 Ga0068857_100028102 3300005577 Bacteria 4961
92 Ga0068854_100089003 3300005578 Bacteria 2293
93 Ga0068854_101071856 3300005578 Unclassified 717
94 Ga0070702_100476978 3300005615 Bacteria 911
95 Ga0068852_100033298 3300005616 Bacteria 4276
96 Ga0068859_100731654 3300005617 Bacteria 1079
97 Ga0068859_101239071 3300005617 Bacteria 822
98 Ga0068864_100238761 3300005618 Bacteria 1683
99 Ga0068864_100392457 3300005618 Unclassified 1318
100 Ga0068861_100038043 3300005719 Bacteria 3579
101 Ga0068861_100076569 3300005719 Bacteria 2607
102 Ga0068851_10056648 3300005834 Bacteria 2000
103 Ga0068870_10008650 3300005840 Bacteria 4588
104 Ga0068863_100025187 3300005841 Bacteria 5672
105 Ga0068863_100544015 3300005841 Bacteria 1146
106 Ga0068858_100105360 3300005842 Bacteria 2631
107 Ga0068860_100060582 3300005843 Bacteria 3597
108 Ga0068860_100159003 3300005843 Bacteria 2178
109 Ga0068862_100000825 3300005844 Bacteria 30645
110 Ga0068862_100014711 3300005844 Bacteria 6499
111 Ga0070717_10642817 3300006028 Unclassified 963
112 Ga0070716_100514098 3300006173 Bacteria 886
113 Ga0070712_100026438 3300006175 Bacteria 3865
114 Ga0097621_100392098 3300006237 Bacteria 1242
115 Ga0097621_101528704 3300006237 Unclassified 634
116 Ga0068871_100311465 3300006358 Bacteria 1384
117 Ga0068871_100380389 3300006358 Unclassified 1254
118 Ga0075428_100105220 3300006844 Bacteria 3078
119 Ga0075428_100831943 3300006844 Bacteria 981
120 Ga0075430_100072964 3300006846 Bacteria 2878
121 Ga0075430_100288815 3300006846 Bacteria 1357
122 Ga0075430_100488057 3300006846 Bacteria 1016
123 Ga0075431_100009342 3300006847 Bacteria 9844
124 Ga0075431_100080603 3300006847 Bacteria 3361
125 Ga0075431_100097640 3300006847 Bacteria 3033
126 Ga0075431_100921303 3300006847 Bacteria 843
127 Ga0075431_101013595 3300006847 Bacteria 797
128 Ga0075433_10427436 3300006852 Bacteria 1168
129 Ga0075433_11546305 3300006852 Unclassified 573
130 Ga0075434_100020202 3300006871 Bacteria 6454
131 Ga0075434_100156318 3300006871 Unclassified 2299
132 Ga0075434_100199913 3300006871 Bacteria 2018
133 Ga0075434_100208035 3300006871 Bacteria 1977
134 Ga0075434_100246369 3300006871 Bacteria 1806
135 Ga0075434_100312100 3300006871 Bacteria 1593
136 Ga0075434_100631765 3300006871 Archaea 1089
137 Ga0075434_100695925 3300006871 Bacteria 1034
138 Ga0075429_100097503 3300006880 Bacteria 2564
139 Ga0075429_100278738 3300006880 Bacteria 1464
140 Ga0075429_101024646 3300006880 Bacteria 721
141 Ga0068865_100036113 3300006881 Bacteria 3329
142 Ga0075436_100013967 3300006914 Bacteria 5494
143 Ga0075436_100014914 3300006914 Bacteria 5325
144 Ga0075436_100031642 3300006914 Bacteria 3644
145 Ga0075436_100078348 3300006914 Bacteria 2289
146 Ga0097620_100731509 3300006931 Bacteria 1079
147 Ga0097620_101238978 3300006931 Bacteria 822
148 Ga0075435_100002525 3300007076 Bacteria 12182
149 Ga0075435_100030144 3300007076 Bacteria 4262
150 Ga0075435_100092720 3300007076 Bacteria 2495
151 Ga0075435_100402611 3300007076 Unclassified 1177
152 Ga0075435_100815078 3300007076 Bacteria 813
153 Ga0105240_10244268 3300009093 Bacteria 2080
154 Ga0105240_10465025 3300009093 Bacteria 1412
155 Ga0111539_10036591 3300009094 Bacteria 5933
156 Ga0111539_10064880 3300009094 Bacteria 4318
157 Ga0111539_10129554 3300009094 Bacteria 2954
158 Ga0111539_10129888 3300009094 Bacteria 2951
159 Ga0111539_10681941 3300009094 Unclassified 1196
160 Ga0111539_10682654 3300009094 Bacteria 1196
161 Ga0111539_10892808 3300009094 Unclassified 1034
162 Ga0105245_12352509 3300009098 Bacteria 586
163 Ga0114129_10017128 3300009147 Bacteria 10319
164 Ga0114129_10079637 3300009147 Bacteria 4555
165 Ga0114129_10460394 3300009147 Bacteria 1667
166 Ga0114129_11506185 3300009147 Unclassified 826
167 Ga0105243_10196956 3300009148 Bacteria 1764
168 Ga0105241_11263464 3300009174 Bacteria 702
169 Ga0105242_10084767 3300009176 Bacteria 2656
170 Ga0105242_10759930 3300009176 Bacteria 955
171 Ga0105248_10039701 3300009177 Bacteria 5276
172 Ga0105248_10139173 3300009177 Bacteria 2738
173 Ga0105248_11229030 3300009177 Unclassified 847
174 Ga0105248_11605371 3300009177 Bacteria 737
175 Ga0105237_10192389 3300009545 Bacteria 2040
176 Ga0105237_10909292 3300009545 Bacteria 887
177 Ga0105249_10000665 3300009553 Bacteria 31200
178 Ga0105249_10028276 3300009553 Bacteria 5062
179 Ga0105239_10075226 3300010375 Bacteria 3713
180 Ga0157371_10066138 3300013102 Bacteria 2560
181 Ga0157369_10275674 3300013105 Bacteria 1752
182 Ga0157378_10151997 3300013297 Bacteria 2158
183 Ga0163162_10014068 3300013306 Bacteria 7821
184 Ga0163162_11382230 3300013306 Bacteria 801
185 Ga0157372_10142329 3300013307 Bacteria 2764
186 Ga0157375_10141692 3300013308 Bacteria 2531
187 Ga0163163_10000022 3300014325 Bacteria 187289
188 Ga0157380_10028027 3300014326 Bacteria 4290
189 Ga0157380_10973499 3300014326 Bacteria 880
190 Ga0157377_10010222 3300014745 Bacteria 4635
191 Ga0157377_10034893 3300014745 Unclassified 2755
192 Ga0157377_10304707 3300014745 Bacteria 1053
193 Ga0157379_10047690 3300014968 Bacteria 3822
194 Ga0157379_11544600 3300014968 Bacteria 647
195 Ga0157376_10045464 3300014969 Bacteria 3615
196 Ga0157376_10252164 3300014969 Bacteria 1649
197 Ga0182005_1071567 3300015265 Unclassified 952
198 Ga0163161_10095251 3300017792 Bacteria 2208
199 Ga0207697_10004143 3300025315 Bacteria 6994
200 Ga0207656_10027448 3300025321 Bacteria 2329
201 Ga0207688_10048779 3300025901 Bacteria 2366
202 Ga0207688_10534313 3300025901 Bacteria 736
203 Ga0207680_10046558 3300025903 Bacteria 2564
204 Ga0207647_10021221 3300025904 Bacteria 4338
205 Ga0207645_10000951 3300025907 Bacteria 24030
206 Ga0207643_10046536 3300025908 Bacteria 2453
207 Ga0207705_10218965 3300025909 Unclassified 1445
208 Ga0207707_10004179 3300025912 Bacteria 12790
209 Ga0207695_10308588 3300025913 Bacteria 1472
210 Ga0207671_10478758 3300025914 Bacteria 992
211 Ga0207663_10130287 3300025916 Unclassified 1737
212 Ga0207660_10213510 3300025917 Bacteria 1512
213 Ga0207662_10005032 3300025918 Bacteria 6998
214 Ga0207657_10602710 3300025919 Bacteria 857
215 Ga0207649_10002036 3300025920 Bacteria 11490
216 Ga0207649_10006944 3300025920 Bacteria 6155
217 Ga0207649_10300818 3300025920 Bacteria 1173
218 Ga0207652_10017008 3300025921 Bacteria 5948
219 Ga0207681_10022135 3300025923 Bacteria 4049
220 Ga0207681_10069430 3300025923 Bacteria 2450
221 Ga0207681_10167599 3300025923 Bacteria 1662
222 Ga0207681_10328708 3300025923 Bacteria 1218
223 Ga0207650_10012944 3300025925 Bacteria 5768
224 Ga0207650_10189656 3300025925 Bacteria 1642
225 Ga0207650_10191715 3300025925 Bacteria 1633
226 Ga0207650_10332802 3300025925 Unclassified 1246
227 Ga0207659_10091617 3300025926 Bacteria 2271
228 Ga0207687_10677265 3300025927 Unclassified 874
229 Ga0207690_10050156 3300025932 Bacteria 2785
230 Ga0207690_10544000 3300025932 Bacteria 943
231 Ga0207706_10001737 3300025933 Bacteria 21437
232 Ga0207706_10573123 3300025933 Bacteria 971
233 Ga0207686_10072463 3300025934 Bacteria 2220
234 Ga0207670_10253481 3300025936 Bacteria 1361
235 Ga0207670_10840062 3300025936 Bacteria 767
236 Ga0207669_10380911 3300025937 Bacteria 1099
237 Ga0207669_11381033 3300025937 Bacteria 599
238 Ga0207704_10029935 3300025938 Bacteria 3045
239 Ga0207665_10665180 3300025939 Bacteria 817
240 Ga0207691_10000366 3300025940 Bacteria 45517
241 Ga0207691_10001194 3300025940 Bacteria 25851
242 Ga0207691_10032534 3300025940 Bacteria 4862
243 Ga0207711_10241844 3300025941 Bacteria 1655
244 Ga0207711_10359822 3300025941 Bacteria 1348
245 Ga0207711_10381100 3300025941 Bacteria 1308
246 Ga0207689_10006584 3300025942 Bacteria 10241
247 Ga0207661_10076194 3300025944 Bacteria 2754
248 Ga0207661_10143751 3300025944 Bacteria 2055
249 Ga0207679_10001515 3300025945 Bacteria 14538
250 Ga0207679_10002601 3300025945 Bacteria 11113
251 Ga0207679_10046679 3300025945 Bacteria 3141
252 Ga0207679_10080723 3300025945 Bacteria 2484
253 Ga0207667_11361918 3300025949 Unclassified 684
254 Ga0207651_10047886 3300025960 Bacteria 2886
255 Ga0207651_10063088 3300025960 Bacteria 2586
256 Ga0207651_10861693 3300025960 Unclassified 805
257 Ga0207712_10000812 3300025961 Bacteria 23033
258 Ga0207712_10036682 3300025961 Bacteria 3341
259 Ga0207668_10002276 3300025972 Bacteria 11215
260 Ga0207668_10006808 3300025972 Bacteria 6771
261 Ga0207658_11388443 3300025986 Bacteria 642
262 Ga0207658_12190463 3300025986 Bacteria 502
263 Ga0207677_10392998 3300026023 Bacteria 1174
264 Ga0207677_10448296 3300026023 Bacteria 1105
265 Ga0207703_10347216 3300026035 Bacteria 1365
266 Ga0207639_10050452 3300026041 Bacteria 3160
267 Ga0207639_10183684 3300026041 Bacteria 1781
268 Ga0207678_10016479 3300026067 Bacteria 6489
269 Ga0207708_10056420 3300026075 Bacteria 2996
270 Ga0207641_10229567 3300026088 Bacteria 1724
271 Ga0207641_11337324 3300026088 Bacteria 717
272 Ga0207641_12009338 3300026088 Bacteria 579
273 Ga0207641_12296102 3300026088 Unclassified 539
274 Ga0207648_10082599 3300026089 Bacteria 2802
275 Ga0207648_10682771 3300026089 Bacteria 951
276 Ga0207648_11109865 3300026089 Bacteria 742
277 Ga0207648_11617759 3300026089 Bacteria 609
278 Ga0207676_10312486 3300026095 Unclassified 1439
279 Ga0207676_10538421 3300026095 Bacteria 1114
280 Ga0207676_10952410 3300026095 Bacteria 844
281 Ga0207674_10000247 3300026116 Bacteria 67328
282 Ga0207674_10000740 3300026116 Bacteria 42740
283 Ga0207674_10008925 3300026116 Bacteria 11522
284 Ga0207675_100001025 3300026118 Bacteria 27674
285 Ga0207675_100038284 3300026118 Bacteria 4475
286 Ga0207675_100540716 3300026118 Bacteria 1163
287 Ga0207683_10136639 3300026121 Unclassified 2207
288 Ga0207698_10673999 3300026142 Bacteria 1027
289 Ga0207698_10784131 3300026142 Bacteria 954
290 Ga0207428_10304184 3300027907 Bacteria 1180
291 Ga0207428_10856991 3300027907 Unclassified 643
292 Ga0268266_10000188 3300028379 Bacteria 109326
293 Ga0268265_10000988 3300028380 Bacteria 25833
294 Ga0268265_10012737 3300028380 Bacteria 5707
295 Ga0268264_10104635 3300028381 Bacteria 2467
296 Ga0268264_10277381 3300028381 Bacteria 1568
297 Ga0265762_1184075 3300030760 Bacteria 516
298 Ga0307408_100009603 3300031548 Bacteria 6382
299 Ga0307405_10239554 3300031731 Bacteria 1343
300 Ga0307413_10068909 3300031824 Bacteria 2218
301 Ga0307413_10217724 3300031824 Bacteria 1392
302 Ga0307413_10297892 3300031824 Bacteria 1222
303 Ga0307413_10930731 3300031824 Bacteria 740
304 Ga0307410_10423687 3300031852 Bacteria 1080
305 Ga0307410_10445693 3300031852 Unclassified 1055
306 Ga0307406_10018890 3300031901 Bacteria 4036
307 Ga0307407_10286339 3300031903 Bacteria 1143
308 Ga0307412_10084456 3300031911 Bacteria 2204
309 Ga0307409_100030725 3300031995 Bacteria 3864
310 Ga0307416_101430877 3300032002 Bacteria 797
311 Ga0307416_101657738 3300032002 Bacteria 744
312 Ga0307411_10090253 3300032005 Bacteria 2137
313 Ga0307411_10093113 3300032005 Bacteria 2109
314 Ga0307411_10158207 3300032005 Bacteria 1693
315 Ga0307411_10450363 3300032005 Bacteria 1077
316 Ga0373959_0103400 3300034820 Bacteria 680
317 Ga0373926_0050433 3300035083 Bacteria 1500
318 Ga0373939_0277618 3300035114 Bacteria 661
319 Ga0373943_0328363 3300035170 Bacteria 873
320 Ga0373935_0152917 3300035692 Bacteria 1567
321 Ga0373927_0000639 3300035695 Bacteria 26547
322 Ga0373947_0284682 3300035725 Bacteria 1099
323 Ga0373947_0348137 3300035725 Unclassified 994
324 Ga0395900_0196109 3300037418 Bacteria 2046
325 Ga0395905_0244895 3300037471 Bacteria 1675
326 Ga0395905_0287900 3300037471 Bacteria 1530
327 Ga0436363_0332337 3300039450 Bacteria 682
328 Ga0450923_157981 3300042125 Unclassified 551
329 Ga0453683_0185697 3300044673 Unclassified 1319
330 Ga0451576_0012304 3300045051 Bacteria 9624
331 Ga0451576_0312654 3300045051 Bacteria 1643
332 Ga0451576_0350234 3300045051 Unclassified 1546
333 Ga0451576_1986500 3300045051 Bacteria 599
334 Ga0495580_0123363 3300046472 Bacteria 1798
335 Ga0495580_0181741 3300046472 Bacteria 1452
336 Ga0495582_0249068 3300046473 Bacteria 1019
337 Ga0495639_0155297 3300046475 Bacteria 1105
338 Ga0495666_0142881 3300046526 Bacteria 1115
339 Ga0495622_0086359 3300046557 Bacteria 1443
340 Ga0495634_0529607 3300046642 Bacteria 689
341 Ga0495647_0103814 3300046681 Bacteria 1180
342 Ga0495658_0074083 3300046683 Bacteria 1983
343 Ga0495658_0952272 3300046683 Bacteria 548
344 Ga0495669_0116083 3300046684 Bacteria 1252
345 Ga0495670_0258706 3300046691 Bacteria 929
346 Ga0495670_0790485 3300046691 Bacteria 518
347 Ga0495684_0695855 3300047471 Archaea 675
348 Ga0496101_0331433 3300048904 Bacteria 1195
349 Ga0496106_0073879 3300048909 Bacteria 2609
350 Ga0496106_0121533 3300048909 Bacteria 2042
351 Ga0496108_0227051 3300048911 Unclassified 1623
352 Ga0496109_0204541 3300048912 Bacteria 1856
353 Ga0496110_0118594 3300048913 Bacteria 2383
354 Ga0496112_0428161 3300048915 Bacteria 1262
355 Ga0496112_1610172 3300048915 Bacteria 562
356 Ga0496114_0179637 3300048917 Unclassified 1848
357 Ga0501292_008151 3300049515 Bacteria 1527
358 Ga0501299_023730 3300049522 Bacteria 1140
359 Ga0501034_0056213 3300049571 Bacteria 3961
360 Ga0501041_1122003 3300049577 Bacteria 507
361 Ga0501067_0346700 3300049583 Bacteria 828
362 Ga0501075_0298327 3300049591 Unclassified 1228
363 Ga0501202_000018 3300049652 Bacteria 17871
364 Ga0501207_057378 3300049654 Bacteria 707
365 Ga0501217_023595 3300049661 Bacteria 1467
366 Ga0501224_001026 3300049664 Bacteria 3624
367 Ga0501227_223739 3300049665 Unclassified 536
368 Ga0501230_006215 3300049667 Bacteria 1724
369 Ga0501235_000038 3300049669 Bacteria 21031
370 Ga0501235_048449 3300049669 Bacteria 981
371 Ga0501243_006132 3300049675 Bacteria 1821
372 Ga0501249_046651 3300049679 Bacteria 990
373 Ga0501252_001877 3300049682 Bacteria 2020
374 Ga0501257_000394 3300049686 Bacteria 8520
375 Ga0501258_002661 3300049687 Bacteria 1584
376 Ga0501259_004500 3300049688 Bacteria 2221
377 Ga0501259_018202 3300049688 Bacteria 1225
378 Ga0501261_001362 3300049690 Bacteria 2994
379 Ga0501234_003296 3300049707 Bacteria 2535
380 Ga0501080_0335909 3300049742 Bacteria 1366
381 Ga0501081_0623313 3300049743 Unclassified 808
382 Ga0501083_0000517 3300049744 Bacteria 24634
383 Ga0501266_002107 3300049763 Bacteria 2505
384 Ga0501268_001546 3300049765 Bacteria 2889
385 Ga0501268_018145 3300049765 Bacteria 1180
386 Ga0501269_025268 3300049766 Unclassified 748
387 Ga0501270_000974 3300049767 Bacteria 2626
388 Ga0501276_043917 3300049773 Unclassified 506
389 Ga0501035_1337695 3300049822 Bacteria 551
390 Ga0501204_018205 3300049850 Bacteria 896
391 Ga0501212_039881 3300049851 Bacteria 774
392 nmdc:mga05p37_184487_c1 3300050507 Bacteria 2537
393 nmdc:mga05p37_37516_c1 3300050507 Bacteria 5942
394 nmdc:mga05p37_559039_c1 3300050507 Bacteria 1300
395 nmdc:mga09592_265436_c1 3300050508 Bacteria 1489
396 nmdc:mga09592_382440_c1 3300050508 Unclassified 1217
397 nmdc:mga0qj67_15148_c1 3300050509 Bacteria 5835
398 nmdc:mga0qj67_18830_c1 3300050509 Bacteria 5266
399 nmdc:mga0qj67_783755_c1 3300050509 Unclassified 755
400 nmdc:mga06r32_1660921_c1 3300050510 Bacteria 576
401 nmdc:mga06r32_9133_c1 3300050510 Bacteria 8936
402 nmdc:mga06r32_986954_c1 3300050510 Bacteria 795
403 nmdc:mga08y16_126306_c1 3300050511 Unclassified 2660
404 nmdc:mga08y16_1667447_c1 3300050511 Bacteria 594
405 nmdc:mga08y16_35564_c1 3300050511 Bacteria 5230
406 nmdc:mga08y16_559743_c1 3300050511 Bacteria 1156
407 nmdc:mga08y16_69126_c1 3300050511 Bacteria 3682
408 nmdc:mga0n895_124078_c1 3300050512 Bacteria 2605
409 nmdc:mga0n895_1511349_c1 3300050512 Unclassified 638
410 nmdc:mga0n895_1828442_c1 3300050512 Bacteria 568
411 nmdc:mga0n895_193169_c1 3300050512 Bacteria 2067
412 nmdc:mga0n895_36825_c1 3300050512 Bacteria 4728
413 nmdc:mga0n895_43881_c1 3300050512 Bacteria 4359
414 nmdc:mga0n895_551960_c1 3300050512 Bacteria 1158
415 nmdc:mga0n895_62934_c1 3300050512 Bacteria 3669
416 nmdc:mga0rr50_1647262_c1 3300050513 Bacteria 541
417 nmdc:mga0rr50_311075_c1 3300050513 Bacteria 1319
418 nmdc:mga0rr50_43080_c1 3300050513 Bacteria 3300
419 nmdc:mga0rr50_456135_c1 3300050513 Unclassified 1084
420 nmdc:mga0rr50_613314_c1 3300050513 Unclassified 928
421 nmdc:mga0rr50_6597_c1 3300050513 Bacteria 7090
422 nmdc:mga08x19_253157_c1 3300050514 Bacteria 1216
423 nmdc:mga08x19_258116_c1 3300050514 Bacteria 1204
424 nmdc:mga08x19_258749_c1 3300050514 Archaea 1203
425 nmdc:mga08x19_40110_c1 3300050514 Bacteria 2979
426 nmdc:mga08x19_54911_c1 3300050514 Bacteria 2566
427 nmdc:mga08x19_61560_c1 3300050514 Bacteria 2433
428 nmdc:mga0a205_157531_c1 3300050515 Bacteria 2169
429 nmdc:mga0a205_17490_c1 3300050515 Bacteria 2983
430 nmdc:mga0a205_582549_c1 3300050515 Bacteria 973
431 nmdc:mga0a205_83651_c1 3300050515 Bacteria 3082
432 Ga0500635_0446143 3300053080 Unclassified 512
433 Ga0590077_033347 3300059426 Bacteria 1130
434 Ga0530510_0023305 3300061734 Bacteria 4410
435 Ga0530510_1463002 3300061734 Bacteria 524
436 Ga0070676_10044165
437 Ga0058860_11844873
438 Ga0065712_10135020
439 Ga0065707_10330981
440 Ga0070658_10036281
441 Ga0070683_100137494
442 Ga0070683_100166166
443 Ga0070690_100086121
444 Ga0070670_100008076
445 Ga0070670_100115259
446 Ga0070670_100284971
447 Ga0070677_10040124
448 Ga0068869_100115664
449 Ga0070666_10035762
450 Ga0070680_100400452
451 Ga0070682_100770679
452 Ga0068868_100005742
453 Ga0070660_100438452
454 Ga0070689_100045297
455 Ga0070689_100127639
456 Ga0070687_100062806
457 Ga0070661_100007122
458 Ga0070661_100020968
459 Ga0070661_100327282
460 Ga0070668_100006373
461 Ga0070668_100009927
462 Ga0070668_100310987
463 Ga0070669_100008994
464 Ga0070669_100010632
465 Ga0070675_100000995
466 Ga0070675_100019071
467 Ga0070675_100548912
468 Ga0070671_100023190
469 Ga0070671_100332897
470 Ga0070674_100267497
471 Ga0070674_101265285
472 Ga0070673_100217372
473 Ga0070673_101344125
474 Ga0070688_100004556
475 Ga0070688_101803891
476 Ga0070659_100017293
477 Ga0070659_100037691
478 Ga0070667_100159379
479 Ga0070667_101047735
480 Ga0070667_101230363
481 Ga0070703_10233808
482 Ga0070714_100178098
483 Ga0070713_101203399
484 Ga0070701_10083844
485 Ga0070711_100040781
486 Ga0070711_100126629
487 Ga0070705_101078111
488 Ga0070700_100130335
489 Ga0070700_100150914
490 Ga0070663_100071494
491 Ga0070662_100245835
492 Ga0070662_100293024
493 Ga0070662_100658218
494 Ga0070681_10009963
495 Ga0068867_100056139
496 Ga0068867_100137762
497 Ga0068867_100881922
498 Ga0070685_10018451
499 Ga0070685_10029062
500 Ga0070707_101084062
501 Ga0070707_101667476
502 Ga0070698_100628720
503 Ga0070699_100000753
504 Ga0070699_100048893
505 Ga0070679_100004240
506 Ga0070684_100770066
507 Ga0070697_100546344
508 Ga0068853_100450479
509 Ga0068853_100452540
510 Ga0068853_100855029
511 Ga0070672_100023472
512 Ga0070672_100073728
513 Ga0070686_100091697
514 Ga0070695_100954278
515 Ga0070695_101394795
516 Ga0070693_100525985
517 Ga0070665_100001056
518 Ga0070665_100280403
519 Ga0070704_100380534
520 Ga0068855_100106554
521 Ga0070664_100001141
522 Ga0070664_100019321
523 Ga0070664_100064215
524 Ga0068857_100001387
525 Ga0068857_100009806
526 Ga0068857_100028102
527 Ga0068854_100089003
528 Ga0068854_101071856
529 Ga0070702_100476978
530 Ga0068852_100033298
531 Ga0068859_100731654
532 Ga0068859_101239071
533 Ga0068864_100238761
534 Ga0068864_100392457
535 Ga0068861_100038043
536 Ga0068861_100076569
537 Ga0068851_10056648
538 Ga0068870_10008650
539 Ga0068863_100025187
540 Ga0068863_100544015
541 Ga0068858_100105360
542 Ga0068860_100060582
543 Ga0068860_100159003
544 Ga0068862_100000825
545 Ga0068862_100014711
546 Ga0070717_10642817
547 Ga0070716_100514098
548 Ga0070712_100026438
549 Ga0097621_100392098
550 Ga0097621_101528704
551 Ga0068871_100311465
552 Ga0068871_100380389
553 Ga0075428_100105220
554 Ga0075428_100831943
555 Ga0075430_100072964
556 Ga0075430_100288815
557 Ga0075430_100488057
558 Ga0075431_100009342
559 Ga0075431_100080603
560 Ga0075431_100097640
561 Ga0075431_100921303
562 Ga0075431_101013595
563 Ga0075433_10427436
564 Ga0075433_11546305
565 Ga0075434_100020202
566 Ga0075434_100156318
567 Ga0075434_100199913
568 Ga0075434_100208035
569 Ga0075434_100246369
570 Ga0075434_100312100
571 Ga0075434_100631765
572 Ga0075434_100695925
573 Ga0075429_100097503
574 Ga0075429_100278738
575 Ga0075429_101024646
576 Ga0068865_100036113
577 Ga0075436_100013967
578 Ga0075436_100014914
579 Ga0075436_100031642
580 Ga0075436_100078348
581 Ga0097620_100731509
582 Ga0097620_101238978
583 Ga0075435_100002525
584 Ga0075435_100030144
585 Ga0075435_100092720
586 Ga0075435_100402611
587 Ga0075435_100815078
588 Ga0105240_10244268
589 Ga0105240_10465025
590 Ga0111539_10036591
591 Ga0111539_10064880
592 Ga0111539_10129554
593 Ga0111539_10129888
594 Ga0111539_10681941
595 Ga0111539_10682654
596 Ga0111539_10892808
597 Ga0105245_12352509
598 Ga0114129_10017128
599 Ga0114129_10079637
600 Ga0114129_10460394
601 Ga0114129_11506185
602 Ga0105243_10196956
603 Ga0105241_11263464
604 Ga0105242_10084767
605 Ga0105242_10759930
606 Ga0105248_10039701
607 Ga0105248_10139173
608 Ga0105248_11229030
609 Ga0105248_11605371
610 Ga0105237_10192389
611 Ga0105237_10909292
612 Ga0105249_10000665
613 Ga0105249_10028276
614 Ga0105239_10075226
615 Ga0157371_10066138
616 Ga0157369_10275674
617 Ga0157378_10151997
618 Ga0163162_10014068
619 Ga0163162_11382230
620 Ga0157372_10142329
621 Ga0157375_10141692
622 Ga0163163_10000022
623 Ga0157380_10028027
624 Ga0157380_10973499
625 Ga0157377_10010222
626 Ga0157377_10034893
627 Ga0157377_10304707
628 Ga0157379_10047690
629 Ga0157379_11544600
630 Ga0157376_10045464
631 Ga0157376_10252164
632 Ga0182005_1071567
633 Ga0163161_10095251
634 Ga0207697_10004143
635 Ga0207656_10027448
636 Ga0207688_10048779
637 Ga0207688_10534313
638 Ga0207680_10046558
639 Ga0207647_10021221
640 Ga0207645_10000951
641 Ga0207643_10046536
642 Ga0207705_10218965
643 Ga0207707_10004179
644 Ga0207695_10308588
645 Ga0207671_10478758
646 Ga0207663_10130287
647 Ga0207660_10213510
648 Ga0207662_10005032
649 Ga0207657_10602710
650 Ga0207649_10002036
651 Ga0207649_10006944
652 Ga0207649_10300818
653 Ga0207652_10017008
654 Ga0207681_10022135
655 Ga0207681_10069430
656 Ga0207681_10167599
657 Ga0207681_10328708
658 Ga0207650_10012944
659 Ga0207650_10189656
660 Ga0207650_10191715
661 Ga0207650_10332802
662 Ga0207659_10091617
663 Ga0207687_10677265
664 Ga0207690_10050156
665 Ga0207690_10544000
666 Ga0207706_10001737
667 Ga0207706_10573123
668 Ga0207686_10072463
669 Ga0207670_10253481
670 Ga0207670_10840062
671 Ga0207669_10380911
672 Ga0207669_11381033
673 Ga0207704_10029935
674 Ga0207665_10665180
675 Ga0207691_10000366
676 Ga0207691_10001194
677 Ga0207691_10032534
678 Ga0207711_10241844
679 Ga0207711_10359822
680 Ga0207711_10381100
681 Ga0207689_10006584
682 Ga0207661_10076194
683 Ga0207661_10143751
684 Ga0207679_10001515
685 Ga0207679_10002601
686 Ga0207679_10046679
687 Ga0207679_10080723
688 Ga0207667_11361918
689 Ga0207651_10047886
690 Ga0207651_10063088
691 Ga0207651_10861693
692 Ga0207712_10000812
693 Ga0207712_10036682
694 Ga0207668_10002276
695 Ga0207668_10006808
696 Ga0207658_11388443
697 Ga0207658_12190463
698 Ga0207677_10392998
699 Ga0207677_10448296
700 Ga0207703_10347216
701 Ga0207639_10050452
702 Ga0207639_10183684
703 Ga0207678_10016479
704 Ga0207708_10056420
705 Ga0207641_10229567
706 Ga0207641_11337324
707 Ga0207641_12009338
708 Ga0207641_12296102
709 Ga0207648_10082599
710 Ga0207648_10682771
711 Ga0207648_11109865
712 Ga0207648_11617759
713 Ga0207676_10312486
714 Ga0207676_10538421
715 Ga0207676_10952410
716 Ga0207674_10000247
717 Ga0207674_10000740
718 Ga0207674_10008925
719 Ga0207675_100001025
720 Ga0207675_100038284
721 Ga0207675_100540716
722 Ga0207683_10136639
723 Ga0207698_10673999
724 Ga0207698_10784131
725 Ga0207428_10304184
726 Ga0207428_10856991
727 Ga0268266_10000188
728 Ga0268265_10000988
729 Ga0268265_10012737
730 Ga0268264_10104635
731 Ga0268264_10277381
732 Ga0265762_1184075
733 Ga0307408_100009603
734 Ga0307405_10239554
735 Ga0307413_10068909
736 Ga0307413_10217724
737 Ga0307413_10297892
738 Ga0307413_10930731
739 Ga0307410_10423687
740 Ga0307410_10445693
741 Ga0307406_10018890
742 Ga0307407_10286339
743 Ga0307412_10084456
744 Ga0307409_100030725
745 Ga0307416_101430877
746 Ga0307416_101657738
747 Ga0307411_10090253
748 Ga0307411_10093113
749 Ga0307411_10158207
750 Ga0307411_10450363
751 Ga0373959_0103400
752 Ga0373926_0050433
753 Ga0373939_0277618
754 Ga0373943_0328363
755 Ga0373935_0152917
756 Ga0373927_0000639
757 Ga0373947_0284682
758 Ga0373947_0348137
759 Ga0395900_0196109
760 Ga0395905_0244895
761 Ga0395905_0287900
762 Ga0436363_0332337
763 Ga0450923_157981
764 Ga0453683_0185697
765 Ga0451576_0012304
766 Ga0451576_0312654
767 Ga0451576_0350234
768 Ga0451576_1986500
769 Ga0495580_0123363
770 Ga0495580_0181741
771 Ga0495582_0249068
772 Ga0495639_0155297
773 Ga0495666_0142881
774 Ga0495622_0086359
775 Ga0495634_0529607
776 Ga0495647_0103814
777 Ga0495658_0074083
778 Ga0495658_0952272
779 Ga0495669_0116083
780 Ga0495670_0258706
781 Ga0495670_0790485
782 Ga0495684_0695855
783 Ga0496101_0331433
784 Ga0496106_0073879
785 Ga0496106_0121533
786 Ga0496108_0227051
787 Ga0496109_0204541
788 Ga0496110_0118594
789 Ga0496112_0428161
790 Ga0496112_1610172
791 Ga0496114_0179637
792 Ga0501292_008151
793 Ga0501299_023730
794 Ga0501034_0056213
795 Ga0501041_1122003
796 Ga0501067_0346700
797 Ga0501075_0298327
798 Ga0501202_000018
799 Ga0501207_057378
800 Ga0501217_023595
801 Ga0501224_001026
802 Ga0501227_223739
803 Ga0501230_006215
804 Ga0501235_000038
805 Ga0501235_048449
806 Ga0501243_006132
807 Ga0501249_046651
808 Ga0501252_001877
809 Ga0501257_000394
810 Ga0501258_002661
811 Ga0501259_004500
812 Ga0501259_018202
813 Ga0501261_001362
814 Ga0501234_003296
815 Ga0501080_0335909
816 Ga0501081_0623313
817 Ga0501083_0000517
818 Ga0501266_002107
819 Ga0501268_001546
820 Ga0501268_018145
821 Ga0501269_025268
822 Ga0501270_000974
823 Ga0501276_043917
824 Ga0501035_1337695
825 Ga0501204_018205
826 Ga0501212_039881
827 nmdc:mga05p37_184487_c1
828 nmdc:mga05p37_37516_c1
829 nmdc:mga05p37_559039_c1
830 nmdc:mga09592_265436_c1
831 nmdc:mga09592_382440_c1
832 nmdc:mga0qj67_15148_c1
833 nmdc:mga0qj67_18830_c1
834 nmdc:mga0qj67_783755_c1
835 nmdc:mga06r32_1660921_c1
836 nmdc:mga06r32_9133_c1
837 nmdc:mga06r32_986954_c1
838 nmdc:mga08y16_126306_c1
839 nmdc:mga08y16_1667447_c1
840 nmdc:mga08y16_35564_c1
841 nmdc:mga08y16_559743_c1
842 nmdc:mga08y16_69126_c1
843 nmdc:mga0n895_124078_c1
844 nmdc:mga0n895_1511349_c1
845 nmdc:mga0n895_1828442_c1
846 nmdc:mga0n895_193169_c1
847 nmdc:mga0n895_36825_c1
848 nmdc:mga0n895_43881_c1
849 nmdc:mga0n895_551960_c1
850 nmdc:mga0n895_62934_c1
851 nmdc:mga0rr50_1647262_c1
852 nmdc:mga0rr50_311075_c1
853 nmdc:mga0rr50_43080_c1
854 nmdc:mga0rr50_456135_c1
855 nmdc:mga0rr50_613314_c1
856 nmdc:mga0rr50_6597_c1
857 nmdc:mga08x19_253157_c1
858 nmdc:mga08x19_258116_c1
859 nmdc:mga08x19_258749_c1
860 nmdc:mga08x19_40110_c1
861 nmdc:mga08x19_54911_c1
862 nmdc:mga08x19_61560_c1
863 nmdc:mga0a205_157531_c1
864 nmdc:mga0a205_17490_c1
865 nmdc:mga0a205_582549_c1
866 nmdc:mga0a205_83651_c1
867 Ga0500635_0446143
868 Ga0590077_033347
869 Ga0530510_0023305
870 Ga0530510_1463002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

71

145

0.93

PF00190

Cupin_1

Cupin

39

157

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9379 50 130
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.92 34 128
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9187 34 128
7zvy-assembly4.cif.gz_H thermococcus kadokarensis phosphomannose isomerase 0.9174 34 140
6l2f-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h54ah58a mutant) in copper (cu) substituted form 0.9166 34 128
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9195 35 130 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9117 35 141 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.909 34 129 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9069 48 141 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9053 48 130 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538NES1-F1-model_v4 Cupin domain-containing protein 0.9962 53 142
AF-A0A2V8CYI2-F1-model_v4 Cupin 0.9904 8 141
AF-A0A7Y2G8C9-F1-model_v4 Cupin domain-containing protein 0.9894 7 133
AF-A0A2V6I1H0-F1-model_v4 Cupin 0.9874 40 145
AF-A0A3D0D1A9-F1-model_v4 Cupin 0.9867 37 142

Map