F443008

General Info

Members Datasets Scaffolds Average Seq Length
434 254 868 114

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10716206|Ga0070676_107162061
Length 117
Sequence MSEPDSAGVAMTLDDYQRAALRTVNVSLDERDRLLDASAGLAEEAAEVLGLVRKRAFQGKDVDQSRLTEELGDVLWCLAVTAHTLGVSLSSVAAANQEKLARRHPDGFRPQRTELPL

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
183 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
244 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 17.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10716206 3300005328 Bacteria 732
2 JGI24750J21931_1026342 3300002070 Unclassified 837
3 Ga0065712_10517217 3300005290 Unclassified 638
4 Ga0070658_10371979 3300005327 Bacteria 1225
5 Ga0070683_100000429 3300005329 Bacteria 29152
6 Ga0070683_100060397 3300005329 Bacteria 3523
7 Ga0070683_100138183 3300005329 Bacteria 2308
8 Ga0070683_100634882 3300005329 Bacteria 1022
9 Ga0070683_100723325 3300005329 Bacteria 953
10 Ga0070683_101061789 3300005329 Bacteria 778
11 Ga0070690_100196476 3300005330 Bacteria 1401
12 Ga0070690_100642405 3300005330 Bacteria 810
13 Ga0070670_100006318 3300005331 Bacteria 10028
14 Ga0070670_101836800 3300005331 Unclassified 558
15 Ga0068869_100090077 3300005334 Bacteria 2305
16 Ga0070680_100000021 3300005336 Bacteria 81631
17 Ga0070680_101002636 3300005336 Bacteria 721
18 Ga0070680_101082731 3300005336 Bacteria 693
19 Ga0070682_100591306 3300005337 Bacteria 875
20 Ga0068868_100008914 3300005338 Bacteria 7192
21 Ga0068868_100124505 3300005338 Bacteria 2105
22 Ga0070660_100630043 3300005339 Unclassified 898
23 Ga0070660_100655026 3300005339 Bacteria 879
24 Ga0070689_102143442 3300005340 Unclassified 512
25 Ga0070687_100000885 3300005343 Bacteria 10079
26 Ga0070661_100004469 3300005344 Bacteria 9645
27 Ga0070661_100237659 3300005344 Bacteria 1402
28 Ga0070661_101071282 3300005344 Bacteria 671
29 Ga0070661_101222567 3300005344 Bacteria 629
30 Ga0070692_10013773 3300005345 Bacteria 3780
31 Ga0070668_100202025 3300005347 Bacteria 1632
32 Ga0070668_100268136 3300005347 Bacteria 1422
33 Ga0070668_100483485 3300005347 Unclassified 1069
34 Ga0070668_101227162 3300005347 Bacteria 680
35 Ga0070669_100000941 3300005353 Bacteria 21233
36 Ga0070669_100005286 3300005353 Bacteria 9323
37 Ga0070669_100013706 3300005353 Bacteria 5764
38 Ga0070669_101982143 3300005353 Unclassified 509
39 Ga0070675_100006039 3300005354 Bacteria 9279
40 Ga0070675_100008007 3300005354 Bacteria 8191
41 Ga0070675_100345893 3300005354 Bacteria 1318
42 Ga0070675_101670865 3300005354 Bacteria 588
43 Ga0070675_102009467 3300005354 Unclassified 533
44 Ga0070671_100853870 3300005355 Bacteria 794
45 Ga0070671_101747267 3300005355 Unclassified 552
46 Ga0070674_100920317 3300005356 Bacteria 763
47 Ga0070673_100064640 3300005364 Bacteria 2916
48 Ga0070673_100300020 3300005364 Bacteria 1414
49 Ga0070673_100371374 3300005364 Bacteria 1274
50 Ga0070673_100656092 3300005364 Bacteria 961
51 Ga0070688_100157864 3300005365 Bacteria 1556
52 Ga0070688_100206332 3300005365 Bacteria 1377
53 Ga0070659_100139962 3300005366 Unclassified 1970
54 Ga0070659_100633996 3300005366 Bacteria 920
55 Ga0070667_100076536 3300005367 Bacteria 2857
56 Ga0070667_100106770 3300005367 Bacteria 2424
57 Ga0070667_100211387 3300005367 Bacteria 1724
58 Ga0070667_101160370 3300005367 Bacteria 723
59 Ga0070703_10127629 3300005406 Unclassified 930
60 Ga0070709_10148254 3300005434 Bacteria 1619
61 Ga0070713_100013581 3300005436 Bacteria 6020
62 Ga0070710_10225050 3300005437 Bacteria 1195
63 Ga0070701_10050347 3300005438 Bacteria 2157
64 Ga0070701_10385872 3300005438 Bacteria 884
65 Ga0070711_100052528 3300005439 Bacteria 2804
66 Ga0070700_100040382 3300005441 Bacteria 2856
67 Ga0070694_100094323 3300005444 Bacteria 2105
68 Ga0070663_100165814 3300005455 Bacteria 1704
69 Ga0070678_100216486 3300005456 Bacteria 1590
70 Ga0070678_100400764 3300005456 Bacteria 1192
71 Ga0070662_100000191 3300005457 Bacteria 35697
72 Ga0070662_100138753 3300005457 Unclassified 1882
73 Ga0070681_10004560 3300005458 Bacteria 13214
74 Ga0070681_10954889 3300005458 Bacteria 776
75 Ga0070681_11440139 3300005458 Bacteria 613
76 Ga0068867_100633836 3300005459 Bacteria 936
77 Ga0068867_102168866 3300005459 Unclassified 527
78 Ga0070685_11397314 3300005466 Unclassified 537
79 Ga0070698_100744266 3300005471 Bacteria 923
80 Ga0070698_101101402 3300005471 Bacteria 743
81 Ga0070699_100250200 3300005518 Bacteria 1583
82 Ga0070699_101752288 3300005518 Unclassified 569
83 Ga0070679_100051156 3300005530 Bacteria 4114
84 Ga0070679_101409395 3300005530 Bacteria 643
85 Ga0070684_100006239 3300005535 Bacteria 9202
86 Ga0070684_100091107 3300005535 Bacteria 2712
87 Ga0070684_100284223 3300005535 Bacteria 1516
88 Ga0070684_100485710 3300005535 Unclassified 1143
89 Ga0070684_100621886 3300005535 Bacteria 1005
90 Ga0070684_100801130 3300005535 Bacteria 881
91 Ga0070697_101391724 3300005536 Unclassified 626
92 Ga0068853_100001877 3300005539 Bacteria 15477
93 Ga0070672_100127263 3300005543 Bacteria 2090
94 Ga0070672_101068162 3300005543 Bacteria 717
95 Ga0070686_100108260 3300005544 Bacteria 1889
96 Ga0070686_100516662 3300005544 Bacteria 929
97 Ga0070686_100679429 3300005544 Bacteria 819
98 Ga0070693_100011837 3300005547 Bacteria 4401
99 Ga0070665_102027427 3300005548 Unclassified 580
100 Ga0070665_102354642 3300005548 Unclassified 535
101 Ga0070704_100551466 3300005549 Bacteria 1007
102 Ga0068855_100438924 3300005563 Bacteria 1426
103 Ga0068855_102224470 3300005563 Bacteria 550
104 Ga0070664_100037690 3300005564 Bacteria 4066
105 Ga0070664_100098533 3300005564 Bacteria 2539
106 Ga0070664_100146748 3300005564 Unclassified 2081
107 Ga0070664_100222228 3300005564 Unclassified 1690
108 Ga0070664_100857196 3300005564 Bacteria 851
109 Ga0070664_101150887 3300005564 Bacteria 731
110 Ga0068857_100004761 3300005577 Bacteria 11491
111 Ga0068857_100169879 3300005577 Bacteria 1982
112 Ga0068857_100492986 3300005577 Bacteria 1149
113 Ga0068857_101224728 3300005577 Unclassified 727
114 Ga0068856_100408184 3300005614 Bacteria 1378
115 Ga0068856_100743566 3300005614 Bacteria 1001
116 Ga0070702_100923272 3300005615 Unclassified 685
117 Ga0068852_100005770 3300005616 Bacteria 8884
118 Ga0068852_100056285 3300005616 Bacteria 3398
119 Ga0068852_101087661 3300005616 Unclassified 820
120 Ga0068852_101996265 3300005616 Unclassified 602
121 Ga0068859_100171697 3300005617 Bacteria 2249
122 Ga0068859_100303832 3300005617 Bacteria 1689
123 Ga0068859_102102596 3300005617 Unclassified 623
124 Ga0068864_102296444 3300005618 Unclassified 546
125 Ga0068861_100002802 3300005719 Bacteria 11458
126 Ga0068861_100016065 3300005719 Bacteria 5286
127 Ga0068870_10084627 3300005840 Bacteria 1761
128 Ga0068870_10094622 3300005840 Unclassified 1677
129 Ga0068863_100449502 3300005841 Bacteria 1265
130 Ga0068862_100000624 3300005844 Bacteria 36787
131 Ga0068862_100013070 3300005844 Bacteria 6867
132 Ga0068862_100087002 3300005844 Bacteria 2717
133 Ga0070717_11232388 3300006028 Bacteria 681
134 Ga0075432_10136348 3300006058 Unclassified 933
135 Ga0070716_100227332 3300006173 Bacteria 1257
136 Ga0070712_100908489 3300006175 Bacteria 759
137 Ga0097621_100726923 3300006237 Bacteria 916
138 Ga0075428_100570127 3300006844 Bacteria 1210
139 Ga0075428_100622662 3300006844 Bacteria 1152
140 Ga0075428_100806092 3300006844 Unclassified 998
141 Ga0075430_100007663 3300006846 Bacteria 9118
142 Ga0075431_100073687 3300006847 Bacteria 3523
143 Ga0075431_100189333 3300006847 Bacteria 2109
144 Ga0075431_101112156 3300006847 Bacteria 754
145 Ga0075433_10022901 3300006852 Bacteria 5250
146 Ga0075429_100054052 3300006880 Bacteria 3494
147 Ga0075429_100326087 3300006880 Bacteria 1344
148 Ga0075429_100445715 3300006880 Bacteria 1134
149 Ga0068865_100466183 3300006881 Bacteria 1047
150 Ga0097620_100171700 3300006931 Bacteria 2249
151 Ga0097620_100303818 3300006931 Bacteria 1689
152 Ga0097620_101181114 3300006931 Bacteria 842
153 Ga0097620_102101985 3300006931 Unclassified 623
154 Ga0105240_10362673 3300009093 Bacteria 1641
155 Ga0105240_10495688 3300009093 Bacteria 1359
156 Ga0111539_10027037 3300009094 Bacteria 7008
157 Ga0111539_10701062 3300009094 Bacteria 1178
158 Ga0111539_11768442 3300009094 Unclassified 717
159 Ga0105245_10339548 3300009098 Bacteria 1485
160 Ga0105247_10565239 3300009101 Unclassified 838
161 Ga0114129_10072834 3300009147 Bacteria 4788
162 Ga0114129_10388174 3300009147 Bacteria 1842
163 Ga0105243_10094470 3300009148 Bacteria 2469
164 Ga0105243_11009000 3300009148 Bacteria 835
165 Ga0105241_10083736 3300009174 Bacteria 2503
166 Ga0105242_11421946 3300009176 Bacteria 722
167 Ga0105242_12821871 3300009176 Bacteria 536
168 Ga0105248_10181340 3300009177 Bacteria 2373
169 Ga0105248_10221236 3300009177 Bacteria 2131
170 Ga0105248_11029291 3300009177 Bacteria 930
171 Ga0105237_10371653 3300009545 Bacteria 1434
172 Ga0105237_11446007 3300009545 Unclassified 694
173 Ga0105238_10085575 3300009551 Bacteria 3140
174 Ga0105238_11304860 3300009551 Bacteria 752
175 Ga0105249_10000311 3300009553 Bacteria 49293
176 Ga0105249_10010338 3300009553 Bacteria 8203
177 Ga0105249_10497472 3300009553 Bacteria 1264
178 Ga0105246_10629626 3300011119 Bacteria 931
179 Ga0105246_10793115 3300011119 Bacteria 840
180 Ga0157325_1000696 3300012485 Unclassified 1391
181 Ga0157373_10665028 3300013100 Unclassified 761
182 Ga0157371_10038302 3300013102 Bacteria 3431
183 Ga0157370_10086221 3300013104 Bacteria 2950
184 Ga0157370_10744544 3300013104 Bacteria 893
185 Ga0157369_10595362 3300013105 Bacteria 1141
186 Ga0157369_11942665 3300013105 Unclassified 597
187 Ga0157374_10942045 3300013296 Bacteria 882
188 Ga0157378_10367811 3300013297 Bacteria 1409
189 Ga0157378_10488140 3300013297 Bacteria 1228
190 Ga0163162_10003422 3300013306 Bacteria 15149
191 Ga0163162_10147728 3300013306 Bacteria 2467
192 Ga0163162_10451163 3300013306 Bacteria 1418
193 Ga0157372_10107494 3300013307 Bacteria 3192
194 Ga0157372_10666374 3300013307 Unclassified 1211
195 Ga0157372_12490963 3300013307 Bacteria 594
196 Ga0157372_12587368 3300013307 Bacteria 582
197 Ga0157375_10013112 3300013308 Bacteria 7366
198 Ga0157375_10681119 3300013308 Bacteria 1183
199 Ga0157375_10703889 3300013308 Unclassified 1164
200 Ga0163163_12640460 3300014325 Unclassified 560
201 Ga0157380_10015445 3300014326 Bacteria 5613
202 Ga0157380_10055267 3300014326 Bacteria 3152
203 Ga0157377_10004654 3300014745 Bacteria 6347
204 Ga0157377_10379823 3300014745 Unclassified 956
205 Ga0157377_11124883 3300014745 Bacteria 603
206 Ga0157379_10009451 3300014968 Bacteria 8496
207 Ga0157376_10146953 3300014969 Bacteria 2121
208 Ga0157376_10864851 3300014969 Unclassified 920
209 Ga0182007_10035475 3300015262 Bacteria 1681
210 Ga0182005_1174833 3300015265 Unclassified 635
211 Ga0163161_10377272 3300017792 Bacteria 1133
212 Ga0213876_10093368 3300021384 Unclassified 1594
213 Ga0207697_10003966 3300025315 Bacteria 7192
214 Ga0207697_10175814 3300025315 Bacteria 937
215 Ga0207682_10141360 3300025893 Bacteria 1080
216 Ga0207692_10400907 3300025898 Bacteria 855
217 Ga0207688_10044632 3300025901 Bacteria 2470
218 Ga0207647_10021611 3300025904 Bacteria 4294
219 Ga0207699_10032395 3300025906 Bacteria 2945
220 Ga0207645_10698269 3300025907 Bacteria 690
221 Ga0207643_10005456 3300025908 Bacteria 6801
222 Ga0207643_10035720 3300025908 Bacteria 2787
223 Ga0207643_10516921 3300025908 Unclassified 764
224 Ga0207654_10262257 3300025911 Bacteria 1162
225 Ga0207707_10002215 3300025912 Bacteria 17569
226 Ga0207707_10192476 3300025912 Bacteria 1779
227 Ga0207671_10757118 3300025914 Bacteria 771
228 Ga0207671_10789825 3300025914 Bacteria 753
229 Ga0207693_10010920 3300025915 Bacteria 7362
230 Ga0207663_10275414 3300025916 Bacteria 1248
231 Ga0207660_10000239 3300025917 Bacteria 35581
232 Ga0207662_10000528 3300025918 Bacteria 16985
233 Ga0207657_10030833 3300025919 Bacteria 4860
234 Ga0207657_10408846 3300025919 Unclassified 1067
235 Ga0207649_10002714 3300025920 Bacteria 9807
236 Ga0207649_10210901 3300025920 Bacteria 1378
237 Ga0207652_10125927 3300025921 Bacteria 2282
238 Ga0207652_10985674 3300025921 Bacteria 741
239 Ga0207681_10001449 3300025923 Bacteria 15269
240 Ga0207681_10002420 3300025923 Bacteria 11837
241 Ga0207681_10221239 3300025923 Bacteria 1465
242 Ga0207681_11023446 3300025923 Bacteria 693
243 Ga0207694_10669000 3300025924 Bacteria 875
244 Ga0207650_10030455 3300025925 Bacteria 3887
245 Ga0207650_10238321 3300025925 Bacteria 1469
246 Ga0207650_10346720 3300025925 Bacteria 1221
247 Ga0207650_10609763 3300025925 Bacteria 918
248 Ga0207650_11043532 3300025925 Unclassified 695
249 Ga0207659_10010368 3300025926 Bacteria 5855
250 Ga0207659_11322763 3300025926 Unclassified 618
251 Ga0207687_10560559 3300025927 Bacteria 959
252 Ga0207700_10255198 3300025928 Bacteria 1499
253 Ga0207644_10319270 3300025931 Bacteria 1256
254 Ga0207644_11233214 3300025931 Unclassified 629
255 Ga0207690_10026790 3300025932 Bacteria 3634
256 Ga0207690_10222884 3300025932 Bacteria 1444
257 Ga0207706_10140006 3300025933 Unclassified 2128
258 Ga0207706_10170275 3300025933 Bacteria 1914
259 Ga0207686_10172843 3300025934 Bacteria 1525
260 Ga0207709_10451949 3300025935 Bacteria 993
261 Ga0207709_10751680 3300025935 Bacteria 784
262 Ga0207670_10951068 3300025936 Bacteria 721
263 Ga0207704_10043234 3300025938 Bacteria 2658
264 Ga0207665_10067086 3300025939 Bacteria 2443
265 Ga0207691_10000771 3300025940 Bacteria 31707
266 Ga0207691_10418723 3300025940 Bacteria 1142
267 Ga0207661_10000363 3300025944 Bacteria 29142
268 Ga0207661_10086637 3300025944 Bacteria 2600
269 Ga0207661_10241207 3300025944 Unclassified 1604
270 Ga0207661_10375410 3300025944 Bacteria 1286
271 Ga0207661_10753195 3300025944 Bacteria 896
272 Ga0207679_10002542 3300025945 Bacteria 11248
273 Ga0207679_10069019 3300025945 Bacteria 2658
274 Ga0207679_10069539 3300025945 Bacteria 2650
275 Ga0207679_10105677 3300025945 Bacteria 2211
276 Ga0207679_10158326 3300025945 Unclassified 1851
277 Ga0207679_10191235 3300025945 Unclassified 1702
278 Ga0207679_11749760 3300025945 Bacteria 568
279 Ga0207679_12036886 3300025945 Bacteria 522
280 Ga0207667_10529929 3300025949 Unclassified 1193
281 Ga0207651_10016808 3300025960 Bacteria 4301
282 Ga0207712_10001511 3300025961 Bacteria 15779
283 Ga0207712_10193261 3300025961 Bacteria 1608
284 Ga0207712_12102936 3300025961 Unclassified 505
285 Ga0207658_10458136 3300025986 Bacteria 1130
286 Ga0207677_10316369 3300026023 Unclassified 1295
287 Ga0207703_10012695 3300026035 Bacteria 6568
288 Ga0207678_10007215 3300026067 Bacteria 9853
289 Ga0207708_10034543 3300026075 Bacteria 3845
290 Ga0207702_10543935 3300026078 Bacteria 1135
291 Ga0207702_11144032 3300026078 Bacteria 772
292 Ga0207641_10303018 3300026088 Bacteria 1510
293 Ga0207641_11019766 3300026088 Bacteria 825
294 Ga0207648_10120894 3300026089 Bacteria 2303
295 Ga0207676_11393322 3300026095 Viruses 697
296 Ga0207674_10109010 3300026116 Bacteria 2745
297 Ga0207674_10192986 3300026116 Bacteria 1987
298 Ga0207674_10523437 3300026116 Bacteria 1145
299 Ga0207683_10100676 3300026121 Bacteria 2580
300 Ga0207683_10277272 3300026121 Bacteria 1532
301 Ga0207683_11931355 3300026121 Unclassified 539
302 Ga0207698_10467977 3300026142 Unclassified 1220
303 Ga0207698_10806628 3300026142 Bacteria 941
304 Ga0207428_10137359 3300027907 Unclassified 1868
305 Ga0268266_10882359 3300028379 Unclassified 865
306 Ga0268266_11743365 3300028379 Unclassified 598
307 Ga0268265_10005280 3300028380 Bacteria 8845
308 Ga0268264_11561628 3300028381 Bacteria 671
309 Ga0307407_10307287 3300031903 Bacteria 1108
310 Ga0307409_100171506 3300031995 Bacteria 1910
311 Ga0307416_100629187 3300032002 Bacteria 1156
312 Ga0307416_100648720 3300032002 Bacteria 1140
313 Ga0307411_11582947 3300032005 Unclassified 604
314 Ga0307411_11761169 3300032005 Bacteria 574
315 Ga0373926_0014251 3300035083 Bacteria 2701
316 Ga0373923_0026703 3300035111 Bacteria 2299
317 Ga0373945_0190288 3300035116 Bacteria 848
318 Ga0373954_0101499 3300035118 Bacteria 1388
319 Ga0373956_0146127 3300035119 Bacteria 1111
320 Ga0373943_0010873 3300035170 Bacteria 4087
321 Ga0373946_0001801 3300035171 Bacteria 7472
322 Ga0373955_0103746 3300035172 Bacteria 1635
323 Ga0373924_0315417 3300035410 Bacteria 695
324 Ga0373931_0087388 3300035691 Bacteria 1731
325 Ga0373935_0022319 3300035692 Bacteria 3880
326 Ga0373927_0010470 3300035695 Bacteria 6182
327 Ga0373927_0744614 3300035695 Unclassified 647
328 Ga0373947_0021638 3300035725 Bacteria 3723
329 Ga0373947_0359935 3300035725 Bacteria 977
330 Ga0373947_0628111 3300035725 Unclassified 732
331 Ga0373937_0066792 3300036401 Bacteria 3312
332 Ga0373925_0001110 3300037068 Bacteria 23981
333 Ga0373925_0098960 3300037068 Bacteria 2239
334 Ga0395905_0310650 3300037471 Bacteria 1465
335 Ga0436365_0474638 3300039437 Bacteria 1263
336 Ga0436365_0505012 3300039437 Bacteria 1916
337 Ga0436365_0745434 3300039437 Bacteria 5498
338 Ga0436365_1903196 3300039437 Unclassified 1500
339 Ga0451839_0466617 3300041496 Bacteria 622
340 Ga0439433_0113978 3300041999 Bacteria 678
341 Ga0439448_0071744 3300042005 Bacteria 1154
342 Ga0439440_0067469 3300042993 Bacteria 925
343 Ga0466969_0352649 3300044656 Unclassified 666
344 Ga0453683_0645040 3300044673 Unclassified 692
345 Ga0451576_0325689 3300045051 Bacteria 1608
346 Ga0466958_0169778 3300045836 Bacteria 1381
347 Ga0466967_0322357 3300045976 Bacteria 1490
348 Ga0466967_1352041 3300045976 Unclassified 709
349 Ga0495617_153164 3300046452 Bacteria 733
350 Ga0495603_0013242 3300046455 Bacteria 4986
351 Ga0495629_0015423 3300046459 Bacteria 5487
352 Ga0495629_0247749 3300046459 Unclassified 1226
353 Ga0495641_0422931 3300046461 Bacteria 605
354 Ga0495651_0031427 3300046462 Bacteria 4140
355 Ga0495653_0046940 3300046463 Bacteria 3342
356 Ga0495580_0019920 3300046472 Bacteria 4974
357 Ga0495580_0147048 3300046472 Bacteria 1633
358 Ga0495582_0013895 3300046473 Bacteria 4434
359 Ga0495582_0398677 3300046473 Unclassified 793
360 Ga0495639_0000399 3300046475 Bacteria 20590
361 Ga0495639_0081078 3300046475 Bacteria 1511
362 Ga0495664_0130701 3300046477 Unclassified 1520
363 Ga0495594_0047751 3300046499 Bacteria 2351
364 Ga0495594_0837203 3300046499 Unclassified 518
365 Ga0495608_0061372 3300046511 Bacteria 2472
366 Ga0495628_0030747 3300046516 Bacteria 4347
367 Ga0495630_0006161 3300046517 Bacteria 8506
368 Ga0495630_0015795 3300046517 Bacteria 5517
369 Ga0495652_0124391 3300046529 Bacteria 2051
370 Ga0495665_0000024 3300046531 Bacteria 59245
371 Ga0495665_0561748 3300046531 Unclassified 572
372 Ga0495586_0582499 3300046535 Bacteria 646
373 Ga0495586_0777876 3300046535 Unclassified 552
374 Ga0495587_0005234 3300046536 Bacteria 8479
375 Ga0495645_0020448 3300046543 Bacteria 4775
376 Ga0495635_0690194 3300046663 Unclassified 662
377 Ga0495588_0046369 3300046674 Bacteria 2229
378 Ga0495588_0052432 3300046674 Bacteria 2103
379 Ga0495599_0005362 3300046678 Bacteria 7654
380 Ga0495623_0018822 3300046679 Bacteria 4458
381 Ga0495646_0030582 3300046680 Bacteria 3362
382 Ga0495658_0000169 3300046683 Bacteria 37045
383 Ga0495658_0071243 3300046683 Bacteria 2019
384 Ga0495613_0016821 3300046689 Bacteria 5446
385 Ga0495600_0147069 3300046809 Bacteria 1527
386 Ga0495581_0003860 3300047315 Bacteria 8624
387 Ga0495581_0079267 3300047315 Bacteria 1900
388 Ga0495604_0021747 3300047317 Bacteria 5121
389 Ga0495674_0133234 3300047319 Bacteria 2093
390 Ga0495672_0018791 3300047320 Bacteria 4577
391 Ga0495680_0261207 3300047322 Bacteria 1225
392 Ga0495675_0054807 3300047444 Bacteria 2530
393 Ga0495684_0017309 3300047471 Bacteria 5548
394 Ga0495684_0071025 3300047471 Bacteria 2646
395 Ga0495684_0081081 3300047471 Bacteria 2463
396 Ga0495684_1000110 3300047471 Unclassified 531
397 Ga0495593_0039863 3300047673 Bacteria 2530
398 Ga0495593_0326501 3300047673 Unclassified 767
399 Ga0495602_0031143 3300048088 Bacteria 5047
400 Ga0495614_0000001 3300048089 Bacteria 137656
401 Ga0496106_0195268 3300048909 Bacteria 1610
402 Ga0496108_0256730 3300048911 Bacteria 1521
403 Ga0496109_0215662 3300048912 Bacteria 1805
404 Ga0501298_043032 3300049521 Bacteria 920
405 Ga0501033_0255366 3300049570 Bacteria 1241
406 Ga0501034_0391718 3300049571 Bacteria 1313
407 Ga0501036_0029031 3300049572 Bacteria 4675
408 Ga0501037_0815692 3300049573 Bacteria 615
409 Ga0501037_0857105 3300049573 Bacteria 597
410 Ga0501038_0167075 3300049574 Bacteria 1784
411 Ga0501038_0960247 3300049574 Bacteria 629
412 Ga0501043_0159730 3300049579 Bacteria 1761
413 Ga0501047_0029408 3300049581 Bacteria 5299
414 Ga0501069_0066099 3300049585 Bacteria 2022
415 Ga0501070_0299852 3300049586 Bacteria 1309
416 Ga0501073_0004751 3300049589 Bacteria 10197
417 Ga0501074_0728029 3300049590 Bacteria 700
418 Ga0501252_016415 3300049682 Bacteria 932
419 Ga0501268_084781 3300049765 Bacteria 659
420 Ga0501044_0007109 3300049823 Bacteria 12312
421 nmdc:mga05p37_210478_c1 3300050507 Bacteria 2351
422 nmdc:mga09592_1158886_c1 3300050508 Bacteria 640
423 nmdc:mga09592_462018_c1 3300050508 Bacteria 1095
424 nmdc:mga06r32_157865_c1 3300050510 Bacteria 2250
425 nmdc:mga06r32_197542_c1 3300050510 Bacteria 1999
426 nmdc:mga06r32_876584_c1 3300050510 Bacteria 855
427 nmdc:mga08y16_340808_c1 3300050511 Bacteria 1541
428 nmdc:mga0n895_117518_c1 3300050512 Bacteria 2679
429 nmdc:mga0n895_3606_c1 3300050512 Bacteria 12517
430 nmdc:mga0a205_313048_c1 3300050515 Bacteria 1442
431 nmdc:mga0a205_82041_c1 3300050515 Bacteria 3115
432 Ga0495601_0311914 3300053077 Bacteria 1024
433 Ga0495612_0006754 3300053078 Bacteria 4700
434 Ga0495619_0222190 3300053085 Bacteria 1308
435 Ga0070676_10716206
436 JGI24750J21931_1026342
437 Ga0065712_10517217
438 Ga0070658_10371979
439 Ga0070683_100000429
440 Ga0070683_100060397
441 Ga0070683_100138183
442 Ga0070683_100634882
443 Ga0070683_100723325
444 Ga0070683_101061789
445 Ga0070690_100196476
446 Ga0070690_100642405
447 Ga0070670_100006318
448 Ga0070670_101836800
449 Ga0068869_100090077
450 Ga0070680_100000021
451 Ga0070680_101002636
452 Ga0070680_101082731
453 Ga0070682_100591306
454 Ga0068868_100008914
455 Ga0068868_100124505
456 Ga0070660_100630043
457 Ga0070660_100655026
458 Ga0070689_102143442
459 Ga0070687_100000885
460 Ga0070661_100004469
461 Ga0070661_100237659
462 Ga0070661_101071282
463 Ga0070661_101222567
464 Ga0070692_10013773
465 Ga0070668_100202025
466 Ga0070668_100268136
467 Ga0070668_100483485
468 Ga0070668_101227162
469 Ga0070669_100000941
470 Ga0070669_100005286
471 Ga0070669_100013706
472 Ga0070669_101982143
473 Ga0070675_100006039
474 Ga0070675_100008007
475 Ga0070675_100345893
476 Ga0070675_101670865
477 Ga0070675_102009467
478 Ga0070671_100853870
479 Ga0070671_101747267
480 Ga0070674_100920317
481 Ga0070673_100064640
482 Ga0070673_100300020
483 Ga0070673_100371374
484 Ga0070673_100656092
485 Ga0070688_100157864
486 Ga0070688_100206332
487 Ga0070659_100139962
488 Ga0070659_100633996
489 Ga0070667_100076536
490 Ga0070667_100106770
491 Ga0070667_100211387
492 Ga0070667_101160370
493 Ga0070703_10127629
494 Ga0070709_10148254
495 Ga0070713_100013581
496 Ga0070710_10225050
497 Ga0070701_10050347
498 Ga0070701_10385872
499 Ga0070711_100052528
500 Ga0070700_100040382
501 Ga0070694_100094323
502 Ga0070663_100165814
503 Ga0070678_100216486
504 Ga0070678_100400764
505 Ga0070662_100000191
506 Ga0070662_100138753
507 Ga0070681_10004560
508 Ga0070681_10954889
509 Ga0070681_11440139
510 Ga0068867_100633836
511 Ga0068867_102168866
512 Ga0070685_11397314
513 Ga0070698_100744266
514 Ga0070698_101101402
515 Ga0070699_100250200
516 Ga0070699_101752288
517 Ga0070679_100051156
518 Ga0070679_101409395
519 Ga0070684_100006239
520 Ga0070684_100091107
521 Ga0070684_100284223
522 Ga0070684_100485710
523 Ga0070684_100621886
524 Ga0070684_100801130
525 Ga0070697_101391724
526 Ga0068853_100001877
527 Ga0070672_100127263
528 Ga0070672_101068162
529 Ga0070686_100108260
530 Ga0070686_100516662
531 Ga0070686_100679429
532 Ga0070693_100011837
533 Ga0070665_102027427
534 Ga0070665_102354642
535 Ga0070704_100551466
536 Ga0068855_100438924
537 Ga0068855_102224470
538 Ga0070664_100037690
539 Ga0070664_100098533
540 Ga0070664_100146748
541 Ga0070664_100222228
542 Ga0070664_100857196
543 Ga0070664_101150887
544 Ga0068857_100004761
545 Ga0068857_100169879
546 Ga0068857_100492986
547 Ga0068857_101224728
548 Ga0068856_100408184
549 Ga0068856_100743566
550 Ga0070702_100923272
551 Ga0068852_100005770
552 Ga0068852_100056285
553 Ga0068852_101087661
554 Ga0068852_101996265
555 Ga0068859_100171697
556 Ga0068859_100303832
557 Ga0068859_102102596
558 Ga0068864_102296444
559 Ga0068861_100002802
560 Ga0068861_100016065
561 Ga0068870_10084627
562 Ga0068870_10094622
563 Ga0068863_100449502
564 Ga0068862_100000624
565 Ga0068862_100013070
566 Ga0068862_100087002
567 Ga0070717_11232388
568 Ga0075432_10136348
569 Ga0070716_100227332
570 Ga0070712_100908489
571 Ga0097621_100726923
572 Ga0075428_100570127
573 Ga0075428_100622662
574 Ga0075428_100806092
575 Ga0075430_100007663
576 Ga0075431_100073687
577 Ga0075431_100189333
578 Ga0075431_101112156
579 Ga0075433_10022901
580 Ga0075429_100054052
581 Ga0075429_100326087
582 Ga0075429_100445715
583 Ga0068865_100466183
584 Ga0097620_100171700
585 Ga0097620_100303818
586 Ga0097620_101181114
587 Ga0097620_102101985
588 Ga0105240_10362673
589 Ga0105240_10495688
590 Ga0111539_10027037
591 Ga0111539_10701062
592 Ga0111539_11768442
593 Ga0105245_10339548
594 Ga0105247_10565239
595 Ga0114129_10072834
596 Ga0114129_10388174
597 Ga0105243_10094470
598 Ga0105243_11009000
599 Ga0105241_10083736
600 Ga0105242_11421946
601 Ga0105242_12821871
602 Ga0105248_10181340
603 Ga0105248_10221236
604 Ga0105248_11029291
605 Ga0105237_10371653
606 Ga0105237_11446007
607 Ga0105238_10085575
608 Ga0105238_11304860
609 Ga0105249_10000311
610 Ga0105249_10010338
611 Ga0105249_10497472
612 Ga0105246_10629626
613 Ga0105246_10793115
614 Ga0157325_1000696
615 Ga0157373_10665028
616 Ga0157371_10038302
617 Ga0157370_10086221
618 Ga0157370_10744544
619 Ga0157369_10595362
620 Ga0157369_11942665
621 Ga0157374_10942045
622 Ga0157378_10367811
623 Ga0157378_10488140
624 Ga0163162_10003422
625 Ga0163162_10147728
626 Ga0163162_10451163
627 Ga0157372_10107494
628 Ga0157372_10666374
629 Ga0157372_12490963
630 Ga0157372_12587368
631 Ga0157375_10013112
632 Ga0157375_10681119
633 Ga0157375_10703889
634 Ga0163163_12640460
635 Ga0157380_10015445
636 Ga0157380_10055267
637 Ga0157377_10004654
638 Ga0157377_10379823
639 Ga0157377_11124883
640 Ga0157379_10009451
641 Ga0157376_10146953
642 Ga0157376_10864851
643 Ga0182007_10035475
644 Ga0182005_1174833
645 Ga0163161_10377272
646 Ga0213876_10093368
647 Ga0207697_10003966
648 Ga0207697_10175814
649 Ga0207682_10141360
650 Ga0207692_10400907
651 Ga0207688_10044632
652 Ga0207647_10021611
653 Ga0207699_10032395
654 Ga0207645_10698269
655 Ga0207643_10005456
656 Ga0207643_10035720
657 Ga0207643_10516921
658 Ga0207654_10262257
659 Ga0207707_10002215
660 Ga0207707_10192476
661 Ga0207671_10757118
662 Ga0207671_10789825
663 Ga0207693_10010920
664 Ga0207663_10275414
665 Ga0207660_10000239
666 Ga0207662_10000528
667 Ga0207657_10030833
668 Ga0207657_10408846
669 Ga0207649_10002714
670 Ga0207649_10210901
671 Ga0207652_10125927
672 Ga0207652_10985674
673 Ga0207681_10001449
674 Ga0207681_10002420
675 Ga0207681_10221239
676 Ga0207681_11023446
677 Ga0207694_10669000
678 Ga0207650_10030455
679 Ga0207650_10238321
680 Ga0207650_10346720
681 Ga0207650_10609763
682 Ga0207650_11043532
683 Ga0207659_10010368
684 Ga0207659_11322763
685 Ga0207687_10560559
686 Ga0207700_10255198
687 Ga0207644_10319270
688 Ga0207644_11233214
689 Ga0207690_10026790
690 Ga0207690_10222884
691 Ga0207706_10140006
692 Ga0207706_10170275
693 Ga0207686_10172843
694 Ga0207709_10451949
695 Ga0207709_10751680
696 Ga0207670_10951068
697 Ga0207704_10043234
698 Ga0207665_10067086
699 Ga0207691_10000771
700 Ga0207691_10418723
701 Ga0207661_10000363
702 Ga0207661_10086637
703 Ga0207661_10241207
704 Ga0207661_10375410
705 Ga0207661_10753195
706 Ga0207679_10002542
707 Ga0207679_10069019
708 Ga0207679_10069539
709 Ga0207679_10105677
710 Ga0207679_10158326
711 Ga0207679_10191235
712 Ga0207679_11749760
713 Ga0207679_12036886
714 Ga0207667_10529929
715 Ga0207651_10016808
716 Ga0207712_10001511
717 Ga0207712_10193261
718 Ga0207712_12102936
719 Ga0207658_10458136
720 Ga0207677_10316369
721 Ga0207703_10012695
722 Ga0207678_10007215
723 Ga0207708_10034543
724 Ga0207702_10543935
725 Ga0207702_11144032
726 Ga0207641_10303018
727 Ga0207641_11019766
728 Ga0207648_10120894
729 Ga0207676_11393322
730 Ga0207674_10109010
731 Ga0207674_10192986
732 Ga0207674_10523437
733 Ga0207683_10100676
734 Ga0207683_10277272
735 Ga0207683_11931355
736 Ga0207698_10467977
737 Ga0207698_10806628
738 Ga0207428_10137359
739 Ga0268266_10882359
740 Ga0268266_11743365
741 Ga0268265_10005280
742 Ga0268264_11561628
743 Ga0307407_10307287
744 Ga0307409_100171506
745 Ga0307416_100629187
746 Ga0307416_100648720
747 Ga0307411_11582947
748 Ga0307411_11761169
749 Ga0373926_0014251
750 Ga0373923_0026703
751 Ga0373945_0190288
752 Ga0373954_0101499
753 Ga0373956_0146127
754 Ga0373943_0010873
755 Ga0373946_0001801
756 Ga0373955_0103746
757 Ga0373924_0315417
758 Ga0373931_0087388
759 Ga0373935_0022319
760 Ga0373927_0010470
761 Ga0373927_0744614
762 Ga0373947_0021638
763 Ga0373947_0359935
764 Ga0373947_0628111
765 Ga0373937_0066792
766 Ga0373925_0001110
767 Ga0373925_0098960
768 Ga0395905_0310650
769 Ga0436365_0474638
770 Ga0436365_0505012
771 Ga0436365_0745434
772 Ga0436365_1903196
773 Ga0451839_0466617
774 Ga0439433_0113978
775 Ga0439448_0071744
776 Ga0439440_0067469
777 Ga0466969_0352649
778 Ga0453683_0645040
779 Ga0451576_0325689
780 Ga0466958_0169778
781 Ga0466967_0322357
782 Ga0466967_1352041
783 Ga0495617_153164
784 Ga0495603_0013242
785 Ga0495629_0015423
786 Ga0495629_0247749
787 Ga0495641_0422931
788 Ga0495651_0031427
789 Ga0495653_0046940
790 Ga0495580_0019920
791 Ga0495580_0147048
792 Ga0495582_0013895
793 Ga0495582_0398677
794 Ga0495639_0000399
795 Ga0495639_0081078
796 Ga0495664_0130701
797 Ga0495594_0047751
798 Ga0495594_0837203
799 Ga0495608_0061372
800 Ga0495628_0030747
801 Ga0495630_0006161
802 Ga0495630_0015795
803 Ga0495652_0124391
804 Ga0495665_0000024
805 Ga0495665_0561748
806 Ga0495586_0582499
807 Ga0495586_0777876
808 Ga0495587_0005234
809 Ga0495645_0020448
810 Ga0495635_0690194
811 Ga0495588_0046369
812 Ga0495588_0052432
813 Ga0495599_0005362
814 Ga0495623_0018822
815 Ga0495646_0030582
816 Ga0495658_0000169
817 Ga0495658_0071243
818 Ga0495613_0016821
819 Ga0495600_0147069
820 Ga0495581_0003860
821 Ga0495581_0079267
822 Ga0495604_0021747
823 Ga0495674_0133234
824 Ga0495672_0018791
825 Ga0495680_0261207
826 Ga0495675_0054807
827 Ga0495684_0017309
828 Ga0495684_0071025
829 Ga0495684_0081081
830 Ga0495684_1000110
831 Ga0495593_0039863
832 Ga0495593_0326501
833 Ga0495602_0031143
834 Ga0495614_0000001
835 Ga0496106_0195268
836 Ga0496108_0256730
837 Ga0496109_0215662
838 Ga0501298_043032
839 Ga0501033_0255366
840 Ga0501034_0391718
841 Ga0501036_0029031
842 Ga0501037_0815692
843 Ga0501037_0857105
844 Ga0501038_0167075
845 Ga0501038_0960247
846 Ga0501043_0159730
847 Ga0501047_0029408
848 Ga0501069_0066099
849 Ga0501070_0299852
850 Ga0501073_0004751
851 Ga0501074_0728029
852 Ga0501252_016415
853 Ga0501268_084781
854 Ga0501044_0007109
855 nmdc:mga05p37_210478_c1
856 nmdc:mga09592_1158886_c1
857 nmdc:mga09592_462018_c1
858 nmdc:mga06r32_157865_c1
859 nmdc:mga06r32_197542_c1
860 nmdc:mga06r32_876584_c1
861 nmdc:mga08y16_340808_c1
862 nmdc:mga0n895_117518_c1
863 nmdc:mga0n895_3606_c1
864 nmdc:mga0a205_313048_c1
865 nmdc:mga0a205_82041_c1
866 Ga0495601_0311914
867 Ga0495612_0006754
868 Ga0495619_0222190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

34

108

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n2u-assembly1.cif.gz_Lc elongating 70s ribosome complex in a hybrid-h1 pre-translocation (pre-h1) conformation 0.829 27 84
6qul-assembly1.cif.gz_Z structure of a bacterial 50s ribosomal subunit in complex with the novel quinoxolidinone antibiotic cadazolid 0.8221 27 84
7q4k-assembly1.cif.gz_BY erythromycin-stalled escherichia coli 70s ribosome with streptococcal msrdl nascent chain 0.8217 27 84
5gad-assembly1.cif.gz_Z rnc-srp-sr complex early state 0.8049 27 84
1vmg-assembly1.cif.gz_A crystal structure of mazg nucleotide pyrophosphohydrolase (13816655) from sulfolobus solfataricus at 1.46 a resolution 0.7958 8 102
ID Description Score Start End Superfamily
af_Q2FWT1_1_150_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9344 8 103 1.10.287.1080
af_A0A1D6LXE9_59_175_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8277 27 81 1.10.287.70
af_A0A1D6QHG9_748_861_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8257 27 81 1.10.287.70
af_A0A0P0WVH4_174_287_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8065 27 81 1.20.140.150
5ie9B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.789 8 97 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A1C3NTH5-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9485 9 106
AF-A0A7W1EKJ7-F1-model_v4 Nucleotide pyrophosphohydrolase 0.946 2 106 GO:0016787
AF-A0A6B5D7Q1-F1-model_v4 deleted 0.9398 8 103
AF-A0A2V7SSY9-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9352 1 102 GO:0016787
AF-A0A0R1FRU3-F1-model_v4 Pyrophosphatase 0.9328 8 99

Map