F442957

General Info

Members Datasets Scaffolds Average Seq Length
433 202 432 275

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_156591_c1|nmdc:mga05p37_156591_c1_1354_2274
Length 306
Sequence MSTPLELTGLSRVFPTPTGPFIAVKDVNAMVEAGEFVAILGHSGCGKSTVLSIVAGLDRATLGGVIIDGKEVTGPGPERAIVFQAPCLLPWLTARQNVQIAASQGVEARSRRQAAVAADEYLDLVGITEAADQLPSQLSLGTQQCVSLARALAVEPRFLLLDEPFSQLDSLTRFELQDLLLRVWEQSASASRVASRPDPSSAAGPVRISGPATADRSGKTVVMVTHDIDEALYLADRLILMTDGPEATVGEVLTVPFPRPRVRSSVLSHPEYQACRRRVIDFLDHHAHQSRASALDTVLHGQVRAS

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 0.92
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003282 3300001977 Bacteria 2546
2 JGI25406J46586_10001634 3300003203 Bacteria 10574
3 Ga0065712_10000806 3300005290 Bacteria 15999
4 Ga0065712_10016804 3300005290 Bacteria 1711
5 Ga0065715_10098899 3300005293 Bacteria 3464
6 Ga0065707_10348821 3300005295 Bacteria 921
7 Ga0070676_10018816 3300005328 Bacteria 3833
8 Ga0070676_10078799 3300005328 Bacteria 1994
9 Ga0070676_10135511 3300005328 Bacteria 1562
10 Ga0070683_100173957 3300005329 Bacteria 2044
11 Ga0070690_100002747 3300005330 Bacteria 9499
12 Ga0070690_100190665 3300005330 Bacteria 1421
13 Ga0070690_100221971 3300005330 Bacteria 1324
14 Ga0070690_100272012 3300005330 Bacteria 1205
15 Ga0070670_100000802 3300005331 Bacteria 24446
16 Ga0070670_100034391 3300005331 Bacteria 4360
17 Ga0070670_100191172 3300005331 Bacteria 1778
18 Ga0070677_10009513 3300005333 Bacteria 3299
19 Ga0070677_10063334 3300005333 Bacteria 1533
20 Ga0068869_100000856 3300005334 Bacteria 17466
21 Ga0068869_100001388 3300005334 Bacteria 14291
22 Ga0068869_100111938 3300005334 Bacteria 2078
23 Ga0068869_100250723 3300005334 Bacteria 1414
24 Ga0070666_10013465 3300005335 Bacteria 5192
25 Ga0070666_10135843 3300005335 Bacteria 1711
26 Ga0070666_10167956 3300005335 Bacteria 1535
27 Ga0068868_100145641 3300005338 Bacteria 1947
28 Ga0068868_100187281 3300005338 Bacteria 1720
29 Ga0070689_100013119 3300005340 Bacteria 5989
30 Ga0070689_100324408 3300005340 Bacteria 1287
31 Ga0070687_100041751 3300005343 Bacteria 2320
32 Ga0070692_10259951 3300005345 Bacteria 1043
33 Ga0070668_100110338 3300005347 Bacteria 2189
34 Ga0070668_100111078 3300005347 Bacteria 2181
35 Ga0070669_100004104 3300005353 Bacteria 10556
36 Ga0070669_100100341 3300005353 Bacteria 2183
37 Ga0070669_100142155 3300005353 Bacteria 1851
38 Ga0070675_100001055 3300005354 Bacteria 19873
39 Ga0070675_100005559 3300005354 Bacteria 9650
40 Ga0070675_100032485 3300005354 Bacteria 4225
41 Ga0070675_100121775 3300005354 Bacteria 2217
42 Ga0070675_100170691 3300005354 Bacteria 1875
43 Ga0070675_100219761 3300005354 Bacteria 1654
44 Ga0070671_100056190 3300005355 Bacteria 3275
45 Ga0070674_100000181 3300005356 Bacteria 29542
46 Ga0070674_100038044 3300005356 Bacteria 3240
47 Ga0070673_100002907 3300005364 Bacteria 10553
48 Ga0070673_100009684 3300005364 Bacteria 6481
49 Ga0070673_100010513 3300005364 Bacteria 6266
50 Ga0070673_100113025 3300005364 Bacteria 2255
51 Ga0070688_100004013 3300005365 Bacteria 7634
52 Ga0070688_100032467 3300005365 Bacteria 3148
53 Ga0070688_100051860 3300005365 Bacteria 2560
54 Ga0070688_100388065 3300005365 Bacteria 1031
55 Ga0070659_100087256 3300005366 Bacteria 2498
56 Ga0070659_100190003 3300005366 Unclassified 1688
57 Ga0070667_100147372 3300005367 Bacteria 2065
58 Ga0070667_100208161 3300005367 Bacteria 1738
59 Ga0070709_10210736 3300005434 Bacteria 1381
60 Ga0070713_100141372 3300005436 Bacteria 2133
61 Ga0070713_100406747 3300005436 Bacteria 1272
62 Ga0070711_100058813 3300005439 Bacteria 2666
63 Ga0070705_100323065 3300005440 Bacteria 1115
64 Ga0070700_100016872 3300005441 Bacteria 4165
65 Ga0070694_100113595 3300005444 Bacteria 1933
66 Ga0070708_100015477 3300005445 Bacteria 6303
67 Ga0070663_100210885 3300005455 Bacteria 1521
68 Ga0070678_100176673 3300005456 Bacteria 1744
69 Ga0070662_100007904 3300005457 Bacteria 6915
70 Ga0070681_10353760 3300005458 Bacteria 1379
71 Ga0068867_100006898 3300005459 Bacteria 8038
72 Ga0068867_100227095 3300005459 Bacteria 1507
73 Ga0070685_10186968 3300005466 Bacteria 1337
74 Ga0070685_10233862 3300005466 Unclassified 1210
75 Ga0070707_100194119 3300005468 Bacteria 1980
76 Ga0070698_100011245 3300005471 Bacteria 9506
77 Ga0070698_100358966 3300005471 Bacteria 1389
78 Ga0070699_100008360 3300005518 Bacteria 8969
79 Ga0070699_100022221 3300005518 Bacteria 5465
80 Ga0070699_100212378 3300005518 Bacteria 1723
81 Ga0070684_100074282 3300005535 Bacteria 2997
82 Ga0070672_100015777 3300005543 Bacteria 5394
83 Ga0070672_100042524 3300005543 Bacteria 3499
84 Ga0070672_100049210 3300005543 Bacteria 3278
85 Ga0070672_100051913 3300005543 Bacteria 3199
86 Ga0070672_100169183 3300005543 Bacteria 1816
87 Ga0070672_100227913 3300005543 Bacteria 1564
88 Ga0070672_100540236 3300005543 Bacteria 1011
89 Ga0070686_100008202 3300005544 Bacteria 5847
90 Ga0070686_100343869 3300005544 Bacteria 1119
91 Ga0070696_100160848 3300005546 Bacteria 1654
92 Ga0070665_100006495 3300005548 Bacteria 11894
93 Ga0070704_100024348 3300005549 Bacteria 3972
94 Ga0070704_100040287 3300005549 Bacteria 3214
95 Ga0070704_100056537 3300005549 Bacteria 2786
96 Ga0070664_100008222 3300005564 Bacteria 8437
97 Ga0070664_100013134 3300005564 Bacteria 6741
98 Ga0070664_100451621 3300005564 Bacteria 1180
99 Ga0068859_100012484 3300005617 Bacteria 8545
100 Ga0068859_100043662 3300005617 Bacteria 4506
101 Ga0068859_100202767 3300005617 Bacteria 2068
102 Ga0068859_100423679 3300005617 Bacteria 1427
103 Ga0068859_100447345 3300005617 Unclassified 1388
104 Ga0068859_100566018 3300005617 Bacteria 1230
105 Ga0068864_100163211 3300005618 Bacteria 2026
106 Ga0068866_10001138 3300005718 Bacteria 11677
107 Ga0068861_100014321 3300005719 Bacteria 5562
108 Ga0068861_100093055 3300005719 Bacteria 2383
109 Ga0068851_10003382 3300005834 Bacteria 7099
110 Ga0068851_10136792 3300005834 Bacteria 1329
111 Ga0068870_10026151 3300005840 Bacteria 2907
112 Ga0068870_10086493 3300005840 Bacteria 1744
113 Ga0068870_10252892 3300005840 Bacteria 1093
114 Ga0068863_100284675 3300005841 Bacteria 1602
115 Ga0068858_100055021 3300005842 Bacteria 3678
116 Ga0068858_100272119 3300005842 Bacteria 1612
117 Ga0068858_100293630 3300005842 Bacteria 1550
118 Ga0068858_100465857 3300005842 Bacteria 1219
119 Ga0068860_100042292 3300005843 Bacteria 4353
120 Ga0068860_100064508 3300005843 Bacteria 3479
121 Ga0068860_100365170 3300005843 Bacteria 1423
122 Ga0068860_100374243 3300005843 Bacteria 1405
123 Ga0068862_100009185 3300005844 Bacteria 8188
124 Ga0068862_100014425 3300005844 Bacteria 6557
125 Ga0068862_100054005 3300005844 Bacteria 3440
126 Ga0068862_100062317 3300005844 Bacteria 3207
127 Ga0081539_10000108 3300005985 Bacteria 195322
128 Ga0081539_10002115 3300005985 Bacteria 29417
129 Ga0070712_100253943 3300006175 Bacteria 1406
130 Ga0075367_10026101 3300006178 Bacteria 3309
131 Ga0075366_10014774 3300006195 Bacteria 4466
132 Ga0097621_100000865 3300006237 Bacteria 21270
133 Ga0097621_100159863 3300006237 Bacteria 1936
134 Ga0068871_100000059 3300006358 Bacteria 59353
135 Ga0068871_100081776 3300006358 Bacteria 2677
136 Ga0068871_100736325 3300006358 Bacteria 905
137 Ga0075428_100007062 3300006844 Bacteria 12443
138 Ga0075428_100008678 3300006844 Bacteria 11274
139 Ga0075428_100032302 3300006844 Bacteria 5780
140 Ga0075428_100048984 3300006844 Bacteria 4636
141 Ga0075430_100004470 3300006846 Bacteria 11794
142 Ga0075430_100004629 3300006846 Bacteria 11573
143 Ga0075430_100005132 3300006846 Bacteria 11022
144 Ga0075430_100008204 3300006846 Bacteria 8820
145 Ga0075430_100026955 3300006846 Bacteria 4887
146 Ga0075430_100045456 3300006846 Bacteria 3710
147 Ga0075430_100127905 3300006846 Bacteria 2118
148 Ga0075430_100491579 3300006846 Bacteria 1012
149 Ga0075431_100008721 3300006847 Bacteria 10159
150 Ga0075431_100019478 3300006847 Bacteria 6918
151 Ga0075431_100036353 3300006847 Bacteria 5073
152 Ga0075431_100078743 3300006847 Bacteria 3402
153 Ga0075431_100079098 3300006847 Bacteria 3394
154 Ga0075431_100211171 3300006847 Bacteria 1982
155 Ga0075431_100366355 3300006847 Bacteria 1447
156 Ga0075433_10007068 3300006852 Bacteria 8892
157 Ga0075433_10032824 3300006852 Bacteria 4448
158 Ga0075433_10036616 3300006852 Bacteria 4228
159 Ga0075433_10058707 3300006852 Bacteria 3366
160 Ga0075433_10131016 3300006852 Bacteria 2228
161 Ga0075433_10304949 3300006852 Bacteria 1410
162 Ga0075434_100006011 3300006871 Bacteria 11106
163 Ga0075434_100052113 3300006871 Bacteria 4066
164 Ga0075434_100057737 3300006871 Bacteria 3857
165 Ga0075429_100003402 3300006880 Bacteria 13562
166 Ga0075429_100033454 3300006880 Bacteria 4467
167 Ga0075429_100195681 3300006880 Bacteria 1771
168 Ga0075429_100200768 3300006880 Bacteria 1747
169 Ga0068865_100008261 3300006881 Bacteria 6427
170 Ga0068865_100092145 3300006881 Bacteria 2201
171 Ga0068865_100578911 3300006881 Bacteria 946
172 Ga0097620_100012484 3300006931 Bacteria 8545
173 Ga0097620_100043663 3300006931 Bacteria 4506
174 Ga0097620_100202770 3300006931 Bacteria 2068
175 Ga0097620_100423687 3300006931 Bacteria 1427
176 Ga0097620_100447422 3300006931 Unclassified 1388
177 Ga0097620_100566009 3300006931 Bacteria 1230
178 Ga0075435_100454108 3300007076 Bacteria 1105
179 Ga0111539_10006095 3300009094 Bacteria 15565
180 Ga0111539_10006941 3300009094 Bacteria 14538
181 Ga0111539_10052300 3300009094 Bacteria 4862
182 Ga0111539_10075669 3300009094 Bacteria 3965
183 Ga0111539_10220010 3300009094 Bacteria 2212
184 Ga0111539_10244142 3300009094 Bacteria 2091
185 Ga0111539_10807668 3300009094 Bacteria 1092
186 Ga0105245_10065038 3300009098 Bacteria 3297
187 Ga0105245_10228398 3300009098 Bacteria 1799
188 Ga0114129_10010418 3300009147 Bacteria 13259
189 Ga0114129_10011274 3300009147 Bacteria 12740
190 Ga0114129_10013769 3300009147 Bacteria 11526
191 Ga0114129_10025601 3300009147 Bacteria 8359
192 Ga0114129_10038728 3300009147 Bacteria 6722
193 Ga0114129_10039698 3300009147 Bacteria 6637
194 Ga0114129_10089372 3300009147 Bacteria 4270
195 Ga0114129_10094978 3300009147 Bacteria 4129
196 Ga0114129_10502135 3300009147 Bacteria 1584
197 Ga0114129_10549824 3300009147 Bacteria 1501
198 Ga0105243_10023520 3300009148 Bacteria 4693
199 Ga0105243_10675716 3300009148 Bacteria 1004
200 Ga0105242_10018186 3300009176 Bacteria 5492
201 Ga0105242_10023478 3300009176 Bacteria 4859
202 Ga0105248_10044799 3300009177 Bacteria 4962
203 Ga0105248_10139072 3300009177 Bacteria 2739
204 Ga0105248_10157970 3300009177 Bacteria 2558
205 Ga0105248_10395985 3300009177 Bacteria 1555
206 Ga0105248_10549879 3300009177 Bacteria 1302
207 Ga0105238_10003023 3300009551 Bacteria 16786
208 Ga0105249_10010494 3300009553 Bacteria 8138
209 Ga0105246_10334541 3300011119 Bacteria 1235
210 Ga0157374_10449831 3300013296 Bacteria 1289
211 Ga0157378_10001288 3300013297 Bacteria 22567
212 Ga0163162_10012060 3300013306 Bacteria 8430
213 Ga0157375_10232019 3300013308 Bacteria 2004
214 Ga0163163_10026382 3300014325 Bacteria 5552
215 Ga0163163_10048310 3300014325 Bacteria 4184
216 Ga0163163_10140462 3300014325 Bacteria 2458
217 Ga0163163_10155886 3300014325 Bacteria 2328
218 Ga0157380_10009723 3300014326 Bacteria 6902
219 Ga0157380_10019533 3300014326 Bacteria 5050
220 Ga0157380_10049474 3300014326 Bacteria 3316
221 Ga0157380_10056953 3300014326 Bacteria 3110
222 Ga0157380_10063809 3300014326 Bacteria 2955
223 Ga0157377_10128980 3300014745 Bacteria 1542
224 Ga0157379_10144170 3300014968 Bacteria 2148
225 Ga0157376_10030353 3300014969 Bacteria 4316
226 Ga0157376_10060290 3300014969 Bacteria 3186
227 Ga0207697_10021897 3300025315 Bacteria 2619
228 Ga0207656_10047860 3300025321 Bacteria 1839
229 Ga0207682_10008052 3300025893 Bacteria 4183
230 Ga0207682_10033881 3300025893 Bacteria 2057
231 Ga0207642_10002373 3300025899 Bacteria 5864
232 Ga0207688_10004441 3300025901 Bacteria 7635
233 Ga0207680_10099123 3300025903 Bacteria 1869
234 Ga0207680_10166541 3300025903 Bacteria 1481
235 Ga0207645_10014021 3300025907 Bacteria 5376
236 Ga0207643_10021480 3300025908 Bacteria 3547
237 Ga0207643_10047106 3300025908 Bacteria 2437
238 Ga0207643_10165980 3300025908 Bacteria 1330
239 Ga0207643_10223038 3300025908 Bacteria 1154
240 Ga0207684_10337441 3300025910 Bacteria 1298
241 Ga0207662_10022592 3300025918 Bacteria 3608
242 Ga0207681_10111522 3300025923 Bacteria 1990
243 Ga0207681_10298688 3300025923 Bacteria 1273
244 Ga0207694_10016937 3300025924 Bacteria 5506
245 Ga0207650_10004024 3300025925 Bacteria 10058
246 Ga0207650_10022879 3300025925 Bacteria 4428
247 Ga0207650_10059955 3300025925 Bacteria 2838
248 Ga0207650_10403604 3300025925 Bacteria 1132
249 Ga0207659_10001341 3300025926 Bacteria 14725
250 Ga0207659_10002139 3300025926 Bacteria 11720
251 Ga0207659_10008976 3300025926 Bacteria 6233
252 Ga0207659_10031137 3300025926 Bacteria 3649
253 Ga0207659_10039268 3300025926 Bacteria 3300
254 Ga0207700_10035008 3300025928 Bacteria 3612
255 Ga0207644_10038956 3300025931 Bacteria 3352
256 Ga0207644_10329043 3300025931 Bacteria 1237
257 Ga0207690_10288641 3300025932 Bacteria 1280
258 Ga0207706_10007634 3300025933 Bacteria 9997
259 Ga0207706_10246462 3300025933 Unclassified 1561
260 Ga0207706_10610174 3300025933 Bacteria 937
261 Ga0207686_10001676 3300025934 Bacteria 12340
262 Ga0207670_10008502 3300025936 Bacteria 5801
263 Ga0207670_10052752 3300025936 Bacteria 2736
264 Ga0207669_10013958 3300025937 Bacteria 4011
265 Ga0207669_10070698 3300025937 Bacteria 2189
266 Ga0207669_10140847 3300025937 Bacteria 1674
267 Ga0207704_10062919 3300025938 Bacteria 2310
268 Ga0207704_10497285 3300025938 Bacteria 982
269 Ga0207691_10003677 3300025940 Bacteria 14884
270 Ga0207691_10054604 3300025940 Bacteria 3644
271 Ga0207691_10057718 3300025940 Bacteria 3532
272 Ga0207691_10078193 3300025940 Bacteria 2978
273 Ga0207691_10114792 3300025940 Bacteria 2392
274 Ga0207691_10160333 3300025940 Bacteria 1974
275 Ga0207691_10446132 3300025940 Bacteria 1101
276 Ga0207711_10019903 3300025941 Bacteria 5593
277 Ga0207711_10114096 3300025941 Bacteria 2406
278 Ga0207711_10274047 3300025941 Bacteria 1553
279 Ga0207689_10006232 3300025942 Bacteria 10565
280 Ga0207689_10012062 3300025942 Bacteria 7404
281 Ga0207689_10102059 3300025942 Bacteria 2356
282 Ga0207689_10129078 3300025942 Bacteria 2080
283 Ga0207689_10178159 3300025942 Bacteria 1753
284 Ga0207689_10196010 3300025942 Bacteria 1667
285 Ga0207679_10240782 3300025945 Bacteria 1533
286 Ga0207679_10269781 3300025945 Bacteria 1455
287 Ga0207679_10350611 3300025945 Bacteria 1286
288 Ga0207679_10418170 3300025945 Unclassified 1182
289 Ga0207667_10427249 3300025949 Bacteria 1348
290 Ga0207651_10002325 3300025960 Bacteria 9058
291 Ga0207651_10006774 3300025960 Bacteria 6038
292 Ga0207651_10062367 3300025960 Bacteria 2597
293 Ga0207651_10329282 3300025960 Bacteria 1279
294 Ga0207712_10138451 3300025961 Bacteria 1865
295 Ga0207668_10141078 3300025972 Bacteria 1853
296 Ga0207658_10093494 3300025986 Bacteria 2338
297 Ga0207677_10039182 3300026023 Bacteria 3114
298 Ga0207677_10106292 3300026023 Bacteria 2079
299 Ga0207677_10149708 3300026023 Bacteria 1799
300 Ga0207677_10165199 3300026023 Bacteria 1724
301 Ga0207703_10386056 3300026035 Bacteria 1296
302 Ga0207678_10292626 3300026067 Bacteria 1399
303 Ga0207708_10001215 3300026075 Bacteria 19449
304 Ga0207641_10256875 3300026088 Bacteria 1634
305 Ga0207648_10003495 3300026089 Bacteria 16460
306 Ga0207648_10047057 3300026089 Bacteria 3781
307 Ga0207648_10217809 3300026089 Bacteria 1696
308 Ga0207648_10267163 3300026089 Bacteria 1528
309 Ga0207676_10091534 3300026095 Bacteria 2499
310 Ga0207675_100002618 3300026118 Bacteria 17803
311 Ga0207675_100003622 3300026118 Bacteria 15060
312 Ga0207675_100082854 3300026118 Bacteria 3008
313 Ga0207675_100180932 3300026118 Bacteria 2019
314 Ga0207683_10184331 3300026121 Bacteria 1893
315 Ga0207683_10197195 3300026121 Bacteria 1829
316 Ga0210002_1031125 3300027617 Bacteria 887
317 Ga0207428_10001523 3300027907 Bacteria 24202
318 Ga0207428_10002292 3300027907 Bacteria 19191
319 Ga0207428_10343881 3300027907 Unclassified 1098
320 Ga0268265_10024706 3300028380 Bacteria 4255
321 Ga0268265_10086724 3300028380 Bacteria 2489
322 Ga0268265_10496455 3300028380 Bacteria 1149
323 Ga0268264_10065637 3300028381 Bacteria 3059
324 Ga0307408_100270146 3300031548 Bacteria 1411
325 Ga0307406_10296104 3300031901 Bacteria 1241
326 Ga0307407_10240299 3300031903 Bacteria 1235
327 Ga0307412_10035487 3300031911 Bacteria 3187
328 Ga0307412_10053299 3300031911 Bacteria 2681
329 Ga0307409_100502871 3300031995 Bacteria 1181
330 Ga0307416_100089490 3300032002 Bacteria 2636
331 Ga0307411_10010576 3300032005 Bacteria 4929
332 Ga0307411_10305336 3300032005 Bacteria 1278
333 Ga0307411_10313838 3300032005 Bacteria 1263
334 Ga0307415_100011680 3300032126 Bacteria 5040
335 Ga0373954_0220783 3300035118 Bacteria 932
336 Ga0373960_0018862 3300035121 Bacteria 1805
337 Ga0373943_0000751 3300035170 Bacteria 14122
338 Ga0373946_0005914 3300035171 Bacteria 4433
339 Ga0373955_0006664 3300035172 Bacteria 5269
340 Ga0373961_0047507 3300035241 Bacteria 1261
341 Ga0373962_0041509 3300035242 Bacteria 1297
342 Ga0373924_0005158 3300035410 Bacteria 4612
343 Ga0373925_0006947 3300037068 Bacteria 8279
344 Ga0439461_0046540 3300041410 Bacteria 951
345 Ga0439435_0029930 3300042436 Bacteria 1473
346 Ga0451577_0183426 3300042876 Bacteria 1887
347 Ga0451576_0055632 3300045051 Bacteria 4138
348 Ga0451576_0213190 3300045051 Bacteria 2017
349 Ga0495629_0280652 3300046459 Bacteria 1143
350 Ga0495580_0070724 3300046472 Bacteria 2438
351 Ga0495664_0068682 3300046477 Bacteria 2115
352 Ga0495594_0050373 3300046499 Bacteria 2290
353 Ga0495608_0041215 3300046511 Bacteria 3091
354 Ga0495628_0061096 3300046516 Bacteria 2955
355 Ga0495630_0010405 3300046517 Bacteria 6717
356 Ga0495587_0022859 3300046536 Bacteria 3847
357 Ga0495598_0035942 3300046537 Bacteria 1421
358 Ga0495588_0021211 3300046674 Bacteria 3199
359 Ga0495588_0136905 3300046674 Bacteria 1293
360 Ga0495658_0233064 3300046683 Bacteria 1155
361 Ga0495669_0004530 3300046684 Bacteria 5748
362 Ga0495613_0004058 3300046689 Bacteria 10955
363 Ga0495613_0200249 3300046689 Bacteria 1408
364 Ga0495600_0093642 3300046809 Bacteria 1959
365 Ga0495581_0102584 3300047315 Bacteria 1662
366 Ga0495604_0049008 3300047317 Bacteria 3284
367 Ga0495674_0033229 3300047319 Bacteria 4674
368 Ga0495680_0031953 3300047322 Bacteria 4279
369 Ga0495684_0001164 3300047471 Bacteria 21155
370 Ga0495684_0273660 3300047471 Bacteria 1221
371 Ga0496104_0242246 3300048907 Bacteria 1716
372 Ga0496109_0071658 3300048912 Bacteria 3182
373 Ga0496113_0137255 3300048916 Bacteria 1922
374 Ga0501032_0114296 3300049569 Bacteria 1785
375 Ga0501033_0000985 3300049570 Bacteria 25904
376 Ga0501034_0048376 3300049571 Bacteria 4292
377 Ga0501037_0016674 3300049573 Bacteria 5407
378 Ga0501038_0191791 3300049574 Bacteria 1644
379 Ga0501043_0419034 3300049579 Bacteria 1010
380 Ga0501046_0002526 3300049580 Bacteria 17117
381 Ga0501048_0074789 3300049582 Bacteria 2390
382 Ga0501080_0120998 3300049742 Bacteria 2425
383 Ga0501044_0121100 3300049823 Bacteria 2617
384 nmdc:mga0k408_78882_c1 3300050493 Bacteria 1927
385 nmdc:mga06z11_65191_c1 3300050494 Bacteria 1911
386 nmdc:mga05p37_156591_c1 3300050507 Bacteria 2783
387 nmdc:mga05p37_26518_c1 3300050507 Bacteria 7047
388 nmdc:mga05p37_28819_c1 3300050507 Bacteria 6773
389 nmdc:mga05p37_430640_c1 3300050507 Bacteria 1533
390 nmdc:mga05p37_4811_c1 3300050507 Bacteria 15794
391 nmdc:mga05p37_5649_c1 3300050507 Bacteria 14708
392 nmdc:mga05p37_73743_c1 3300050507 Bacteria 4201
393 nmdc:mga05p37_83989_c1 3300050507 Bacteria 3923
394 nmdc:mga05p37_96873_c1 3300050507 Bacteria 3635
395 nmdc:mga09592_32740_c1 3300050508 Bacteria 4334
396 nmdc:mga09592_5178_c1 3300050508 Bacteria 10597
397 nmdc:mga09592_66103_c1 3300050508 Bacteria 3064
398 nmdc:mga09592_76501_c1 3300050508 Bacteria 2846
399 nmdc:mga0qj67_2196_c1 3300050509 Bacteria 13870
400 nmdc:mga0qj67_4475_c1 3300050509 Bacteria 10126
401 nmdc:mga0qj67_4505_c1 3300050509 Bacteria 10095
402 nmdc:mga0qj67_4569_c1 3300050509 Bacteria 10036
403 nmdc:mga0qj67_46868_c1 3300050509 Bacteria 3413
404 nmdc:mga0qj67_49221_c1 3300050509 Bacteria 3331
405 nmdc:mga06r32_203050_c1 3300050510 Bacteria 1970
406 nmdc:mga06r32_32347_c1 3300050510 Bacteria 4920
407 nmdc:mga06r32_391834_c1 3300050510 Bacteria 1371
408 nmdc:mga06r32_4143_c1 3300050510 Bacteria 12982
409 nmdc:mga06r32_49702_c1 3300050510 Bacteria 4011
410 nmdc:mga06r32_60246_c1 3300050510 Bacteria 3653
411 nmdc:mga06r32_83881_c1 3300050510 Bacteria 3105
412 nmdc:mga08y16_104525_c1 3300050511 Bacteria 2948
413 nmdc:mga08y16_13770_c1 3300050511 Bacteria 8514
414 nmdc:mga08y16_147951_c1 3300050511 Bacteria 2441
415 nmdc:mga08y16_445763_c1 3300050511 Bacteria 1321
416 nmdc:mga08y16_635790_c1 3300050511 Bacteria 1073
417 nmdc:mga08y16_785450_c1 3300050511 Bacteria 946
418 nmdc:mga0n895_122821_c1 3300050512 Bacteria 2618
419 nmdc:mga0n895_50513_c1 3300050512 Bacteria 4077
420 nmdc:mga0n895_66607_c1 3300050512 Bacteria 3566
421 nmdc:mga0n895_85981_c1 3300050512 Bacteria 3141
422 nmdc:mga0rr50_107603_c1 3300050513 Bacteria 2201
423 nmdc:mga0rr50_338523_c1 3300050513 Bacteria 1264
424 nmdc:mga0a205_11792_c1 3300050515 Bacteria 8065
425 nmdc:mga0a205_214473_c1 3300050515 Bacteria 1812
426 nmdc:mga0a205_229778_c1 3300050515 Bacteria 1739
427 nmdc:mga0a205_33289_c1 3300050515 Bacteria 4942
428 nmdc:mga0a205_455736_c1 3300050515 Unclassified 1139
429 nmdc:mga0a205_67722_c1 3300050515 Bacteria 3449
430 Ga0495601_0006402 3300053077 Bacteria 6886
431 Ga0495619_0009733 3300053085 Bacteria 6059
432 Ga0500642_0070701 3300053130 Bacteria 1587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0419034 Ga0501043_0419034_39_767 220
2 3300050509 nmdc:mga0qj67_46868_c1 nmdc:mga0qj67_46868_c1_47_793 247
3 3300050511 nmdc:mga08y16_785450_c1 nmdc:mga08y16_785450_c1_22_783 248
4 3300005471 Ga0070698_100011245 Ga0070698_1000112455 252
5 3300005518 Ga0070699_100008360 Ga0070699_1000083605 252
6 3300005549 Ga0070704_100024348 Ga0070704_1000243483 252
7 3300005543 Ga0070672_100540236 Ga0070672_1005402361 253
8 3300025940 Ga0207691_10446132 Ga0207691_104461322 253
9 3300009147 Ga0114129_10089372 Ga0114129_100893722 256
10 3300050507 nmdc:mga05p37_430640_c1 nmdc:mga05p37_430640_c1_555_1409 256
11 3300009147 Ga0114129_10010418 Ga0114129_100104185 257
12 3300031995 Ga0307409_100502871 Ga0307409_1005028712 257
13 3300050507 nmdc:mga05p37_26518_c1 nmdc:mga05p37_26518_c1_4977_5750 257
14 3300050512 nmdc:mga0n895_122821_c1 nmdc:mga0n895_122821_c1_969_1742 257
15 3300050515 nmdc:mga0a205_214473_c1 nmdc:mga0a205_214473_c1_809_1582 257
16 3300014326 Ga0157380_10049474 Ga0157380_100494742 260
17 3300005331 Ga0070670_100191172 Ga0070670_1001911722 261
18 3300005466 Ga0070685_10186968 Ga0070685_101869681 261
19 3300005564 Ga0070664_100451621 Ga0070664_1004516211 261
20 3300005617 Ga0068859_100012484 Ga0068859_1000124844 261
21 3300005843 Ga0068860_100064508 Ga0068860_1000645084 261
22 3300006846 Ga0075430_100026955 Ga0075430_1000269553 261
23 3300006881 Ga0068865_100092145 Ga0068865_1000921451 261
24 3300006881 Ga0068865_100578911 Ga0068865_1005789111 261
25 3300006931 Ga0097620_100012484 Ga0097620_1000124844 261
26 3300028381 Ga0268264_10065637 Ga0268264_100656372 261
27 3300050509 nmdc:mga0qj67_49221_c1 nmdc:mga0qj67_49221_c1_1077_1907 261
28 3300005364 Ga0070673_100002907 Ga0070673_1000029072 262
29 3300005458 Ga0070681_10353760 Ga0070681_103537602 262
30 3300005617 Ga0068859_100423679 Ga0068859_1004236792 262
31 3300005842 Ga0068858_100272119 Ga0068858_1002721192 262
32 3300005843 Ga0068860_100365170 Ga0068860_1003651702 262
33 3300006358 Ga0068871_100736325 Ga0068871_1007363251 262
34 3300006852 Ga0075433_10058707 Ga0075433_100587074 262
35 3300006931 Ga0097620_100423687 Ga0097620_1004236872 262
36 3300009147 Ga0114129_10025601 Ga0114129_100256015 262
37 3300009177 Ga0105248_10139072 Ga0105248_101390722 262
38 3300025941 Ga0207711_10019903 Ga0207711_100199032 262
39 3300025942 Ga0207689_10102059 Ga0207689_101020592 262
40 3300025960 Ga0207651_10062367 Ga0207651_100623672 262
41 3300026089 Ga0207648_10267163 Ga0207648_102671632 262
42 3300026118 Ga0207675_100180932 Ga0207675_1001809322 262
43 3300050507 nmdc:mga05p37_5649_c1 nmdc:mga05p37_5649_c1_5643_6431 262
44 3300050515 nmdc:mga0a205_67722_c1 nmdc:mga0a205_67722_c1_2440_3228 262
45 3300005548 Ga0070665_100006495 Ga0070665_1000064951 263
46 3300006847 Ga0075431_100036353 Ga0075431_1000363532 263
47 3300050510 nmdc:mga06r32_32347_c1 nmdc:mga06r32_32347_c1_3179_3982 263
48 3300005445 Ga0070708_100015477 Ga0070708_1000154773 264
49 3300005543 Ga0070672_100169183 Ga0070672_1001691832 264
50 3300005546 Ga0070696_100160848 Ga0070696_1001608482 264
51 3300006847 Ga0075431_100079098 Ga0075431_1000790982 264
52 3300006852 Ga0075433_10304949 Ga0075433_103049492 264
53 3300025910 Ga0207684_10337441 Ga0207684_103374412 264
54 3300025940 Ga0207691_10114792 Ga0207691_101147921 264
55 3300025942 Ga0207689_10196010 Ga0207689_101960102 264
56 3300025945 Ga0207679_10350611 Ga0207679_103506112 264
57 3300050510 nmdc:mga06r32_83881_c1 nmdc:mga06r32_83881_c1_362_1168 264
58 3300005345 Ga0070692_10259951 Ga0070692_102599512 268
59 3300006846 Ga0075430_100045456 Ga0075430_1000454562 269
60 3300006847 Ga0075431_100078743 Ga0075431_1000787434 269
61 3300009177 Ga0105248_10157970 Ga0105248_101579703 269
62 3300050508 nmdc:mga09592_66103_c1 nmdc:mga09592_66103_c1_1010_1828 269
63 3300050510 nmdc:mga06r32_203050_c1 nmdc:mga06r32_203050_c1_686_1504 269
64 iso_pu_bacteria 2786546517 2787436870 269
65 3300005436 Ga0070713_100141372 Ga0070713_1001413722 270
66 3300005439 Ga0070711_100058813 Ga0070711_1000588133 270
67 3300006175 Ga0070712_100253943 Ga0070712_1002539433 270
68 3300006852 Ga0075433_10036616 Ga0075433_100366162 270
69 3300009094 Ga0111539_10220010 Ga0111539_102200102 270
70 3300009094 Ga0111539_10807668 Ga0111539_108076681 270
71 3300009147 Ga0114129_10038728 Ga0114129_100387283 270
72 3300025925 Ga0207650_10403604 Ga0207650_104036041 270
73 3300025928 Ga0207700_10035008 Ga0207700_100350084 270
74 3300035170 Ga0373943_0000751 Ga0373943_0000751_11065_11895 270
75 3300035171 Ga0373946_0005914 Ga0373946_0005914_2040_2870 270
76 3300035172 Ga0373955_0006664 Ga0373955_0006664_4192_5022 270
77 3300035410 Ga0373924_0005158 Ga0373924_0005158_376_1206 270
78 3300037068 Ga0373925_0006947 Ga0373925_0006947_2166_2996 270
79 3300042876 Ga0451577_0183426 Ga0451577_0183426_945_1808 270
80 3300046459 Ga0495629_0280652 Ga0495629_0280652_297_1127 270
81 3300046472 Ga0495580_0070724 Ga0495580_0070724_1092_1922 270
82 3300046477 Ga0495664_0068682 Ga0495664_0068682_108_938 270
83 3300046511 Ga0495608_0041215 Ga0495608_0041215_1512_2342 270
84 3300046516 Ga0495628_0061096 Ga0495628_0061096_1092_1922 270
85 3300046517 Ga0495630_0010405 Ga0495630_0010405_2124_2954 270
86 3300046536 Ga0495587_0022859 Ga0495587_0022859_2960_3790 270
87 3300046683 Ga0495658_0233064 Ga0495658_0233064_61_891 270
88 3300046684 Ga0495669_0004530 Ga0495669_0004530_4074_4916 270
89 3300046689 Ga0495613_0004058 Ga0495613_0004058_1708_2538 270
90 3300046689 Ga0495613_0200249 Ga0495613_0200249_11_841 270
91 3300046809 Ga0495600_0093642 Ga0495600_0093642_699_1529 270
92 3300047317 Ga0495604_0049008 Ga0495604_0049008_939_1769 270
93 3300047319 Ga0495674_0033229 Ga0495674_0033229_2808_3638 270
94 3300047322 Ga0495680_0031953 Ga0495680_0031953_1860_2690 270
95 3300047471 Ga0495684_0001164 Ga0495684_0001164_18980_19810 270
96 3300047471 Ga0495684_0273660 Ga0495684_0273660_50_880 270
97 3300050507 nmdc:mga05p37_73743_c1 nmdc:mga05p37_73743_c1_2521_3342 270
98 3300050515 nmdc:mga0a205_33289_c1 nmdc:mga0a205_33289_c1_3820_4641 270
99 3300053077 Ga0495601_0006402 Ga0495601_0006402_2039_2869 270
100 3300053085 Ga0495619_0009733 Ga0495619_0009733_4625_5455 270
101 3300005330 Ga0070690_100190665 Ga0070690_1001906651 271
102 3300005334 Ga0068869_100250723 Ga0068869_1002507231 271
103 3300005335 Ga0070666_10135843 Ga0070666_101358432 271
104 3300005338 Ga0068868_100145641 Ga0068868_1001456411 271
105 3300005347 Ga0070668_100110338 Ga0070668_1001103383 271
106 3300005434 Ga0070709_10210736 Ga0070709_102107362 271
107 3300005842 Ga0068858_100055021 Ga0068858_1000550213 271
108 3300006847 Ga0075431_100211171 Ga0075431_1002111712 271
109 3300006852 Ga0075433_10032824 Ga0075433_100328245 271
110 3300006871 Ga0075434_100006011 Ga0075434_1000060112 271
111 3300006880 Ga0075429_100200768 Ga0075429_1002007682 271
112 3300006881 Ga0068865_100008261 Ga0068865_1000082615 271
113 3300009098 Ga0105245_10065038 Ga0105245_100650382 271
114 3300009147 Ga0114129_10039698 Ga0114129_100396982 271
115 3300009147 Ga0114129_10549824 Ga0114129_105498242 271
116 3300009176 Ga0105242_10018186 Ga0105242_100181863 271
117 3300013308 Ga0157375_10232019 Ga0157375_102320193 271
118 3300025903 Ga0207680_10099123 Ga0207680_100991232 271
119 3300025940 Ga0207691_10160333 Ga0207691_101603333 271
120 3300026023 Ga0207677_10165199 Ga0207677_101651992 271
121 3300026089 Ga0207648_10047057 Ga0207648_100470571 271
122 3300026089 Ga0207648_10217809 Ga0207648_102178092 271
123 3300032005 Ga0307411_10313838 Ga0307411_103138382 271
124 3300050507 nmdc:mga05p37_96873_c1 nmdc:mga05p37_96873_c1_955_1785 271
125 3300050512 nmdc:mga0n895_85981_c1 nmdc:mga0n895_85981_c1_218_1048 271
126 3300050515 nmdc:mga0a205_229778_c1 nmdc:mga0a205_229778_c1_191_1021 271
127 3300005290 Ga0065712_10000806 Ga0065712_100008066 272
128 3300005329 Ga0070683_100173957 Ga0070683_1001739572 272
129 3300005354 Ga0070675_100005559 Ga0070675_1000055597 272
130 3300005365 Ga0070688_100032467 Ga0070688_1000324674 272
131 3300005365 Ga0070688_100388065 Ga0070688_1003880651 272
132 3300005366 Ga0070659_100190003 Ga0070659_1001900032 272
133 3300005444 Ga0070694_100113595 Ga0070694_1001135952 272
134 3300005466 Ga0070685_10233862 Ga0070685_102338621 272
135 3300005471 Ga0070698_100358966 Ga0070698_1003589662 272
136 3300005535 Ga0070684_100074282 Ga0070684_1000742823 272
137 3300005617 Ga0068859_100447345 Ga0068859_1004473452 272
138 3300006178 Ga0075367_10026101 Ga0075367_100261012 272
139 3300006195 Ga0075366_10014774 Ga0075366_100147745 272
140 3300006237 Ga0097621_100000865 Ga0097621_1000008659 272
141 3300006237 Ga0097621_100159863 Ga0097621_1001598633 272
142 3300006358 Ga0068871_100000059 Ga0068871_10000005956 272
143 3300006846 Ga0075430_100004470 Ga0075430_1000044702 272
144 3300006846 Ga0075430_100005132 Ga0075430_1000051329 272
145 3300006847 Ga0075431_100008721 Ga0075431_1000087219 272
146 3300006852 Ga0075433_10131016 Ga0075433_101310161 272
147 3300006871 Ga0075434_100057737 Ga0075434_1000577373 272
148 3300006880 Ga0075429_100033454 Ga0075429_1000334544 272
149 3300006931 Ga0097620_100447422 Ga0097620_1004474222 272
150 3300007076 Ga0075435_100454108 Ga0075435_1004541082 272
151 3300009094 Ga0111539_10075669 Ga0111539_100756694 272
152 3300009147 Ga0114129_10011274 Ga0114129_1001127413 272
153 3300009147 Ga0114129_10502135 Ga0114129_105021351 272
154 3300009148 Ga0105243_10675716 Ga0105243_106757162 272
155 3300014969 Ga0157376_10030353 Ga0157376_100303532 272
156 3300014969 Ga0157376_10060290 Ga0157376_100602902 272
157 3300025925 Ga0207650_10059955 Ga0207650_100599553 272
158 3300025926 Ga0207659_10001341 Ga0207659_100013418 272
159 3300025933 Ga0207706_10246462 Ga0207706_102464621 272
160 3300025945 Ga0207679_10269781 Ga0207679_102697812 272
161 3300025945 Ga0207679_10418170 Ga0207679_104181701 272
162 3300025949 Ga0207667_10427249 Ga0207667_104272492 272
163 3300027907 Ga0207428_10343881 Ga0207428_103438812 272
164 3300028380 Ga0268265_10086724 Ga0268265_100867243 272
165 3300031903 Ga0307407_10240299 Ga0307407_102402991 272
166 3300031911 Ga0307412_10053299 Ga0307412_100532993 272
167 3300032002 Ga0307416_100089490 Ga0307416_1000894902 272
168 3300032005 Ga0307411_10305336 Ga0307411_103053361 272
169 3300035118 Ga0373954_0220783 Ga0373954_0220783_67_906 272
170 3300041410 Ga0439461_0046540 Ga0439461_0046540_20_838 272
171 3300042436 Ga0439435_0029930 Ga0439435_0029930_327_1172 272
172 3300045051 Ga0451576_0213190 Ga0451576_0213190_237_1076 272
173 3300046499 Ga0495594_0050373 Ga0495594_0050373_803_1642 272
174 3300046674 Ga0495588_0021211 Ga0495588_0021211_1278_2117 272
175 3300047315 Ga0495581_0102584 Ga0495581_0102584_399_1238 272
176 3300048907 Ga0496104_0242246 Ga0496104_0242246_243_1076 272
177 3300048912 Ga0496109_0071658 Ga0496109_0071658_276_1109 272
178 3300048916 Ga0496113_0137255 Ga0496113_0137255_306_1139 272
179 3300049569 Ga0501032_0114296 Ga0501032_0114296_891_1775 272
180 3300049570 Ga0501033_0000985 Ga0501033_0000985_6868_7752 272
181 3300049573 Ga0501037_0016674 Ga0501037_0016674_119_1003 272
182 3300049574 Ga0501038_0191791 Ga0501038_0191791_469_1353 272
183 3300049580 Ga0501046_0002526 Ga0501046_0002526_8747_9631 272
184 3300049582 Ga0501048_0074789 Ga0501048_0074789_509_1393 272
185 3300049742 Ga0501080_0120998 Ga0501080_0120998_1321_2205 272
186 3300049823 Ga0501044_0121100 Ga0501044_0121100_735_1619 272
187 3300050493 nmdc:mga0k408_78882_c1 nmdc:mga0k408_78882_c1_498_1316 272
188 3300050494 nmdc:mga06z11_65191_c1 nmdc:mga06z11_65191_c1_390_1208 272
189 3300050507 nmdc:mga05p37_4811_c1 nmdc:mga05p37_4811_c1_3769_4602 272
190 3300050508 nmdc:mga09592_32740_c1 nmdc:mga09592_32740_c1_3234_4067 272
191 3300050509 nmdc:mga0qj67_2196_c1 nmdc:mga0qj67_2196_c1_10240_11070 272
192 3300050509 nmdc:mga0qj67_4505_c1 nmdc:mga0qj67_4505_c1_3030_3863 272
193 3300050510 nmdc:mga06r32_60246_c1 nmdc:mga06r32_60246_c1_462_1295 272
194 3300050511 nmdc:mga08y16_104525_c1 nmdc:mga08y16_104525_c1_1500_2333 272
195 3300050511 nmdc:mga08y16_635790_c1 nmdc:mga08y16_635790_c1_232_1056 272
196 3300050512 nmdc:mga0n895_66607_c1 nmdc:mga0n895_66607_c1_894_1733 272
197 3300050513 nmdc:mga0rr50_338523_c1 nmdc:mga0rr50_338523_c1_294_1133 272
198 3300050515 nmdc:mga0a205_455736_c1 nmdc:mga0a205_455736_c1_245_1078 272
199 3300053130 Ga0500642_0070701 Ga0500642_0070701_20_895 272
200 3300003203 JGI25406J46586_10001634 JGI25406J46586_100016345 273
201 3300005290 Ga0065712_10016804 Ga0065712_100168041 273
202 3300005328 Ga0070676_10018816 Ga0070676_100188164 273
203 3300005330 Ga0070690_100002747 Ga0070690_1000027472 273
204 3300005330 Ga0070690_100272012 Ga0070690_1002720121 273
205 3300005331 Ga0070670_100000802 Ga0070670_1000008025 273
206 3300005331 Ga0070670_100034391 Ga0070670_1000343911 273
207 3300005333 Ga0070677_10063334 Ga0070677_100633342 273
208 3300005334 Ga0068869_100000856 Ga0068869_1000008566 273
209 3300005335 Ga0070666_10167956 Ga0070666_101679562 273
210 3300005340 Ga0070689_100324408 Ga0070689_1003244082 273
211 3300005353 Ga0070669_100100341 Ga0070669_1001003412 273
212 3300005354 Ga0070675_100001055 Ga0070675_1000010557 273
213 3300005354 Ga0070675_100032485 Ga0070675_1000324855 273
214 3300005354 Ga0070675_100219761 Ga0070675_1002197612 273
215 3300005355 Ga0070671_100056190 Ga0070671_1000561902 273
216 3300005356 Ga0070674_100038044 Ga0070674_1000380443 273
217 3300005364 Ga0070673_100009684 Ga0070673_1000096842 273
218 3300005364 Ga0070673_100113025 Ga0070673_1001130253 273
219 3300005365 Ga0070688_100051860 Ga0070688_1000518603 273
220 3300005436 Ga0070713_100406747 Ga0070713_1004067471 273
221 3300005440 Ga0070705_100323065 Ga0070705_1003230651 273
222 3300005441 Ga0070700_100016872 Ga0070700_1000168725 273
223 3300005459 Ga0068867_100006898 Ga0068867_1000068982 273
224 3300005518 Ga0070699_100022221 Ga0070699_1000222213 273
225 3300005543 Ga0070672_100042524 Ga0070672_1000425243 273
226 3300005543 Ga0070672_100049210 Ga0070672_1000492102 273
227 3300005543 Ga0070672_100051913 Ga0070672_1000519133 273
228 3300005543 Ga0070672_100227913 Ga0070672_1002279132 273
229 3300005544 Ga0070686_100343869 Ga0070686_1003438692 273
230 3300005549 Ga0070704_100040287 Ga0070704_1000402872 273
231 3300005549 Ga0070704_100056537 Ga0070704_1000565372 273
232 3300005564 Ga0070664_100008222 Ga0070664_1000082224 273
233 3300005564 Ga0070664_100013134 Ga0070664_1000131341 273
234 3300005617 Ga0068859_100043662 Ga0068859_1000436621 273
235 3300005617 Ga0068859_100566018 Ga0068859_1005660182 273
236 3300005618 Ga0068864_100163211 Ga0068864_1001632112 273
237 3300005718 Ga0068866_10001138 Ga0068866_100011386 273
238 3300005719 Ga0068861_100093055 Ga0068861_1000930552 273
239 3300005834 Ga0068851_10003382 Ga0068851_100033824 273
240 3300005840 Ga0068870_10026151 Ga0068870_100261512 273
241 3300005841 Ga0068863_100284675 Ga0068863_1002846752 273
242 3300005842 Ga0068858_100465857 Ga0068858_1004658572 273
243 3300005843 Ga0068860_100042292 Ga0068860_1000422922 273
244 3300005844 Ga0068862_100014425 Ga0068862_1000144253 273
245 3300005844 Ga0068862_100054005 Ga0068862_1000540052 273
246 3300005985 Ga0081539_10000108 Ga0081539_1000010860 273
247 3300005985 Ga0081539_10002115 Ga0081539_1000211510 273
248 3300006358 Ga0068871_100081776 Ga0068871_1000817762 273
249 3300006844 Ga0075428_100008678 Ga0075428_1000086786 273
250 3300006844 Ga0075428_100048984 Ga0075428_1000489842 273
251 3300006846 Ga0075430_100004629 Ga0075430_1000046295 273
252 3300006846 Ga0075430_100127905 Ga0075430_1001279051 273
253 3300006846 Ga0075430_100491579 Ga0075430_1004915791 273
254 3300006931 Ga0097620_100043663 Ga0097620_1000436631 273
255 3300006931 Ga0097620_100566009 Ga0097620_1005660092 273
256 3300009094 Ga0111539_10052300 Ga0111539_100523002 273
257 3300009098 Ga0105245_10228398 Ga0105245_102283982 273
258 3300009147 Ga0114129_10013769 Ga0114129_100137698 273
259 3300009148 Ga0105243_10023520 Ga0105243_100235203 273
260 3300009176 Ga0105242_10023478 Ga0105242_100234783 273
261 3300009177 Ga0105248_10044799 Ga0105248_100447994 273
262 3300009177 Ga0105248_10395985 Ga0105248_103959852 273
263 3300009551 Ga0105238_10003023 Ga0105238_100030237 273
264 3300013297 Ga0157378_10001288 Ga0157378_1000128813 273
265 3300014325 Ga0163163_10026382 Ga0163163_100263825 273
266 3300014325 Ga0163163_10048310 Ga0163163_100483104 273
267 3300014325 Ga0163163_10140462 Ga0163163_101404623 273
268 3300014325 Ga0163163_10155886 Ga0163163_101558862 273
269 3300014326 Ga0157380_10019533 Ga0157380_100195331 273
270 3300014326 Ga0157380_10063809 Ga0157380_100638092 273
271 3300025321 Ga0207656_10047860 Ga0207656_100478602 273
272 3300025893 Ga0207682_10033881 Ga0207682_100338812 273
273 3300025899 Ga0207642_10002373 Ga0207642_100023735 273
274 3300025907 Ga0207645_10014021 Ga0207645_100140213 273
275 3300025908 Ga0207643_10021480 Ga0207643_100214803 273
276 3300025908 Ga0207643_10165980 Ga0207643_101659801 273
277 3300025923 Ga0207681_10111522 Ga0207681_101115222 273
278 3300025924 Ga0207694_10016937 Ga0207694_100169372 273
279 3300025925 Ga0207650_10004024 Ga0207650_100040248 273
280 3300025925 Ga0207650_10022879 Ga0207650_100228793 273
281 3300025926 Ga0207659_10002139 Ga0207659_100021395 273
282 3300025926 Ga0207659_10031137 Ga0207659_100311372 273
283 3300025926 Ga0207659_10039268 Ga0207659_100392682 273
284 3300025931 Ga0207644_10038956 Ga0207644_100389562 273
285 3300025931 Ga0207644_10329043 Ga0207644_103290431 273
286 3300025934 Ga0207686_10001676 Ga0207686_1000167611 273
287 3300025936 Ga0207670_10052752 Ga0207670_100527521 273
288 3300025937 Ga0207669_10070698 Ga0207669_100706982 273
289 3300025937 Ga0207669_10140847 Ga0207669_101408472 273
290 3300025938 Ga0207704_10062919 Ga0207704_100629192 273
291 3300025938 Ga0207704_10497285 Ga0207704_104972851 273
292 3300025940 Ga0207691_10054604 Ga0207691_100546042 273
293 3300025940 Ga0207691_10057718 Ga0207691_100577183 273
294 3300025940 Ga0207691_10078193 Ga0207691_100781933 273
295 3300025941 Ga0207711_10114096 Ga0207711_101140962 273
296 3300025942 Ga0207689_10012062 Ga0207689_100120622 273
297 3300025942 Ga0207689_10178159 Ga0207689_101781592 273
298 3300025960 Ga0207651_10006774 Ga0207651_100067746 273
299 3300025960 Ga0207651_10329282 Ga0207651_103292822 273
300 3300026023 Ga0207677_10039182 Ga0207677_100391822 273
301 3300026075 Ga0207708_10001215 Ga0207708_100012155 273
302 3300026088 Ga0207641_10256875 Ga0207641_102568752 273
303 3300026089 Ga0207648_10003495 Ga0207648_100034956 273
304 3300026095 Ga0207676_10091534 Ga0207676_100915343 273
305 3300026118 Ga0207675_100003622 Ga0207675_10000362214 273
306 3300026118 Ga0207675_100082854 Ga0207675_1000828543 273
307 3300026121 Ga0207683_10197195 Ga0207683_101971952 273
308 3300027907 Ga0207428_10002292 Ga0207428_100022924 273
309 3300028380 Ga0268265_10496455 Ga0268265_104964551 273
310 3300031911 Ga0307412_10035487 Ga0307412_100354872 273
311 3300046674 Ga0495588_0136905 Ga0495588_0136905_305_1141 273
312 3300050508 nmdc:mga09592_76501_c1 nmdc:mga09592_76501_c1_1227_2060 273
313 3300050509 nmdc:mga0qj67_4475_c1 nmdc:mga0qj67_4475_c1_7292_8125 273
314 3300050510 nmdc:mga06r32_391834_c1 nmdc:mga06r32_391834_c1_316_1146 273
315 3300050511 nmdc:mga08y16_147951_c1 nmdc:mga08y16_147951_c1_258_1088 273
316 3300001977 JGI24746J21847_1003282 JGI24746J21847_10032823 274
317 3300005293 Ga0065715_10098899 Ga0065715_100988991 274
318 3300005295 Ga0065707_10348821 Ga0065707_103488211 274
319 3300005328 Ga0070676_10078799 Ga0070676_100787993 274
320 3300005328 Ga0070676_10135511 Ga0070676_101355112 274
321 3300005330 Ga0070690_100221971 Ga0070690_1002219712 274
322 3300005333 Ga0070677_10009513 Ga0070677_100095134 274
323 3300005334 Ga0068869_100001388 Ga0068869_1000013882 274
324 3300005334 Ga0068869_100111938 Ga0068869_1001119382 274
325 3300005335 Ga0070666_10013465 Ga0070666_100134651 274
326 3300005338 Ga0068868_100187281 Ga0068868_1001872811 274
327 3300005340 Ga0070689_100013119 Ga0070689_1000131193 274
328 3300005343 Ga0070687_100041751 Ga0070687_1000417513 274
329 3300005347 Ga0070668_100111078 Ga0070668_1001110782 274
330 3300005353 Ga0070669_100004104 Ga0070669_1000041045 274
331 3300005353 Ga0070669_100142155 Ga0070669_1001421552 274
332 3300005354 Ga0070675_100121775 Ga0070675_1001217752 274
333 3300005354 Ga0070675_100170691 Ga0070675_1001706912 274
334 3300005356 Ga0070674_100000181 Ga0070674_1000001813 274
335 3300005364 Ga0070673_100010513 Ga0070673_1000105136 274
336 3300005365 Ga0070688_100004013 Ga0070688_1000040134 274
337 3300005366 Ga0070659_100087256 Ga0070659_1000872563 274
338 3300005367 Ga0070667_100147372 Ga0070667_1001473722 274
339 3300005367 Ga0070667_100208161 Ga0070667_1002081612 274
340 3300005455 Ga0070663_100210885 Ga0070663_1002108852 274
341 3300005456 Ga0070678_100176673 Ga0070678_1001766732 274
342 3300005457 Ga0070662_100007904 Ga0070662_1000079044 274
343 3300005459 Ga0068867_100227095 Ga0068867_1002270952 274
344 3300005468 Ga0070707_100194119 Ga0070707_1001941193 274
345 3300005518 Ga0070699_100212378 Ga0070699_1002123782 274
346 3300005543 Ga0070672_100015777 Ga0070672_1000157772 274
347 3300005544 Ga0070686_100008202 Ga0070686_1000082025 274
348 3300005617 Ga0068859_100202767 Ga0068859_1002027672 274
349 3300005719 Ga0068861_100014321 Ga0068861_1000143213 274
350 3300005834 Ga0068851_10136792 Ga0068851_101367922 274
351 3300005840 Ga0068870_10086493 Ga0068870_100864932 274
352 3300005840 Ga0068870_10252892 Ga0068870_102528921 274
353 3300005842 Ga0068858_100293630 Ga0068858_1002936302 274
354 3300005843 Ga0068860_100374243 Ga0068860_1003742432 274
355 3300005844 Ga0068862_100009185 Ga0068862_1000091853 274
356 3300005844 Ga0068862_100062317 Ga0068862_1000623174 274
357 3300006844 Ga0075428_100007062 Ga0075428_1000070629 274
358 3300006844 Ga0075428_100032302 Ga0075428_1000323022 274
359 3300006846 Ga0075430_100008204 Ga0075430_1000082046 274
360 3300006847 Ga0075431_100019478 Ga0075431_1000194785 274
361 3300006847 Ga0075431_100366355 Ga0075431_1003663552 274
362 3300006852 Ga0075433_10007068 Ga0075433_100070684 274
363 3300006871 Ga0075434_100052113 Ga0075434_1000521134 274
364 3300006880 Ga0075429_100003402 Ga0075429_10000340210 274
365 3300006880 Ga0075429_100195681 Ga0075429_1001956812 274
366 3300006931 Ga0097620_100202770 Ga0097620_1002027702 274
367 3300009094 Ga0111539_10006095 Ga0111539_1000609513 274
368 3300009094 Ga0111539_10006941 Ga0111539_100069412 274
369 3300009094 Ga0111539_10244142 Ga0111539_102441421 274
370 3300009147 Ga0114129_10094978 Ga0114129_100949783 274
371 3300009177 Ga0105248_10549879 Ga0105248_105498791 274
372 3300009553 Ga0105249_10010494 Ga0105249_100104945 274
373 3300011119 Ga0105246_10334541 Ga0105246_103345412 274
374 3300013296 Ga0157374_10449831 Ga0157374_104498312 274
375 3300013306 Ga0163162_10012060 Ga0163162_100120605 274
376 3300014326 Ga0157380_10009723 Ga0157380_100097234 274
377 3300014326 Ga0157380_10056953 Ga0157380_100569533 274
378 3300014745 Ga0157377_10128980 Ga0157377_101289802 274
379 3300014968 Ga0157379_10144170 Ga0157379_101441703 274
380 3300025315 Ga0207697_10021897 Ga0207697_100218973 274
381 3300025893 Ga0207682_10008052 Ga0207682_100080521 274
382 3300025901 Ga0207688_10004441 Ga0207688_100044412 274
383 3300025903 Ga0207680_10166541 Ga0207680_101665412 274
384 3300025908 Ga0207643_10047106 Ga0207643_100471063 274
385 3300025908 Ga0207643_10223038 Ga0207643_102230381 274
386 3300025918 Ga0207662_10022592 Ga0207662_100225924 274
387 3300025923 Ga0207681_10298688 Ga0207681_102986881 274
388 3300025926 Ga0207659_10008976 Ga0207659_100089762 274
389 3300025932 Ga0207690_10288641 Ga0207690_102886411 274
390 3300025933 Ga0207706_10007634 Ga0207706_100076346 274
391 3300025933 Ga0207706_10610174 Ga0207706_106101741 274
392 3300025936 Ga0207670_10008502 Ga0207670_100085025 274
393 3300025937 Ga0207669_10013958 Ga0207669_100139581 274
394 3300025940 Ga0207691_10003677 Ga0207691_100036772 274
395 3300025941 Ga0207711_10274047 Ga0207711_102740472 274
396 3300025942 Ga0207689_10006232 Ga0207689_100062322 274
397 3300025942 Ga0207689_10129078 Ga0207689_101290782 274
398 3300025945 Ga0207679_10240782 Ga0207679_102407823 274
399 3300025960 Ga0207651_10002325 Ga0207651_100023254 274
400 3300025961 Ga0207712_10138451 Ga0207712_101384512 274
401 3300025972 Ga0207668_10141078 Ga0207668_101410782 274
402 3300025986 Ga0207658_10093494 Ga0207658_100934942 274
403 3300026023 Ga0207677_10106292 Ga0207677_101062922 274
404 3300026023 Ga0207677_10149708 Ga0207677_101497082 274
405 3300026035 Ga0207703_10386056 Ga0207703_103860561 274
406 3300026067 Ga0207678_10292626 Ga0207678_102926262 274
407 3300026118 Ga0207675_100002618 Ga0207675_1000026189 274
408 3300026121 Ga0207683_10184331 Ga0207683_101843312 274
409 3300027617 Ga0210002_1031125 Ga0210002_10311251 274
410 3300027907 Ga0207428_10001523 Ga0207428_100015238 274
411 3300028380 Ga0268265_10024706 Ga0268265_100247061 274
412 3300031548 Ga0307408_100270146 Ga0307408_1002701462 274
413 3300031901 Ga0307406_10296104 Ga0307406_102961042 274
414 3300032005 Ga0307411_10010576 Ga0307411_100105761 274
415 3300032126 Ga0307415_100011680 Ga0307415_1000116803 274
416 3300035121 Ga0373960_0018862 Ga0373960_0018862_320_1144 274
417 3300035241 Ga0373961_0047507 Ga0373961_0047507_24_848 274
418 3300035242 Ga0373962_0041509 Ga0373962_0041509_438_1262 274
419 3300045051 Ga0451576_0055632 Ga0451576_0055632_86_910 274
420 3300046537 Ga0495598_0035942 Ga0495598_0035942_386_1222 274
421 3300049571 Ga0501034_0048376 Ga0501034_0048376_167_1066 274
422 3300050507 nmdc:mga05p37_156591_c1 nmdc:mga05p37_156591_c1_1354_2274 274
423 3300050507 nmdc:mga05p37_28819_c1 nmdc:mga05p37_28819_c1_4000_4878 274
424 3300050507 nmdc:mga05p37_83989_c1 nmdc:mga05p37_83989_c1_1471_2298 274
425 3300050508 nmdc:mga09592_5178_c1 nmdc:mga09592_5178_c1_454_1281 274
426 3300050509 nmdc:mga0qj67_4569_c1 nmdc:mga0qj67_4569_c1_2995_3822 274
427 3300050510 nmdc:mga06r32_4143_c1 nmdc:mga06r32_4143_c1_117_944 274
428 3300050510 nmdc:mga06r32_49702_c1 nmdc:mga06r32_49702_c1_21_848 274
429 3300050511 nmdc:mga08y16_13770_c1 nmdc:mga08y16_13770_c1_199_1029 274
430 3300050511 nmdc:mga08y16_445763_c1 nmdc:mga08y16_445763_c1_382_1206 274
431 3300050512 nmdc:mga0n895_50513_c1 nmdc:mga0n895_50513_c1_2801_3625 274
432 3300050513 nmdc:mga0rr50_107603_c1 nmdc:mga0rr50_107603_c1_539_1363 274
433 3300050515 nmdc:mga0a205_11792_c1 nmdc:mga0a205_11792_c1_195_1019 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

24

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9396 4 224
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9361 4 224
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9306 4 224
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9264 1 210
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.919 5 224
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9672 5 250 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9516 5 250 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9351 3 210 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.932 5 242 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9292 5 210 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A536LBD7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9617 3 162 GO:0005524
GO:0016887
AF-A0A2S8K3Z3-F1-model_v4 deleted 0.9567 34 187
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9564 1 190 GO:0005524
GO:0016887
AF-A0A6A8AKN4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9514 1 190 GO:0005524
GO:0016887
AF-A0A6I1NNV7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9493 40 186 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map