F443002

General Info

Members Datasets Scaffolds Average Seq Length
434 332 297 270

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1015288|Ga0055524_10152884
Length 283
Sequence MEVKFRTSACKSRDRYLMQAKRSRMSTPFLTTSQIAYQAAGKSILSGIDLTLTSGRIYGLVGQNGSGKSTLLKIMARQIAPTSGGVELKGEAISRWGARPFARQVAYMPQFTPATDSMTVRELVALGRFPWHGTLGRFTSADQKLVDEAXXRTDLERFADSPVASISGGERQRAWIAMMLAQNAQCLLLDEPTSALDLLHQDSVLALLRELSHERRLTIVVVLHDINLAARYCDEIVALRKGRISAHGTPADIVRSDVLKSVFDLEMGVFPHPLSNDPISYVL

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
7 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
10 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
11 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
12 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
13 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
14 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
15 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
16 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
17 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
18 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
19 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2643221582 Rhizobium sp. Root651 Isolate Unclassified
22 2643221693 Rhizobium sp. Root491 Isolate Unclassified
23 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
24 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
25 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
26 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
27 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
28 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
29 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
30 2751185800 Brucella pituitosa AA2 Isolate Unclassified
31 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
32 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
33 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
34 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
35 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
36 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
37 2791355199
38 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
39 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
40 2818991450 Burkholderia sp. 604 Isolate Unclassified
41 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
42 2818991467 Bosea vestrisii 3192 Isolate Unclassified
43 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
44 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
45 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
46 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
47 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
48 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
49 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
55 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
56 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
57 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
58 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
59 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
60 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
61 2841760612 Bosea sp. Tri-49 Isolate Nodule
62 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
63 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
64 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
65 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
66 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
67 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
68 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
69 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
70 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
71 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
72 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
73 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
74 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
75 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
76 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
77 2844104063 Bosea sp. Tri-39 Isolate Nodule
78 2851182111 Bosea sp. Tri-44 Isolate Nodule
79 2851246043 Bosea sp. Tri-54 Isolate Nodule
80 2854911287 Brucella lupini LUP21 Isolate Unclassified
81 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
82 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
83 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
84 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
85 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
86 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
87 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
88 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
89 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
90 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
91 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
92 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
93 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
94 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
95 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
96 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
97 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
98 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
99 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
100 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
101 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
102 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
103 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
104 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
105 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
106 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
107 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
108 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
109 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
110 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
111 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
112 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
113 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
114 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
115 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
116 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
117 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
118 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
119 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
120 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
121 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
122 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
123 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
124 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
125 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
126 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
127 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
128 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
129 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
130 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
131 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
132 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
133 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
134 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
135 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
136 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
137 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
138 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
139 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
140 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
141 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
142 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
143 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
144 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
145 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
146 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
147 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
150 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
151 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
152 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
153 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
154 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
155 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
158 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
161 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
162 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
163 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
167 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
168 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
172 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
173 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
174 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
175 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
176 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
179 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
180 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
181 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
182 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
310 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
311 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
312 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
318 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
322 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
323 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
324 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
325 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
326 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
327 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
328 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
329 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
330 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
331 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
332 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.59
Metatranscriptomes 0
Isolates 31.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.92
Bulb 0
Endosphere 23.73
Nodule 11.52
Rhizoplane 4.15
Rhizosphere 32.03
Stem 0
Stem Tuber 0
Unclassified 27.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000644 3300001979 Bacteria 15091
2 JGI24739J22299_10053140 3300001989 Bacteria 1301
3 JGI24735J21928_10013407 3300002067 Bacteria 2579
4 JGI24738J21930_10005244 3300002075 Bacteria 3125
5 JGI25156J39149_1000867 3300002705 Bacteria 15059
6 JGI25162J39368_1000352 3300002737 Bacteria 39535
7 JGI25162J39368_1000424 3300002737 Bacteria 34188
8 JGI25151J46595_10001880 3300003187 Bacteria 13386
9 JGI25165J46597_1000198 3300003214 Bacteria 88888
10 JGI25165J46597_1000550 3300003214 Bacteria 34203
11 JGI25165J46597_1002289 3300003214 Bacteria 6541
12 JGI25153J46596_10019833 3300003215 Bacteria 2561
13 rootH1_10001766 3300003323 Bacteria 20645
14 Ga0055533_1000115 3300003756 Bacteria 91607
15 Ga0055532_1000055 3300003758 Bacteria 160192
16 Ga0055527_1000030 3300003760 Bacteria 160175
17 Ga0055535_1000038 3300003761 Bacteria 160192
18 Ga0055542_1000063 3300003762 Bacteria 160175
19 Ga0055529_1000071 3300003763 Bacteria 160192
20 Ga0055526_1041735 3300003771 Bacteria 1140
21 Ga0055524_1015288 3300003775 Bacteria 2805
22 Ga0055524_1029722 3300003775 Bacteria 1608
23 Ga0055536_1009497 3300003781 Bacteria 4014
24 Ga0055528_1020664 3300003790 Bacteria 2128
25 Ga0055540_1001350 3300003792 Bacteria 14730
26 Ga0055531_10006213 3300003794 Bacteria 6820
27 Ga0070671_100114617 3300005355 Bacteria 2265
28 Ga0070665_100005027 3300005548 Bacteria 13715
29 Ga0070665_100086592 3300005548 Bacteria 3138
30 Ga0068856_100037758 3300005614 Bacteria 4740
31 Ga0068852_100036315 3300005616 Bacteria 4122
32 Ga0068862_100036384 3300005844 Bacteria 4173
33 Ga0081455_10003451 3300005937 Bacteria 18173
34 Ga0075365_10001264 3300006038 Bacteria 11212
35 Ga0075365_10167992 3300006038 Bacteria 1531
36 Ga0075365_10318486 3300006038 Bacteria 1095
37 Ga0075365_10402388 3300006038 Bacteria 966
38 Ga0075368_10000183 3300006042 Bacteria 17080
39 Ga0075363_100021634 3300006048 Bacteria 3243
40 Ga0075363_100092224 3300006048 Bacteria 1668
41 Ga0075364_10036447 3300006051 Bacteria 3179
42 Ga0075364_10038829 3300006051 Bacteria 3085
43 Ga0075362_10003825 3300006177 Bacteria 5337
44 Ga0075362_10016926 3300006177 Bacteria 2995
45 Ga0075362_10069939 3300006177 Bacteria 1601
46 Ga0075367_10002715 3300006178 Bacteria 8171
47 Ga0075367_10054079 3300006178 Bacteria 2380
48 Ga0075369_10023477 3300006186 Bacteria 2550
49 Ga0075369_10048771 3300006186 Bacteria 1828
50 Ga0075369_10048821 3300006186 Bacteria 1827
51 Ga0075366_10002030 3300006195 Bacteria 10275
52 Ga0075370_10041328 3300006353 Bacteria 2603
53 Ga0099826_10000814 3300006948 Bacteria 16756
54 Ga0099826_10006266 3300006948 Bacteria 8650
55 Ga0105251_10067851 3300009011 Bacteria 1665
56 Ga0105240_10000214 3300009093 Bacteria 117038
57 Ga0105243_10028015 3300009148 Bacteria 4322
58 Ga0105248_10145066 3300009177 Bacteria 2679
59 Ga0123341_1060851 3300009765 Bacteria 1857
60 Ga0123342_1014800 3300009766 Bacteria 7323
61 Ga0105239_10001443 3300010375 Bacteria 31684
62 Ga0105239_10220150 3300010375 Bacteria 2129
63 Ga0105246_10044456 3300011119 Bacteria 3019
64 Ga0157373_10068201 3300013100 Bacteria 2514
65 Ga0157371_10000219 3300013102 Bacteria 83847
66 Ga0157370_10000037 3300013104 Bacteria 136803
67 Ga0157370_10000981 3300013104 Bacteria 36141
68 Ga0157369_10617560 3300013105 Bacteria 1119
69 Ga0171462_1027 3300013250 Bacteria 113319
70 Ga0182008_10020889 3300014497 Bacteria 3368
71 Ga0182007_10001279 3300015262 Bacteria 13617
72 Ga0214544_1000002 3300021320 Bacteria 753857
73 Ga0214542_1000001 3300021321 Bacteria 1018696
74 Ga0214545_1000001 3300021324 Bacteria 1092817
75 Ga0214543_1000001 3300021327 Bacteria 776921
76 Ga0209674_100022 3300025226 Bacteria 563656
77 Ga0209672_100001 3300025228 Bacteria 2828210
78 Ga0209147_100001 3300025229 Bacteria 2384371
79 Ga0209563_101024 3300025230 Bacteria 8136
80 Ga0209437_100042 3300025233 Bacteria 444095
81 Ga0209437_100296 3300025233 Bacteria 70722
82 Ga0209258_100001 3300025242 Bacteria 2384269
83 Ga0207425_1014541 3300025245 Bacteria 1785
84 Ga0209148_1000003 3300025254 Bacteria 2384288
85 Ga0209759_1000099 3300025256 Bacteria 156332
86 Ga0209759_1010289 3300025256 Bacteria 2750
87 Ga0209129_1002101 3300025258 Bacteria 10189
88 Ga0209233_1000103 3300025261 Bacteria 284123
89 Ga0209233_1000180 3300025261 Bacteria 140304
90 Ga0209233_1000393 3300025261 Bacteria 37074
91 Ga0209455_1000001 3300025272 Bacteria 2384278
92 Ga0209673_1009479 3300025273 Bacteria 4209
93 Ga0209673_1012427 3300025273 Bacteria 3429
94 Ga0209025_1000220 3300025294 Bacteria 136977
95 Ga0209025_1000689 3300025294 Bacteria 57945
96 Ga0209025_1016531 3300025294 Bacteria 4340
97 Ga0209025_1020289 3300025294 Bacteria 3644
98 Ga0209564_1009016 3300025295 Bacteria 4814
99 Ga0209564_1023229 3300025295 Bacteria 2162
100 Ga0209758_1000130 3300025297 Bacteria 184456
101 Ga0209758_1073283 3300025297 Bacteria 1067
102 Ga0209050_1040343 3300025298 Bacteria 1301
103 Ga0209256_1000693 3300025299 Bacteria 44830
104 Ga0209256_1009046 3300025299 Bacteria 4454
105 Ga0209256_1011881 3300025299 Bacteria 3418
106 Ga0207426_1000730 3300025302 Bacteria 37639
107 Ga0207426_1007982 3300025302 Bacteria 4350
108 Ga0209051_1011557 3300025303 Bacteria 4351
109 Ga0209257_1003146 3300025304 Bacteria 14719
110 Ga0207713_1005325 3300025735 Bacteria 8084
111 Ga0207688_10024859 3300025901 Bacteria 3286
112 Ga0207647_10011276 3300025904 Bacteria 6272
113 Ga0207647_10017818 3300025904 Bacteria 4819
114 Ga0207695_10006154 3300025913 Bacteria 15649
115 Ga0207706_10032377 3300025933 Bacteria 4656
116 Ga0207709_10543089 3300025935 Bacteria 913
117 Ga0207640_10080315 3300025981 Bacteria 2226
118 Ga0207708_10200123 3300026075 Bacteria 1593
119 Ga0207702_10019435 3300026078 Bacteria 5621
120 Ga0207698_10081500 3300026142 Bacteria 2612
121 Ga0209371_1000035 3300027312 Bacteria 368979
122 Ga0209371_1002897 3300027312 Bacteria 8987
123 Ga0209282_1000811 3300027666 Bacteria 15966
124 Ga0209813_10004100 3300027866 Bacteria 3459
125 Ga0268266_10063083 3300028379 Bacteria 3199
126 Ga0268266_10214328 3300028379 Bacteria 1767
127 Ga0307517_10001070 3300028786 Bacteria 46406
128 Ga0307515_10289260 3300028794 Bacteria 1336
129 Ga0268256_1000037 3300030500 Bacteria 367024
130 Ga0268256_1002648 3300030500 Bacteria 8873
131 Ga0307410_10225354 3300031852 Bacteria 1444
132 Ga0307412_10000054 3300031911 Bacteria 147105
133 Ga0307412_10203851 3300031911 Bacteria 1504
134 Ga0307416_100206044 3300032002 Bacteria 1871
135 Ga0307411_10100066 3300032005 Bacteria 2048
136 Ga0439465_0078330 3300041413 Bacteria 1117
137 Ga0495590_0009864 3300046457 Bacteria 3613
138 Ga0495629_0021395 3300046459 Bacteria 4616
139 Ga0495641_0012935 3300046461 Bacteria 4627
140 Ga0495653_0045585 3300046463 Bacteria 3399
141 Ga0495653_0403381 3300046463 Bacteria 868
142 Ga0495580_0037717 3300046472 Bacteria 3466
143 Ga0495582_0003006 3300046473 Bacteria 9450
144 Ga0495605_0018438 3300046474 Bacteria 3740
145 Ga0495662_0022323 3300046476 Bacteria 3057
146 Ga0495664_0063333 3300046477 Bacteria 2203
147 Ga0495596_0051094 3300046500 Bacteria 1619
148 Ga0495606_0005044 3300046507 Bacteria 12852
149 Ga0495608_0032165 3300046511 Bacteria 3545
150 Ga0495610_0004906 3300046512 Bacteria 9717
151 Ga0495620_0076527 3300046515 Bacteria 1360
152 Ga0495628_0105969 3300046516 Bacteria 2165
153 Ga0495628_0123478 3300046516 Bacteria 1984
154 Ga0495630_0051827 3300046517 Bacteria 3071
155 Ga0495643_0038366 3300046522 Bacteria 2624
156 Ga0495666_0019586 3300046526 Bacteria 3356
157 Ga0495642_0022890 3300046528 Bacteria 2464
158 Ga0495652_0021238 3300046529 Bacteria 5771
159 Ga0495665_0027784 3300046531 Bacteria 3036
160 Ga0495586_0018673 3300046535 Bacteria 3691
161 Ga0495597_0059610 3300046542 Bacteria 1666
162 Ga0495645_0136540 3300046543 Bacteria 1715
163 Ga0495633_0024847 3300046558 Bacteria 2956
164 Ga0495633_0043990 3300046558 Bacteria 2117
165 Ga0495667_0022285 3300046559 Bacteria 4268
166 Ga0495668_0175886 3300046616 Bacteria 1173
167 Ga0495634_0020775 3300046642 Bacteria 4651
168 Ga0495635_0007939 3300046663 Bacteria 7414
169 Ga0495588_0001121 3300046674 Bacteria 11535
170 Ga0495657_0007760 3300046675 Bacteria 8247
171 Ga0495599_0173040 3300046678 Bacteria 1332
172 Ga0495623_0046180 3300046679 Bacteria 2765
173 Ga0495646_0001620 3300046680 Bacteria 13397
174 Ga0495613_0168227 3300046689 Bacteria 1557
175 Ga0495624_0042832 3300046690 Bacteria 2891
176 Ga0495671_0006894 3300046692 Bacteria 6518
177 Ga0495649_0014183 3300046694 Bacteria 4576
178 Ga0495589_0028430 3300046794 Bacteria 2822
179 Ga0495589_0053138 3300046794 Bacteria 2000
180 Ga0495600_0009449 3300046809 Bacteria 6024
181 Ga0495660_0124896 3300046810 Bacteria 1297
182 Ga0495581_0008705 3300047315 Bacteria 5877
183 Ga0495604_0095300 3300047317 Bacteria 2198
184 Ga0495672_0149634 3300047320 Bacteria 1212
185 Ga0495680_0022173 3300047322 Bacteria 5301
186 Ga0495687_017186 3300047443 Bacteria 3617
187 Ga0495675_0015042 3300047444 Bacteria 4893
188 Ga0495681_0000773 3300047470 Bacteria 24644
189 Ga0495684_0173735 3300047471 Bacteria 1600
190 Ga0495593_0030872 3300047673 Bacteria 2929
191 Ga0495602_0095168 3300048088 Bacteria 2459
192 Ga0495614_0016864 3300048089 Bacteria 3177
193 Ga0495626_0078317 3300048091 Bacteria 1472
194 Ga0496100_0088810 3300048903 Bacteria 2104
195 Ga0496102_0034590 3300048905 Bacteria 4545
196 Ga0496103_0205335 3300048906 Bacteria 1267
197 Ga0496104_0004068 3300048907 Bacteria 12683
198 Ga0496105_0001873 3300048908 Bacteria 15086
199 Ga0496110_0031186 3300048913 Bacteria 4598
200 Ga0496111_0131465 3300048914 Bacteria 1852
201 Ga0496113_0109524 3300048916 Bacteria 2148
202 Ga0496113_0229755 3300048916 Bacteria 1479
203 Ga0496113_0314399 3300048916 Bacteria 1255
204 Ga0496114_0257917 3300048917 Bacteria 1535
205 Ga0496116_0000798 3300048919 Bacteria 39923
206 Ga0496116_0004419 3300048919 Bacteria 13426
207 Ga0496116_0044781 3300048919 Bacteria 3002
208 Ga0496116_0121867 3300048919 Bacteria 1507
209 Ga0496116_0177983 3300048919 Bacteria 1143
210 Ga0496117_0000066 3300048920 Bacteria 253534
211 Ga0496117_0003901 3300048920 Bacteria 16907
212 Ga0496117_0021281 3300048920 Bacteria 5254
213 Ga0496118_0004568 3300048921 Bacteria 16307
214 Ga0496118_0007189 3300048921 Bacteria 11900
215 Ga0496118_0009389 3300048921 Bacteria 9893
216 Ga0496118_0038552 3300048921 Bacteria 3827
217 Ga0496118_0069320 3300048921 Bacteria 2555
218 Ga0496118_0187067 3300048921 Bacteria 1243
219 Ga0496119_0000418 3300048922 Bacteria 58482
220 Ga0496119_0003284 3300048922 Bacteria 16912
221 Ga0496119_0005053 3300048922 Bacteria 12824
222 Ga0496119_0005079 3300048922 Bacteria 12776
223 Ga0496119_0006709 3300048922 Bacteria 10579
224 Ga0496119_0022687 3300048922 Bacteria 4483
225 Ga0496119_0166441 3300048922 Bacteria 1167
226 Ga0496120_0000100 3300048923 Bacteria 143064
227 Ga0496120_0001767 3300048923 Bacteria 24357
228 Ga0496120_0009895 3300048923 Bacteria 6714
229 Ga0496120_0020098 3300048923 Bacteria 4254
230 Ga0496120_0198038 3300048923 Bacteria 974
231 Ga0496120_0208843 3300048923 Bacteria 940
232 Ga0496121_0001058 3300048924 Bacteria 48765
233 Ga0496121_0006042 3300048924 Bacteria 15249
234 Ga0496121_0411206 3300048924 Bacteria 883
235 Ga0496122_0000057 3300048925 Bacteria 253452
236 Ga0496122_0003647 3300048925 Bacteria 20021
237 Ga0496122_0004110 3300048925 Bacteria 18418
238 Ga0496122_0004775 3300048925 Bacteria 16585
239 Ga0496122_0015615 3300048925 Bacteria 7244
240 Ga0496122_0027289 3300048925 Bacteria 4886
241 Ga0496122_0067918 3300048925 Bacteria 2563
242 Ga0496122_0229883 3300048925 Bacteria 1055
243 Ga0496123_0000096 3300048926 Bacteria 173914
244 Ga0496123_0000517 3300048926 Bacteria 67322
245 Ga0496123_0003777 3300048926 Bacteria 16585
246 Ga0496123_0012128 3300048926 Bacteria 7384
247 Ga0496123_0028876 3300048926 Bacteria 4095
248 Ga0496123_0029241 3300048926 Bacteria 4063
249 Ga0496123_0030626 3300048926 Bacteria 3935
250 Ga0496124_0000091 3300048927 Bacteria 189706
251 Ga0496124_0000236 3300048927 Bacteria 107751
252 Ga0496124_0001498 3300048927 Bacteria 34209
253 Ga0496124_0023883 3300048927 Bacteria 5569
254 Ga0496124_0056104 3300048927 Bacteria 3324
255 Ga0496124_0094065 3300048927 Bacteria 2438
256 Ga0496124_0119107 3300048927 Bacteria 2112
257 Ga0496124_0249811 3300048927 Bacteria 1313
258 Ga0496125_0000034 3300048928 Bacteria 348231
259 Ga0496125_0004596 3300048928 Bacteria 15779
260 Ga0496125_0011574 3300048928 Bacteria 8813
261 Ga0496125_0019141 3300048928 Bacteria 6471
262 Ga0496125_0125053 3300048928 Bacteria 1824
263 Ga0496126_0006055 3300048929 Bacteria 13572
264 Ga0501035_0362578 3300049822 Bacteria 1211
265 Ga0501044_0948804 3300049823 Bacteria 733
266 nmdc:mga03683_2578_c1 3300050489 Bacteria 5654
267 nmdc:mga03683_57518_c1 3300050489 Bacteria 1637
268 nmdc:mga03683_59812_c1 3300050489 Bacteria 1608
269 nmdc:mga03n38_11252_c1 3300050490 Bacteria 3326
270 nmdc:mga03n38_5030_c1 3300050490 Bacteria 4456
271 nmdc:mga00v17_17_c1 3300050491 Bacteria 121949
272 nmdc:mga00v17_30238_c1 3300050491 Bacteria 3186
273 nmdc:mga0yw44_101_c1 3300050492 Bacteria 29987
274 nmdc:mga0yw44_427561_c1 3300050492 Bacteria 897
275 nmdc:mga0k408_64_c1 3300050493 Bacteria 52393
276 nmdc:mga06z11_163742_c1 3300050494 Bacteria 1273
277 nmdc:mga06z11_891_c1 3300050494 Bacteria 10880
278 nmdc:mga04h51_4662_c1 3300050495 Bacteria 3430
279 nmdc:mga07m45_14166_c1 3300050496 Bacteria 4242
280 nmdc:mga0sz30_16006_c1 3300050516 Bacteria 2970
281 nmdc:mga0sz30_4631_c1 3300050516 Bacteria 4982
282 nmdc:mga0sz30_9055_c1 3300050516 Bacteria 3776
283 Ga0500566_0151699 3300053094 Unclassified 1217
284 Ga0500556_0000038 3300053104 Bacteria 138208
285 Ga0500560_011727 3300053107 Bacteria 2246
286 Ga0500572_005312 3300053111 Bacteria 2914
287 Ga0500618_000593 3300053125 Bacteria 22319
288 Ga0500618_003647 3300053125 Bacteria 5209
289 Ga0500618_010690 3300053125 Bacteria 2455
290 Ga0500561_0000038 3300053137 Bacteria 26963
291 Ga0500568_0027193 3300053139 Bacteria 2394
292 Ga0500616_0000093 3300053153 Bacteria 183114
293 Ga0500616_0019333 3300053153 Bacteria 3842
294 Ga0500622_0008265 3300053156 Bacteria 5839
295 Ga0500624_000466 3300053157 Bacteria 12055
296 Ga0500634_0076152 3300053161 Bacteria 1742
297 Ga0501084_0613439 3300054114 Bacteria 919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1041735 Ga0055526_10417351 232
2 3300049823 Ga0501044_0948804 Ga0501044_0948804_18_716 232
3 3300048923 Ga0496120_0208843 Ga0496120_0208843_36_740 234
4 3300048922 Ga0496119_0005053 Ga0496119_0005053_11826_12536 236
5 iso_pu_bacteria 8002811521 8002812401 242
6 3300054114 Ga0501084_0613439 Ga0501084_0613439_71_832 247
7 3300006038 Ga0075365_10402388 Ga0075365_104023881 250
8 3300050492 nmdc:mga0yw44_427561_c1 nmdc:mga0yw44_427561_c1_106_885 250
9 iso_pu_bacteria 2904483920 2904485612 251
10 3300046477 Ga0495664_0063333 Ga0495664_0063333_45_812 255
11 3300047317 Ga0495604_0095300 Ga0495604_0095300_1390_2157 255
12 3300048919 Ga0496116_0177983 Ga0496116_0177983_26_793 255
13 iso_pu_bacteria 2510917028 2511186044 255
14 iso_pu_bacteria 2582581867 2585401799 255
15 iso_pu_bacteria 2585427590 2585820189 255
16 iso_pu_bacteria 2751185800 2753358212 255
17 iso_pu_bacteria 2758568016 2758639011 255
18 iso_pu_bacteria 2765235802 2765466726 255
19 iso_pu_bacteria 2767802442 2770197128 255
20 iso_pu_bacteria 2775506902 2776267670 255
21 iso_pu_bacteria 2839993093 2839993708 255
22 iso_pu_bacteria 2840764183 2840764494 255
23 iso_pu_bacteria 2904578770 2904581747 255
24 iso_pu_bacteria 2919119836 2919123414 255
25 iso_pu_bacteria 2923556063 2923562480 255
26 iso_pu_bacteria 3002141150 3002146448 255
27 3300025294 Ga0209025_1000689 Ga0209025_100068952 256
28 3300048921 Ga0496118_0069320 Ga0496118_0069320_1201_1971 256
29 3300053111 Ga0500572_005312 Ga0500572_005312_1107_1877 256
30 iso_pu_bacteria 2842333319 2842338722 256
31 iso_pu_bacteria 2854911287 2854913509 256
32 iso_pu_bacteria 8055431914 8055433185 256
33 3300053125 Ga0500618_010690 Ga0500618_010690_1183_1956 257
34 iso_pu_bacteria 2851182111 2851185561 257
35 3300003775 Ga0055524_1029722 Ga0055524_10297222 259
36 3300003790 Ga0055528_1020664 Ga0055528_10206642 259
37 3300005355 Ga0070671_100114617 Ga0070671_1001146171 259
38 3300006038 Ga0075365_10001264 Ga0075365_100012648 259
39 3300006177 Ga0075362_10016926 Ga0075362_100169263 259
40 3300006186 Ga0075369_10023477 Ga0075369_100234772 259
41 3300009765 Ga0123341_1060851 Ga0123341_10608512 259
42 3300009766 Ga0123342_1014800 Ga0123342_10148006 259
43 3300025245 Ga0207425_1014541 Ga0207425_10145412 259
44 3300025258 Ga0209129_1002101 Ga0209129_10021012 259
45 3300025273 Ga0209673_1009479 Ga0209673_10094794 259
46 3300025295 Ga0209564_1009016 Ga0209564_10090163 259
47 3300025295 Ga0209564_1023229 Ga0209564_10232291 259
48 3300025299 Ga0209256_1009046 Ga0209256_10090464 259
49 3300025302 Ga0207426_1000730 Ga0207426_100073026 259
50 3300048906 Ga0496103_0205335 Ga0496103_0205335_141_920 259
51 3300048907 Ga0496104_0004068 Ga0496104_0004068_2958_3737 259
52 3300048914 Ga0496111_0131465 Ga0496111_0131465_77_856 259
53 3300048919 Ga0496116_0044781 Ga0496116_0044781_1979_2758 259
54 3300048922 Ga0496119_0022687 Ga0496119_0022687_2260_3039 259
55 3300048924 Ga0496121_0411206 Ga0496121_0411206_31_810 259
56 3300048925 Ga0496122_0027289 Ga0496122_0027289_203_982 259
57 3300048927 Ga0496124_0056104 Ga0496124_0056104_779_1558 259
58 3300048927 Ga0496124_0119107 Ga0496124_0119107_573_1352 259
59 3300050489 nmdc:mga03683_57518_c1 nmdc:mga03683_57518_c1_472_1251 259
60 3300050516 nmdc:mga0sz30_16006_c1 nmdc:mga0sz30_16006_c1_1750_2529 259
61 3300003187 JGI25151J46595_10001880 JGI25151J46595_100018806 261
62 3300025294 Ga0209025_1000220 Ga0209025_1000220118 261
63 3300006038 Ga0075365_10167992 Ga0075365_101679922 262
64 3300048927 Ga0496124_0000091 Ga0496124_0000091_149839_150630 263
65 3300047320 Ga0495672_0149634 Ga0495672_0149634_231_1061 264
66 iso_pu_bacteria 2510917026 2511175106 264
67 iso_pu_bacteria 2894817345 2894820421 264
68 iso_pu_bacteria 2537561587 2537875345 265
69 iso_pu_bacteria 2554235003 2554244935 265
70 iso_pu_bacteria 2558860242 2559297231 265
71 iso_pu_bacteria 2599185210 2599605150 265
72 iso_pu_bacteria 2600255279 2601611665 265
73 iso_pu_bacteria 2600255308 2601748783 265
74 iso_pu_bacteria 2643221582 2643921771 265
75 iso_pu_bacteria 2643221693 2644519740 265
76 iso_pu_bacteria 2808606387 2808988811 265
77 iso_pu_bacteria 2818991439 2819561326 265
78 iso_pu_bacteria 2838675328 2838679525 265
79 iso_pu_bacteria 2838714209 2838718882 265
80 iso_pu_bacteria 2838719591 2838723881 265
81 iso_pu_bacteria 2838724970 2838729203 265
82 iso_pu_bacteria 2841846520 2841851027 265
83 iso_pu_bacteria 2841859092 2841863835 265
84 iso_pu_bacteria 2842124991 2842129902 265
85 iso_pu_bacteria 2842130223 2842134356 265
86 iso_pu_bacteria 2842152218 2842156352 265
87 iso_pu_bacteria 2842170452 2842175128 265
88 iso_pu_bacteria 2842175837 2842180044 265
89 iso_pu_bacteria 2842187318 2842191537 265
90 iso_pu_bacteria 2842211629 2842215854 265
91 iso_pu_bacteria 2842224351 2842228646 265
92 iso_pu_bacteria 2842515876 2842520617 265
93 iso_pu_bacteria 2899792073 2899793274 265
94 iso_pu_bacteria 2899845264 2899850491 265
95 iso_pu_bacteria 2919114240 2919118743 265
96 iso_pu_bacteria 2926754445 2926758236 265
97 iso_pu_bacteria 2926760298 2926764199 265
98 iso_pu_bacteria 2929138655 2929142700 265
99 iso_pu_bacteria 2933006813 2933011126 265
100 iso_pu_bacteria 2933011516 2933016334 265
101 iso_pu_bacteria 2933594066 2933599045 265
102 iso_pu_bacteria 2979089926 2979090701 265
103 iso_pu_bacteria 2979095461 2979096225 265
104 iso_pu_bacteria 2979100975 2979101751 265
105 iso_pu_bacteria 2984509177 2984510296 265
106 iso_pu_bacteria 2984518228 2984518999 265
107 iso_pu_bacteria 2984537506 2984538645 265
108 iso_pu_bacteria 2984601300 2984605353 265
109 iso_pu_bacteria 650716007 650843660 265
110 iso_pu_bacteria 8003570095 8003574077 265
111 3300009177 Ga0105248_10145066 Ga0105248_101450662 266
112 3300025294 Ga0209025_1016531 Ga0209025_10165311 266
113 3300048908 Ga0496105_0001873 Ga0496105_0001873_414_1214 266
114 3300048913 Ga0496110_0031186 Ga0496110_0031186_2866_3666 266
115 3300048916 Ga0496113_0314399 Ga0496113_0314399_245_1045 266
116 3300048922 Ga0496119_0005079 Ga0496119_0005079_3961_4761 266
117 3300048923 Ga0496120_0198038 Ga0496120_0198038_47_847 266
118 3300048927 Ga0496124_0094065 Ga0496124_0094065_659_1459 266
119 3300003215 JGI25153J46596_10019833 JGI25153J46596_100198331 267
120 3300003781 Ga0055536_1009497 Ga0055536_10094974 267
121 3300003792 Ga0055540_1001350 Ga0055540_100135012 267
122 3300003794 Ga0055531_10006213 Ga0055531_100062134 267
123 3300005548 Ga0070665_100005027 Ga0070665_1000050275 267
124 3300006042 Ga0075368_10000183 Ga0075368_1000018310 267
125 3300006048 Ga0075363_100021634 Ga0075363_1000216341 267
126 3300006048 Ga0075363_100092224 Ga0075363_1000922241 267
127 3300006051 Ga0075364_10036447 Ga0075364_100364473 267
128 3300006051 Ga0075364_10038829 Ga0075364_100388293 267
129 3300006177 Ga0075362_10003825 Ga0075362_100038254 267
130 3300006177 Ga0075362_10069939 Ga0075362_100699392 267
131 3300006178 Ga0075367_10002715 Ga0075367_100027157 267
132 3300006178 Ga0075367_10054079 Ga0075367_100540792 267
133 3300006186 Ga0075369_10048771 Ga0075369_100487712 267
134 3300006186 Ga0075369_10048821 Ga0075369_100488212 267
135 3300006195 Ga0075366_10002030 Ga0075366_100020307 267
136 3300006353 Ga0075370_10041328 Ga0075370_100413283 267
137 3300006948 Ga0099826_10000814 Ga0099826_1000081415 267
138 3300006948 Ga0099826_10006266 Ga0099826_100062667 267
139 3300009148 Ga0105243_10028015 Ga0105243_100280152 267
140 3300011119 Ga0105246_10044456 Ga0105246_100444563 267
141 3300013100 Ga0157373_10068201 Ga0157373_100682012 267
142 3300013102 Ga0157371_10000219 Ga0157371_1000021980 267
143 3300013104 Ga0157370_10000037 Ga0157370_1000003754 267
144 3300025297 Ga0209758_1000130 Ga0209758_100013078 267
145 3300025298 Ga0209050_1040343 Ga0209050_10403432 267
146 3300025303 Ga0209051_1011557 Ga0209051_10115574 267
147 3300025304 Ga0209257_1003146 Ga0209257_100314613 267
148 3300025901 Ga0207688_10024859 Ga0207688_100248592 267
149 3300025935 Ga0207709_10543089 Ga0207709_105430891 267
150 3300025981 Ga0207640_10080315 Ga0207640_100803152 267
151 3300026075 Ga0207708_10200123 Ga0207708_102001231 267
152 3300027312 Ga0209371_1000035 Ga0209371_1000035148 267
153 3300027312 Ga0209371_1002897 Ga0209371_10028973 267
154 3300027666 Ga0209282_1000811 Ga0209282_100081113 267
155 3300027866 Ga0209813_10004100 Ga0209813_100041002 267
156 3300028379 Ga0268266_10214328 Ga0268266_102143281 267
157 3300030500 Ga0268256_1000037 Ga0268256_1000037147 267
158 3300030500 Ga0268256_1002648 Ga0268256_10026483 267
159 3300031852 Ga0307410_10225354 Ga0307410_102253542 267
160 3300031911 Ga0307412_10203851 Ga0307412_102038512 267
161 3300041413 Ga0439465_0078330 Ga0439465_0078330_159_968 267
162 3300046558 Ga0495633_0024847 Ga0495633_0024847_1955_2764 267
163 3300046558 Ga0495633_0043990 Ga0495633_0043990_422_1231 267
164 3300046674 Ga0495588_0001121 Ga0495588_0001121_7307_8125 267
165 3300046692 Ga0495671_0006894 Ga0495671_0006894_5179_5988 267
166 3300047470 Ga0495681_0000773 Ga0495681_0000773_17592_18401 267
167 3300048916 Ga0496113_0109524 Ga0496113_0109524_131_940 267
168 3300048919 Ga0496116_0004419 Ga0496116_0004419_11813_12622 267
169 3300048919 Ga0496116_0121867 Ga0496116_0121867_239_1057 267
170 3300048920 Ga0496117_0000066 Ga0496117_0000066_160989_161798 267
171 3300048920 Ga0496117_0021281 Ga0496117_0021281_4291_5100 267
172 3300048921 Ga0496118_0007189 Ga0496118_0007189_9029_9838 267
173 3300048921 Ga0496118_0187067 Ga0496118_0187067_172_981 267
174 3300048922 Ga0496119_0166441 Ga0496119_0166441_290_1099 267
175 3300048923 Ga0496120_0000100 Ga0496120_0000100_90710_91519 267
176 3300048923 Ga0496120_0009895 Ga0496120_0009895_1086_1895 267
177 3300048924 Ga0496121_0006042 Ga0496121_0006042_13438_14247 267
178 3300048925 Ga0496122_0000057 Ga0496122_0000057_90710_91519 267
179 3300048925 Ga0496122_0067918 Ga0496122_0067918_1535_2344 267
180 3300048925 Ga0496122_0229883 Ga0496122_0229883_219_1028 267
181 3300048926 Ga0496123_0000096 Ga0496123_0000096_82396_83205 267
182 3300048926 Ga0496123_0028876 Ga0496123_0028876_760_1569 267
183 3300048926 Ga0496123_0029241 Ga0496123_0029241_302_1126 267
184 3300048927 Ga0496124_0000236 Ga0496124_0000236_37974_38810 267
185 3300048927 Ga0496124_0023883 Ga0496124_0023883_4456_5265 267
186 3300048927 Ga0496124_0249811 Ga0496124_0249811_280_1098 267
187 3300048928 Ga0496125_0000034 Ga0496125_0000034_251659_252468 267
188 3300048928 Ga0496125_0011574 Ga0496125_0011574_3169_3987 267
189 3300048928 Ga0496125_0019141 Ga0496125_0019141_3395_4204 267
190 3300048928 Ga0496125_0125053 Ga0496125_0125053_463_1272 267
191 3300050489 nmdc:mga03683_2578_c1 nmdc:mga03683_2578_c1_4665_5474 267
192 3300050489 nmdc:mga03683_59812_c1 nmdc:mga03683_59812_c1_619_1428 267
193 3300050490 nmdc:mga03n38_11252_c1 nmdc:mga03n38_11252_c1_251_1060 267
194 3300050490 nmdc:mga03n38_5030_c1 nmdc:mga03n38_5030_c1_2268_3077 267
195 3300050491 nmdc:mga00v17_17_c1 nmdc:mga00v17_17_c1_31515_32324 267
196 3300050491 nmdc:mga00v17_30238_c1 nmdc:mga00v17_30238_c1_2197_3006 267
197 3300050492 nmdc:mga0yw44_101_c1 nmdc:mga0yw44_101_c1_5316_6125 267
198 3300050493 nmdc:mga0k408_64_c1 nmdc:mga0k408_64_c1_8700_9509 267
199 3300050494 nmdc:mga06z11_163742_c1 nmdc:mga06z11_163742_c1_260_1069 267
200 3300050494 nmdc:mga06z11_891_c1 nmdc:mga06z11_891_c1_7804_8613 267
201 3300050495 nmdc:mga04h51_4662_c1 nmdc:mga04h51_4662_c1_384_1193 267
202 3300050496 nmdc:mga07m45_14166_c1 nmdc:mga07m45_14166_c1_2223_3032 267
203 3300050516 nmdc:mga0sz30_4631_c1 nmdc:mga0sz30_4631_c1_361_1170 267
204 3300050516 nmdc:mga0sz30_9055_c1 nmdc:mga0sz30_9055_c1_44_853 267
205 3300053107 Ga0500560_011727 Ga0500560_011727_635_1444 267
206 3300053137 Ga0500561_0000038 Ga0500561_0000038_5005_5814 267
207 3300053153 Ga0500616_0000093 Ga0500616_0000093_9133_9957 267
208 3300053157 Ga0500624_000466 Ga0500624_000466_2907_3716 267
209 3300053161 Ga0500634_0076152 Ga0500634_0076152_478_1287 267
210 iso_pu_bacteria 2508501125 2509131493 267
211 iso_pu_bacteria 2510917026 2511169509 267
212 iso_pu_bacteria 2511231027 2511391309 267
213 iso_pu_bacteria 2526164713 2527080767 267
214 iso_pu_bacteria 2757320392 2757569826 267
215 iso_pu_bacteria 2818991450 2819624419 267
216 iso_pu_bacteria 2841911363 2841912681 267
217 iso_pu_bacteria 2841917233 2841923082 267
218 iso_pu_bacteria 2842871566 2842875583 267
219 iso_pu_bacteria 2856287931 2856289664 267
220 iso_pu_bacteria 2857357740 2857366412 267
221 iso_pu_bacteria 2894232714 2894236292 267
222 iso_pu_bacteria 2919171160 2919176058 267
223 iso_pu_bacteria 2919527303 2919533776 267
224 iso_pu_bacteria 2928108538 2928112538 267
225 iso_pu_bacteria 2928135762 2928141631 267
226 iso_pu_bacteria 2928503688 2928507772 267
227 iso_pu_bacteria 2954011201 2954011491 267
228 iso_pu_bacteria 8055301274 8055303160 267
229 3300025294 Ga0209025_1020289 Ga0209025_10202892 268
230 3300025299 Ga0209256_1000693 Ga0209256_100069326 268
231 3300048903 Ga0496100_0088810 Ga0496100_0088810_14_820 268
232 iso_pu_bacteria 2738541296 2738824440 269
233 iso_pu_bacteria 2738541298 2738836849 269
234 iso_pu_bacteria 2738541306 2738878380 269
235 iso_pu_bacteria 2738543002 2739190072 269
236 iso_pu_bacteria 2738543008 2739224973 269
237 iso_pu_bacteria 2945934425 2945936229 269
238 iso_pu_bacteria 2990703756 2990709870 269
239 iso_pu_bacteria 641736151 642425479 269
240 3300046522 Ga0495643_0038366 Ga0495643_0038366_657_1499 270
241 iso_pu_bacteria 2513237101 2513693132 270
242 iso_pu_bacteria 2721755755 2723843241 270
243 iso_pu_bacteria 2791355199 2793076544 270
244 iso_pu_bacteria 2874604998 2874607764 270
245 iso_pu_bacteria 2889033259 2889038480 270
246 iso_pu_bacteria 8006964411 8006968146 270
247 iso_pu_bacteria 8006994254 8006999821 270
248 iso_pu_bacteria 8056673599 8056676574 270
249 3300002705 JGI25156J39149_1000867 JGI25156J39149_100086713 271
250 3300003214 JGI25165J46597_1002289 JGI25165J46597_10022895 271
251 3300003756 Ga0055533_1000115 Ga0055533_10001153 271
252 3300003758 Ga0055532_1000055 Ga0055532_10000553 271
253 3300003760 Ga0055527_1000030 Ga0055527_10000303 271
254 3300003761 Ga0055535_1000038 Ga0055535_10000383 271
255 3300003762 Ga0055542_1000063 Ga0055542_10000633 271
256 3300003763 Ga0055529_1000071 Ga0055529_10000713 271
257 3300015262 Ga0182007_10001279 Ga0182007_100012795 271
258 3300025226 Ga0209674_100022 Ga0209674_100022143 271
259 3300025228 Ga0209672_100001 Ga0209672_100001138 271
260 3300025229 Ga0209147_100001 Ga0209147_100001138 271
261 3300025230 Ga0209563_101024 Ga0209563_1010242 271
262 3300025242 Ga0209258_100001 Ga0209258_100001138 271
263 3300025254 Ga0209148_1000003 Ga0209148_1000003138 271
264 3300025256 Ga0209759_1000099 Ga0209759_1000099138 271
265 3300025261 Ga0209233_1000180 Ga0209233_1000180173 271
266 3300025272 Ga0209455_1000001 Ga0209455_1000001138 271
267 3300025735 Ga0207713_1005325 Ga0207713_10053257 271
268 3300025904 Ga0207647_10011276 Ga0207647_100112762 271
269 3300046457 Ga0495590_0009864 Ga0495590_0009864_18_836 271
270 3300046459 Ga0495629_0021395 Ga0495629_0021395_1958_2776 271
271 3300046461 Ga0495641_0012935 Ga0495641_0012935_1804_2622 271
272 3300046463 Ga0495653_0045585 Ga0495653_0045585_119_937 271
273 3300046463 Ga0495653_0403381 Ga0495653_0403381_12_830 271
274 3300046472 Ga0495580_0037717 Ga0495580_0037717_2637_3455 271
275 3300046473 Ga0495582_0003006 Ga0495582_0003006_1134_1952 271
276 3300046476 Ga0495662_0022323 Ga0495662_0022323_1896_2714 271
277 3300046507 Ga0495606_0005044 Ga0495606_0005044_12001_12819 271
278 3300046511 Ga0495608_0032165 Ga0495608_0032165_177_995 271
279 3300046515 Ga0495620_0076527 Ga0495620_0076527_412_1230 271
280 3300046516 Ga0495628_0105969 Ga0495628_0105969_1335_2153 271
281 3300046516 Ga0495628_0123478 Ga0495628_0123478_210_1028 271
282 3300046517 Ga0495630_0051827 Ga0495630_0051827_158_976 271
283 3300046526 Ga0495666_0019586 Ga0495666_0019586_1691_2509 271
284 3300046529 Ga0495652_0021238 Ga0495652_0021238_1928_2746 271
285 3300046531 Ga0495665_0027784 Ga0495665_0027784_285_1103 271
286 3300046535 Ga0495586_0018673 Ga0495586_0018673_136_954 271
287 3300046542 Ga0495597_0059610 Ga0495597_0059610_234_1052 271
288 3300046543 Ga0495645_0136540 Ga0495645_0136540_286_1104 271
289 3300046559 Ga0495667_0022285 Ga0495667_0022285_815_1633 271
290 3300046642 Ga0495634_0020775 Ga0495634_0020775_2637_3455 271
291 3300046663 Ga0495635_0007939 Ga0495635_0007939_3734_4552 271
292 3300046675 Ga0495657_0007760 Ga0495657_0007760_5045_5863 271
293 3300046678 Ga0495599_0173040 Ga0495599_0173040_130_948 271
294 3300046679 Ga0495623_0046180 Ga0495623_0046180_941_1759 271
295 3300046680 Ga0495646_0001620 Ga0495646_0001620_6444_7262 271
296 3300046689 Ga0495613_0168227 Ga0495613_0168227_359_1177 271
297 3300046690 Ga0495624_0042832 Ga0495624_0042832_255_1073 271
298 3300046694 Ga0495649_0014183 Ga0495649_0014183_2068_2886 271
299 3300046794 Ga0495589_0028430 Ga0495589_0028430_1601_2419 271
300 3300046809 Ga0495600_0009449 Ga0495600_0009449_3146_3964 271
301 3300046810 Ga0495660_0124896 Ga0495660_0124896_80_898 271
302 3300047315 Ga0495581_0008705 Ga0495581_0008705_3346_4164 271
303 3300047322 Ga0495680_0022173 Ga0495680_0022173_1934_2752 271
304 3300047443 Ga0495687_017186 Ga0495687_017186_518_1336 271
305 3300047444 Ga0495675_0015042 Ga0495675_0015042_22_840 271
306 3300047471 Ga0495684_0173735 Ga0495684_0173735_632_1450 271
307 3300047673 Ga0495593_0030872 Ga0495593_0030872_1390_2208 271
308 3300048088 Ga0495602_0095168 Ga0495602_0095168_813_1631 271
309 3300048089 Ga0495614_0016864 Ga0495614_0016864_394_1212 271
310 3300048921 Ga0496118_0004568 Ga0496118_0004568_12169_12987 271
311 iso_pu_bacteria 2818991467 2819717759 272
312 3300001989 JGI24739J22299_10053140 JGI24739J22299_100531402 273
313 3300002067 JGI24735J21928_10013407 JGI24735J21928_100134072 273
314 3300002075 JGI24738J21930_10005244 JGI24738J21930_100052442 273
315 3300014497 Ga0182008_10020889 Ga0182008_100208892 273
316 3300021320 Ga0214544_1000002 Ga0214544_10000025 273
317 3300021321 Ga0214542_1000001 Ga0214542_1000001355 273
318 3300021324 Ga0214545_1000001 Ga0214545_1000001421 273
319 3300021327 Ga0214543_1000001 Ga0214543_1000001775 273
320 3300025256 Ga0209759_1010289 Ga0209759_10102892 273
321 3300025904 Ga0207647_10017818 Ga0207647_100178182 273
322 3300031911 Ga0307412_10000054 Ga0307412_1000005446 273
323 3300032005 Ga0307411_10100066 Ga0307411_101000661 273
324 3300046474 Ga0495605_0018438 Ga0495605_0018438_2275_3099 273
325 3300046500 Ga0495596_0051094 Ga0495596_0051094_188_1012 273
326 3300046512 Ga0495610_0004906 Ga0495610_0004906_504_1328 273
327 3300046528 Ga0495642_0022890 Ga0495642_0022890_705_1529 273
328 3300046794 Ga0495589_0053138 Ga0495589_0053138_1091_1915 273
329 3300048091 Ga0495626_0078317 Ga0495626_0078317_629_1453 273
330 3300048921 Ga0496118_0038552 Ga0496118_0038552_1855_2679 273
331 iso_pu_bacteria 2617270741 2617378376 273
332 iso_pu_bacteria 2824732956 2824738186 273
333 iso_pu_bacteria 2908775508 2908780617 273
334 3300005844 Ga0068862_100036384 Ga0068862_1000363842 274
335 3300005937 Ga0081455_10003451 Ga0081455_100034515 274
336 3300006038 Ga0075365_10318486 Ga0075365_103184862 274
337 3300010375 Ga0105239_10220150 Ga0105239_102201502 274
338 3300025297 Ga0209758_1073283 Ga0209758_10732832 274
339 3300025302 Ga0207426_1007982 Ga0207426_10079822 274
340 3300025933 Ga0207706_10032377 Ga0207706_100323773 274
341 3300032002 Ga0307416_100206044 Ga0307416_1002060442 274
342 3300048916 Ga0496113_0229755 Ga0496113_0229755_597_1427 274
343 3300048925 Ga0496122_0015615 Ga0496122_0015615_3924_4754 274
344 3300048926 Ga0496123_0030626 Ga0496123_0030626_1835_2665 274
345 3300053139 Ga0500568_0027193 Ga0500568_0027193_783_1631 274
346 iso_pu_bacteria 2508501050 2508735114 274
347 iso_pu_bacteria 2600255067 2600813970 274
348 iso_pu_bacteria 2824600985 2824608445 274
349 iso_pu_bacteria 2824609381 2824617394 274
350 iso_pu_bacteria 2824617872 2824618675 274
351 iso_pu_bacteria 2824626560 2824627110 274
352 iso_pu_bacteria 2824635225 2824635674 274
353 iso_pu_bacteria 2824644064 2824644510 274
354 iso_pu_bacteria 2824714736 2824715542 274
355 iso_pu_bacteria 2824723954 2824724823 274
356 iso_pu_bacteria 2824746037 2824752688 274
357 iso_pu_bacteria 2857509624 2857516742 274
358 iso_pu_bacteria 2885366525 2885373813 274
359 iso_pu_bacteria 2888419890 2888425203 274
360 iso_pu_bacteria 2917699015 2917703538 274
361 iso_pu_bacteria 3005506211 3005507553 274
362 3300009011 Ga0105251_10067851 Ga0105251_100678512 275
363 3300048917 Ga0496114_0257917 Ga0496114_0257917_123_959 275
364 iso_pu_bacteria 2513237087 2513589761 275
365 iso_pu_bacteria 2582581308 2585282363 275
366 iso_pu_bacteria 2667528174 2671116657 275
367 iso_pu_bacteria 2818991453 2819644127 275
368 iso_pu_bacteria 2919408235 2919413712 275
369 iso_pu_bacteria 8005314921 8005320945 275
370 3300048922 Ga0496119_0000418 Ga0496119_0000418_2721_3551 276
371 iso_pu_bacteria 2508501114 2509078739 276
372 iso_pu_bacteria 2775506901 2776260005 276
373 iso_pu_bacteria 2835312727 2835319276 276
374 3300028794 Ga0307515_10289260 Ga0307515_102892602 277
375 3300053153 Ga0500616_0019333 Ga0500616_0019333_2806_3666 277
376 3300053156 Ga0500622_0008265 Ga0500622_0008265_3071_3931 277
377 iso_pu_bacteria 2841760612 2841764284 277
378 iso_pu_bacteria 2844104063 2844108261 277
379 iso_pu_bacteria 2851246043 2851250719 277
380 iso_pu_bacteria 2889790730 2889792515 277
381 iso_pu_bacteria 2889914905 2889916183 277
382 iso_pu_bacteria 8057529695 8057533655 277
383 3300002737 JGI25162J39368_1000352 JGI25162J39368_100035211 278
384 3300003214 JGI25165J46597_1000198 JGI25165J46597_100019851 278
385 3300003323 rootH1_10001766 rootH1_1000176612 278
386 3300013250 Ga0171462_1027 Ga0171462_10277 278
387 3300025233 Ga0209437_100042 Ga0209437_100042205 278
388 3300025261 Ga0209233_1000103 Ga0209233_1000103205 278
389 3300028786 Ga0307517_10001070 Ga0307517_1000107022 278
390 3300046616 Ga0495668_0175886 Ga0495668_0175886_86_955 278
391 3300048925 Ga0496122_0003647 Ga0496122_0003647_12518_13381 278
392 3300048925 Ga0496122_0004775 Ga0496122_0004775_15458_16303 278
393 3300048926 Ga0496123_0000517 Ga0496123_0000517_59589_60452 278
394 3300048926 Ga0496123_0003777 Ga0496123_0003777_15458_16303 278
395 3300049822 Ga0501035_0362578 Ga0501035_0362578_323_1171 278
396 3300053094 Ga0500566_0151699 Ga0500566_0151699_275_1117 278
397 3300053104 Ga0500556_0000038 Ga0500556_0000038_87295_88134 278
398 3300053125 Ga0500618_000593 Ga0500618_000593_21336_22181 278
399 iso_pu_bacteria 2824653114 2824660096 278
400 3300001979 JGI24740J21852_10000644 JGI24740J21852_1000064413 279
401 3300002737 JGI25162J39368_1000424 JGI25162J39368_100042421 279
402 3300003214 JGI25165J46597_1000550 JGI25165J46597_100055015 279
403 3300003775 Ga0055524_1015288 Ga0055524_10152884 279
404 3300005548 Ga0070665_100086592 Ga0070665_1000865922 279
405 3300005614 Ga0068856_100037758 Ga0068856_1000377581 279
406 3300005616 Ga0068852_100036315 Ga0068852_1000363156 279
407 3300009093 Ga0105240_10000214 Ga0105240_1000021415 279
408 3300010375 Ga0105239_10001443 Ga0105239_1000144329 279
409 3300013104 Ga0157370_10000981 Ga0157370_1000098126 279
410 3300013105 Ga0157369_10617560 Ga0157369_106175601 279
411 3300025233 Ga0209437_100296 Ga0209437_10029625 279
412 3300025261 Ga0209233_1000393 Ga0209233_100039325 279
413 3300025273 Ga0209673_1012427 Ga0209673_10124272 279
414 3300025299 Ga0209256_1011881 Ga0209256_10118813 279
415 3300025913 Ga0207695_10006154 Ga0207695_100061544 279
416 3300026078 Ga0207702_10019435 Ga0207702_100194354 279
417 3300026142 Ga0207698_10081500 Ga0207698_100815004 279
418 3300028379 Ga0268266_10063083 Ga0268266_100630832 279
419 3300048905 Ga0496102_0034590 Ga0496102_0034590_2851_3690 279
420 3300048919 Ga0496116_0000798 Ga0496116_0000798_20411_21250 279
421 3300048920 Ga0496117_0003901 Ga0496117_0003901_295_1134 279
422 3300048921 Ga0496118_0009389 Ga0496118_0009389_295_1134 279
423 3300048922 Ga0496119_0003284 Ga0496119_0003284_295_1134 279
424 3300048922 Ga0496119_0006709 Ga0496119_0006709_2776_3615 279
425 3300048923 Ga0496120_0001767 Ga0496120_0001767_1030_1869 279
426 3300048923 Ga0496120_0020098 Ga0496120_0020098_1395_2234 279
427 3300048924 Ga0496121_0001058 Ga0496121_0001058_20518_21357 279
428 3300048925 Ga0496122_0004110 Ga0496122_0004110_9171_10010 279
429 3300048926 Ga0496123_0012128 Ga0496123_0012128_3622_4461 279
430 3300048927 Ga0496124_0001498 Ga0496124_0001498_17469_18308 279
431 3300048928 Ga0496125_0004596 Ga0496125_0004596_10302_11141 279
432 3300048929 Ga0496126_0006055 Ga0496126_0006055_12395_13234 279
433 3300053125 Ga0500618_003647 Ga0500618_003647_3109_3948 279
434 iso_pu_bacteria 8018150411 8018152876 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

194

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_C structure of a ferrichrome importer fhucdb from e. coli 0.9478 26 279
7lb8-assembly1.cif.gz_C structure of a ferrichrome importer fhucdb from e. coli 0.9406 26 279
5b58-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.9335 26 279
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.9289 26 279
4g1u-assembly1.cif.gz_D x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.9285 26 277
ID Description Score Start End Superfamily
af_P07821_3_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.983 21 275 3.40.50.300
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.974 26 279 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9727 25 269 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9695 27 277 3.40.50.300
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9627 26 279 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Y6BEB1-F1-model_v4 Iron complex transport system ATP-binding protein 0.9537 23 260 GO:0005524
GO:0016887
AF-A0A3D2CY35-F1-model_v4 deleted 0.9536 23 173
AF-A0A0R2E0W2-F1-model_v4 Iron ABC transporter ATP-binding protein 0.9528 24 235 GO:0005524
GO:0016887
AF-A0A527ZQM3-F1-model_v4 ABC transporter ATP-binding protein 0.9389 24 164 GO:0005524
GO:0016887
AF-A3PBX6-F1-model_v4 ABC transporter, ATP binding domain, possibly Mn transporter 0.9346 23 260 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.38 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map