F442904

General Info

Members Datasets Scaffolds Average Seq Length
433 325 866 238

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0002245|Ga0466969_0002245_8862_9680
Length 272
Sequence LFKYRFIEYNDRRIITACIQQADNKLIKESGYSMGRKWNNIKEKKASKDGNTSRIYAKFGIEIYVAAKKGEPDPESNQALKFVIERAKTYNVPKAIIDRAVEKAKGSSDENYSELRYEGFGPSGSMIIIDALTNNVNRTAADVRSAFNKNGGNMGVSGSVAYMFSPTAVIGVEGKTSDEVLELLMEAELDVRDIAEEEESVIIYAEPDQLYAVQNALKQAGITEFTVAELTMLAQNYVTLPEDELAQFEKLIDVLEDLEDVQRVYHNVELED

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
54 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
55 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
68 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
73 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
74 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
75 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
76 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
77 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
78 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
137 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
138 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
139 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
140 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
141 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
142 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
143 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
144 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
145 2554235283 Bacillus safensis VK Isolate Rhizosphere
146 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
147 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
148 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
149 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
150 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
151 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
152 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
153 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
154 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
155 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
156 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
157 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
158 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
159 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
160 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
161 2643221729 Bacillus sp. Root11 Isolate Unclassified
162 2643221730 Bacillus sp. Root131 Isolate Unclassified
163 2643221731 Bacillus sp. Root147 Isolate Unclassified
164 2643221732 Bacillus sp. Root239 Isolate Unclassified
165 2643221735 Bacillus sp. Root920 Isolate Unclassified
166 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
167 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
168 2671180694 Paenibacillus sp. A3 Isolate Unclassified
169 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
170 2684622632 Bacillus cereus 905 Isolate Unclassified
171 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
172 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
173 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
174 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
175 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
176 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
177 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
178 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
179 2738541295 Bacillus sp. OK085 Isolate Unclassified
180 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
181 2738541358 Bacillus sp. OV752 Isolate Unclassified
182 2738543006 Bacillus sp. OK077 Isolate Unclassified
183 2738543010 Bacillus sp. YR335 Isolate Unclassified
184 2738543017 Bacillus sp. OV186 Isolate Unclassified
185 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
186 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
187 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
188 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
189 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
190 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
191 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
192 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
193 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
194 2811994870 Bacillus sp. JB4 Isolate Unclassified
195 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
196 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
197 2818991441 Niallia circulans 3243 Isolate Rhizosphere
198 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
199 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
200 2818991459 Paenibacillus sp. 597 Isolate Unclassified
201 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
202 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
203 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
204 2842682962 Bacillus sp. R-72492 Isolate Unclassified
205 2842882022 Bacillus sp. R-71893 Isolate Unclassified
206 2849139964 Bacillus sp. R-71875 Isolate Unclassified
207 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
208 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
209 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
210 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
211 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
212 2857581216 Bacillus sp. R-71922 Isolate Unclassified
213 2857586860 Bacillus sp. R-71935 Isolate Unclassified
214 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
215 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
216 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
217 2860837431 Bacillus sp. WR11 Isolate Unclassified
218 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
219 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
220 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
221 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
222 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
223 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
224 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
225 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
226 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
227 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
228 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
229 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
230 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
231 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
232 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
233 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
234 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
235 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
236 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
237 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
238 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
239 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
240 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
241 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
242 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
243 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
244 2919720352 Priestia megaterium 4340 Isolate Unclassified
245 2919726948 Bacillus pumilus 4489 Isolate Unclassified
246 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
247 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
248 2929004312 Priestia megaterium 1104 Isolate Unclassified
249 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
250 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
251 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
252 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
253 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
254 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
255 2938917290 Bacillus sp. CR71 Isolate Unclassified
256 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
257 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
258 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
259 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
260 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
261 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
262 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
263 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
264 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
265 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
266 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
267 2965761152 Bacillus sp. COPE52 Isolate Unclassified
268 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
269 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
270 2969141011 Bacillus velezensis MH25 Isolate Unclassified
271 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
272 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
273 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
274 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
275 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
276 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
277 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
278 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
279 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
280 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
281 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
282 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
283 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
284 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
285 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
286 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
287 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
288 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
289 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
290 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
291 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
292 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
293 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
294 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
295 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
296 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
297 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
298 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
299 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
300 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
301 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
302 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
303 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
304 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
305 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
306 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
307 8022653035 Bacillus sp. Rc4 Isolate Unclassified
308 8022792930 Bacillus sp. Xin Isolate Rhizosphere
309 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
310 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
311 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
312 8023438354 Bacillus sp. BH2 Isolate Unclassified
313 8023444577 Bacillus sp. BH32 Isolate Unclassified
314 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
315 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
316 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
317 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
318 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
319 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
320 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
321 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
322 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
323 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
324 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
325 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 41.8
Metatranscriptomes 14.32
Isolates 43.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 13.86
Nodule 0.23
Rhizoplane 5.31
Rhizosphere 49.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0002245 3300044656 Bacteria 10327
2 JGI25159J45721_1012541 3300002987 Bacteria 2016
3 JGI25151J46595_10000094 3300003187 Bacteria 119943
4 JGI25151J46595_10000103 3300003187 Bacteria 114459
5 JGI25151J46595_10000902 3300003187 Bacteria 23349
6 JGI25151J46595_10004542 3300003187 Bacteria 7321
7 JGI25151J46595_10004682 3300003187 Bacteria 7195
8 JGI25151J46595_10005602 3300003187 Bacteria 6463
9 JGI25151J46595_10016183 3300003187 Bacteria 3267
10 rootH1_10005496 3300003316 Bacteria 1600
11 rootL2_10259518 3300003322 Bacteria 1730
12 rootH1_10193155 3300003323 Bacteria 6182
13 JGI25160J50197_1036866 3300003354 Bacteria 1179
14 Ga0006562J51391_1000899 3300003578 Bacteria 9310
15 Ga0006562J51391_1001036 3300003578 Bacteria 8980
16 Ga0006562J51391_1004210 3300003578 Bacteria 954
17 Ga0006562J51391_1004240 3300003578 Bacteria 868
18 Ga0055538_1000179 3300003751 Bacteria 40015
19 Ga0055538_1000802 3300003751 Bacteria 8538
20 Ga0055532_1000060 3300003758 Bacteria 150321
21 Ga0055532_1001184 3300003758 Bacteria 7851
22 Ga0055532_1007180 3300003758 Bacteria 1449
23 Ga0055535_1004491 3300003761 Bacteria 3371
24 Ga0055536_1054229 3300003781 Bacteria 863
25 Ga0055534_1022966 3300003784 Bacteria 1026
26 Ga0055528_1002043 3300003790 Bacteria 11282
27 Ga0055528_1020321 3300003790 Bacteria 2160
28 Ga0055541_1000466 3300003841 Bacteria 11590
29 Ga0055541_1004713 3300003841 Bacteria 2452
30 Ga0055541_1004914 3300003841 Bacteria 2383
31 Ga0070675_100405102 3300005354 Bacteria 1217
32 Ga0070671_100025936 3300005355 Bacteria 4813
33 Ga0070674_100146945 3300005356 Bacteria 1775
34 Ga0105251_10016171 3300009011 Bacteria 4043
35 Ga0105244_10017031 3300009036 Bacteria 4119
36 Ga0105250_10008643 3300009092 Bacteria 4315
37 Ga0105245_10268454 3300009098 Bacteria 1663
38 Ga0105247_10003417 3300009101 Bacteria 10368
39 Ga0105243_10004376 3300009148 Bacteria 11177
40 Ga0105242_10050041 3300009176 Bacteria 3401
41 Ga0105249_10126978 3300009553 Bacteria 2430
42 Ga0105246_10006455 3300011119 Bacteria 7166
43 Ga0105246_10022954 3300011119 Bacteria 4032
44 Ga0157371_10036311 3300013102 Bacteria 3529
45 Ga0157378_10108813 3300013297 Bacteria 2538
46 Ga0157372_10578886 3300013307 Bacteria 1308
47 Ga0157377_10108714 3300014745 Bacteria 1664
48 Ga0157376_10030622 3300014969 Bacteria 4299
49 Ga0209784_100129 3300025224 Bacteria 76203
50 Ga0209566_100190 3300025225 Bacteria 64865
51 Ga0209566_100362 3300025225 Bacteria 38116
52 Ga0209566_101202 3300025225 Bacteria 9125
53 Ga0209147_100080 3300025229 Bacteria 196308
54 Ga0209147_100110 3300025229 Bacteria 146408
55 Ga0209147_102340 3300025229 Bacteria 4870
56 Ga0209147_103376 3300025229 Bacteria 3153
57 Ga0209147_108932 3300025229 Bacteria 1216
58 Ga0209258_106769 3300025242 Bacteria 1760
59 Ga0209673_1017739 3300025273 Bacteria 2615
60 Ga0209130_1001153 3300025284 Bacteria 19151
61 Ga0209130_1008876 3300025284 Bacteria 2921
62 Ga0209130_1010941 3300025284 Bacteria 2462
63 Ga0209675_1001787 3300025291 Bacteria 11750
64 Ga0209675_1015341 3300025291 Bacteria 2281
65 Ga0209675_1027664 3300025291 Bacteria 1391
66 Ga0209676_1000381 3300025292 Bacteria 81685
67 Ga0209676_1000530 3300025292 Bacteria 59517
68 Ga0209676_1009110 3300025292 Bacteria 4330
69 Ga0209676_1042212 3300025292 Bacteria 1268
70 Ga0209025_1000067 3300025294 Bacteria 295690
71 Ga0209025_1000170 3300025294 Bacteria 160659
72 Ga0209025_1000262 3300025294 Bacteria 123617
73 Ga0209025_1000388 3300025294 Bacteria 91113
74 Ga0209025_1000646 3300025294 Bacteria 61033
75 Ga0209025_1000958 3300025294 Bacteria 43522
76 Ga0209025_1001655 3300025294 Bacteria 27460
77 Ga0209025_1003802 3300025294 Bacteria 13799
78 Ga0209025_1004745 3300025294 Bacteria 11569
79 Ga0209025_1005716 3300025294 Bacteria 9997
80 Ga0209025_1014546 3300025294 Bacteria 4827
81 Ga0209025_1018673 3300025294 Bacteria 3910
82 Ga0209025_1021405 3300025294 Bacteria 3485
83 Ga0209025_1037361 3300025294 Bacteria 2155
84 Ga0209025_1039632 3300025294 Bacteria 2051
85 Ga0209025_1103533 3300025294 Bacteria 894
86 Ga0207426_1017374 3300025302 Bacteria 2560
87 Ga0207696_1005982 3300025711 Bacteria 4966
88 Ga0207696_1010950 3300025711 Bacteria 3298
89 Ga0207696_1043603 3300025711 Bacteria 1304
90 Ga0207655_1008422 3300025728 Bacteria 6547
91 Ga0207655_1043813 3300025728 Bacteria 1887
92 Ga0207655_1051180 3300025728 Bacteria 1672
93 Ga0207713_1003132 3300025735 Bacteria 11462
94 Ga0207713_1016466 3300025735 Bacteria 3750
95 Ga0207713_1091158 3300025735 Bacteria 1071
96 Ga0207710_10031638 3300025900 Bacteria 2315
97 Ga0207650_10137097 3300025925 Bacteria 1921
98 Ga0207659_10234972 3300025926 Bacteria 1480
99 Ga0207687_10289318 3300025927 Bacteria 1316
100 Ga0207686_10094169 3300025934 Bacteria 1985
101 Ga0207709_10002602 3300025935 Bacteria 11247
102 Ga0207712_10195544 3300025961 Bacteria 1599
103 Ga0209371_1011271 3300027312 Bacteria 2667
104 Ga0237817_10424 3300030083 Bacteria 6689
105 Ga0268256_1013510 3300030500 Bacteria 2468
106 Ga0307408_100009020 3300031548 Bacteria 6588
107 Ga0307408_100054078 3300031548 Bacteria 2902
108 Ga0307409_100014845 3300031995 Bacteria 5085
109 Ga0307409_100568494 3300031995 Bacteria 1116
110 Ga0307416_100059586 3300032002 Bacteria 3103
111 Ga0395899_0005941 3300037312 Bacteria 9479
112 Ga0237819_00036 3300038705 Bacteria 46167
113 Ga0237819_00672 3300038705 Bacteria 11125
114 Ga0466965_0072594 3300044683 Bacteria 1732
115 Ga0466968_0007154 3300044735 Bacteria 4239
116 Ga0466970_0242947 3300044765 Bacteria 1008
117 Ga0466957_0233712 3300044842 Bacteria 1218
118 Ga0466959_0022863 3300045049 Bacteria 4621
119 Ga0466967_0000762 3300045976 Bacteria 16638
120 Ga0466967_0043610 3300045976 Bacteria 3885
121 Ga0495585_0010393 3300046492 Bacteria 5542
122 Ga0495637_0051325 3300046520 Bacteria 1727
123 Ga0495622_0012583 3300046557 Bacteria 3921
124 Ga0495661_0246444 3300046665 Bacteria 914
125 Ga0495670_0077782 3300046691 Bacteria 1687
126 Ga0495589_0183615 3300046794 Bacteria 991
127 Ga0495660_0008325 3300046810 Bacteria 6071
128 Ga0495660_0052693 3300046810 Bacteria 2210
129 Ga0495676_0378109 3300047321 Bacteria 943
130 Ga0495683_0003820 3300047323 Bacteria 8684
131 Ga0495681_0152590 3300047470 Bacteria 968
132 Ga0495686_0248935 3300047472 Bacteria 999
133 Ga0495626_0051867 3300048091 Bacteria 1892
134 Ga0496100_0001369 3300048903 Bacteria 11947
135 Ga0496101_0001393 3300048904 Bacteria 14471
136 Ga0496102_0002434 3300048905 Bacteria 15874
137 Ga0496102_0188750 3300048905 Bacteria 1942
138 Ga0496103_0067262 3300048906 Bacteria 2237
139 Ga0496104_0000546 3300048907 Bacteria 32183
140 Ga0496104_0468176 3300048907 Bacteria 1172
141 Ga0496105_0003765 3300048908 Bacteria 11303
142 Ga0496106_0003223 3300048909 Bacteria 12221
143 Ga0496107_0065475 3300048910 Bacteria 2634
144 Ga0496108_0004036 3300048911 Bacteria 11780
145 Ga0496108_0101094 3300048911 Bacteria 2460
146 Ga0496109_0001758 3300048912 Bacteria 18025
147 Ga0496110_0001252 3300048913 Bacteria 18157
148 Ga0496110_0004342 3300048913 Bacteria 10976
149 Ga0496110_0302161 3300048913 Bacteria 1458
150 Ga0496111_0000890 3300048914 Bacteria 16255
151 Ga0496112_0004635 3300048915 Bacteria 11695
152 Ga0496113_0000155 3300048916 Bacteria 30022
153 Ga0496116_0006514 3300048919 Bacteria 10580
154 Ga0496116_0069381 3300048919 Bacteria 2241
155 Ga0496116_0099975 3300048919 Bacteria 1735
156 Ga0496116_0121556 3300048919 Bacteria 1510
157 Ga0496116_0209050 3300048919 Bacteria 1013
158 Ga0496116_0249555 3300048919 Bacteria 884
159 Ga0496117_0010874 3300048920 Bacteria 8209
160 Ga0496118_0006051 3300048921 Bacteria 13479
161 Ga0496119_0001026 3300048922 Bacteria 35812
162 Ga0496119_0006000 3300048922 Bacteria 11415
163 Ga0496119_0014132 3300048922 Bacteria 6274
164 Ga0496119_0083324 3300048922 Bacteria 1837
165 Ga0496120_0000644 3300048923 Bacteria 51437
166 Ga0496121_0025454 3300048924 Bacteria 5612
167 Ga0496121_0026178 3300048924 Bacteria 5507
168 Ga0496122_0001451 3300048925 Bacteria 38307
169 Ga0496122_0008321 3300048925 Bacteria 11230
170 Ga0496122_0080739 3300048925 Bacteria 2266
171 Ga0496122_0086881 3300048925 Bacteria 2151
172 Ga0496122_0124343 3300048925 Bacteria 1655
173 Ga0496123_0031960 3300048926 Bacteria 3821
174 Ga0496124_0000062 3300048927 Bacteria 232676
175 Ga0496124_0000793 3300048927 Bacteria 51468
176 Ga0496124_0041235 3300048927 Bacteria 3986
177 Ga0496124_0224013 3300048927 Bacteria 1412
178 Ga0496125_0005689 3300048928 Bacteria 13747
179 Ga0496125_0029186 3300048928 Bacteria 4962
180 Ga0496125_0060916 3300048928 Bacteria 3030
181 Ga0496125_0186075 3300048928 Bacteria 1377
182 Ga0496126_0000250 3300048929 Bacteria 116245
183 Ga0496126_0001501 3300048929 Bacteria 36130
184 Ga0496126_0006821 3300048929 Bacteria 12669
185 Ga0496126_0022257 3300048929 Bacteria 6171
186 Ga0501306_025592 3300049127 Bacteria 850
187 Ga0501309_008364 3300049129 Bacteria 1301
188 Ga0501309_023086 3300049129 Bacteria 883
189 Ga0501343_001828 3300049132 Bacteria 1475
190 Ga0501344_00612 3300049133 Bacteria 1542
191 Ga0501344_03944 3300049133 Bacteria 804
192 Ga0501304_010462 3300049160 Bacteria 812
193 Ga0501305_006367 3300049161 Bacteria 1464
194 Ga0501305_006891 3300049161 Bacteria 1425
195 Ga0501305_022432 3300049161 Bacteria 939
196 Ga0501307_005236 3300049162 Bacteria 1361
197 Ga0501307_005859 3300049162 Bacteria 1309
198 Ga0501342_00623 3300049163 Bacteria 992
199 Ga0501311_014575 3300049527 Bacteria 1005
200 Ga0501312_002961 3300049528 Bacteria 1882
201 Ga0501312_008128 3300049528 Bacteria 1356
202 Ga0501312_025285 3300049528 Bacteria 904
203 Ga0501313_005981 3300049529 Bacteria 1304
204 Ga0501313_016682 3300049529 Bacteria 883
205 Ga0501314_010205 3300049530 Bacteria 872
206 Ga0501314_010583 3300049530 Bacteria 861
207 Ga0501315_002093 3300049531 Bacteria 1831
208 Ga0501315_006215 3300049531 Bacteria 1323
209 Ga0501315_023402 3300049531 Bacteria 848
210 Ga0501316_004194 3300049532 Bacteria 1436
211 Ga0501316_005312 3300049532 Bacteria 1331
212 Ga0501317_001801 3300049533 Bacteria 1921
213 Ga0501317_004886 3300049533 Bacteria 1413
214 Ga0501317_021055 3300049533 Bacteria 883
215 Ga0501317_033613 3300049533 Bacteria 755
216 Ga0501318_003448 3300049534 Bacteria 1448
217 Ga0501318_004288 3300049534 Bacteria 1360
218 Ga0501318_012386 3300049534 Bacteria 977
219 Ga0501319_004492 3300049535 Bacteria 973
220 Ga0501321_003772 3300049537 Bacteria 1410
221 Ga0501321_004755 3300049537 Bacteria 1313
222 Ga0501322_003561 3300049538 Bacteria 1015
223 Ga0501323_006671 3300049539 Bacteria 1296
224 Ga0501323_007932 3300049539 Bacteria 1222
225 Ga0501324_009877 3300049540 Bacteria 862
226 Ga0501326_00595 3300049542 Bacteria 1481
227 Ga0501328_02628 3300049544 Bacteria 796
228 Ga0501331_00583 3300049547 Bacteria 1545
229 Ga0501331_00869 3300049547 Bacteria 1359
230 Ga0501332_00876 3300049548 Bacteria 1451
231 Ga0501333_003473 3300049549 Bacteria 962
232 Ga0501334_00799 3300049550 Bacteria 1585
233 Ga0501335_001351 3300049551 Bacteria 1871
234 Ga0501335_003190 3300049551 Bacteria 1377
235 Ga0501335_012178 3300049551 Bacteria 847
236 Ga0501336_001370 3300049552 Bacteria 1440
237 Ga0501336_007266 3300049552 Bacteria 838
238 Ga0501336_009373 3300049552 Bacteria 770
239 Ga0501337_001207 3300049553 Bacteria 1444
240 Ga0501338_01043 3300049554 Bacteria 1408
241 Ga0501338_03900 3300049554 Bacteria 895
242 Ga0501340_001011 3300049556 Bacteria 1435
243 Ga0501340_004622 3300049556 Bacteria 873
244 2511180409 2510917027 Bacteria 5287437
245 2511698615 2511231119 Bacteria 4019861
246 2512638888 2512564013 Bacteria 6286191
247 2512734035 2512564039 Bacteria 8739048
248 2524190927 2524023129 Bacteria 6762600
249 2540605829 2540341094 Bacteria 4061186
250 2545558628 2545555800 Bacteria 4222588
251 2550902777 2548877040 Bacteria 7507281
252 2553397182 2551306519 Bacteria 5465154
253 2555470445 2554235283 Bacteria 3683090
254 2571528406 2571042143 Bacteria 6986194
255 2573040151 2571042588 Bacteria 5045676
256 2578334745 2576861424 Bacteria 5270569
257 2578933086 2576861599 Bacteria 4217202
258 2580934346 2579778775 Bacteria 5360914
259 2587744294 2585428059 Bacteria 8696589
260 2595091445 2593339131 Bacteria 5116855
261 2595317416 2593339198 Bacteria 7267884
262 2600199619 2599185353 Bacteria 2219443
263 2600402374 2600254943 Bacteria 2613887
264 2601637825 2600255286 Bacteria 5390125
265 2621272774 2619619294 Bacteria 5575484
266 2631985948 2630968484 Bacteria 3876276
267 2643736409 2643221543 Bacteria 6628015
268 2644427270 2643221676 Bacteria 8119172
269 2644708437 2643221729 Bacteria 6621700
270 2644715035 2643221730 Bacteria 6523787
271 2644718519 2643221731 Bacteria 5623886
272 2644724346 2643221732 Bacteria 5756404
273 2644741140 2643221735 Bacteria 3676263
274 2651529857 2648501850 Bacteria 3975476
275 2672338152 2671180330 Bacteria 5521719
276 2673822159 2671180694 Bacteria 7506943
277 2674420566 2671180844 Bacteria 4164150
278 2685148459 2684622632 Bacteria 5380049
279 2686996002 2684623153 Bacteria 3878815
280 2687497245 2687453109 Bacteria 3860091
281 2695630466 2695420354 Bacteria 3922431
282 2698324715 2695420987 Bacteria 6152737
283 2705992402 2703719227 Bacteria 5631989
284 2717917625 2716884898 Bacteria 3928789
285 2721503839 2718218445 Bacteria 5113413
286 2728534919 2728368933 Bacteria 7044283
287 2738813139 2738541295 Bacteria 5730091
288 2738838615 2738541299 Bacteria 4020721
289 2739158425 2738541358 Bacteria 5932299
290 2739211197 2738543006 Bacteria 5904091
291 2739234420 2738543010 Bacteria 5583595
292 2739269185 2738543017 Bacteria 4271950
293 2753810717 2751185905 Bacteria 6142767
294 2757566617 2757320391 Bacteria 4746095
295 2777760507 2775507177 Bacteria 4384303
296 2777839019 2775507192 Bacteria 4622234
297 2791215645 2788500588 Bacteria 4584915
298 2793182137 2791355222 Bacteria 5898266
299 2802440287 2802428803 Bacteria 5806948
300 2808867086 2808606364 Bacteria 4465927
301 2809056563 2808606399 Bacteria 4021018
302 2812315123 2811994870 Bacteria 3776934
303 2816861374 2816332186 Bacteria 5331395
304 2817478857 2816332295 Bacteria 4352468
305 2819571231 2818991441 Bacteria 5062707
306 2819583259 2818991443 Bacteria 6598732
307 2819627160 2818991451 Bacteria 4697364
308 2819668546 2818991459 Bacteria 8736032
309 2819712142 2818991465 Bacteria 5388835
310 2819725446 2818991468 Bacteria 3723169
311 2823527087 2823526263 Bacteria 3765752
312 2842687127 2842682962 Bacteria 5589973
313 2842888007 2842882022 Bacteria 6158489
314 2849143749 2849139964 Bacteria 5613304
315 2852676700 2852673933 Bacteria 3347676
316 2857358494 2857357740 Bacteria 9937880
317 2857454744 2857453340 Bacteria 8090534
318 2857464953 2857460504 Bacteria 5194327
319 2857471305 2857465823 Bacteria 6772595
320 2857585958 2857581216 Bacteria 5522813
321 2857591274 2857586860 Bacteria 4354574
322 2857592508 2857591370 Bacteria 6569758
323 2857606872 2857604169 Bacteria 5111450
324 2857612618 2857609550 Bacteria 3753890
325 2860838178 2860837431 Bacteria 4202080
326 2864739018 2864733723 Bacteria 6770668
327 2865001784 2864997549 Bacteria 5139696
328 2865003862 2865002811 Bacteria 6333767
329 2877769359 2877768649 Bacteria 3957164
330 2880170368 2880169592 Bacteria 3900066
331 2881641466 2881636855 Bacteria 5205297
332 2888581565 2888578766 Bacteria 6743310
333 2889049804 2889049205 Bacteria 7524325
334 2889279789 2889276214 Bacteria 5979355
335 2889299896 2889295896 Bacteria 4704906
336 2897110335 2897109615 Bacteria 4009619
337 2904530257 2904524088 Bacteria 5887454
338 2904563874 2904560550 Bacteria 4029838
339 2904600711 2904595352 Bacteria 6124848
340 2904609322 2904606771 Bacteria 4684500
341 2904757524 2904755435 Bacteria 7986759
342 2907202675 2907202186 Bacteria 6632024
343 2908669158 2908665501 Bacteria 3678115
344 2915600028 2915597211 Bacteria 6475886
345 2915609608 2915606848 Bacteria 6032732
346 2916973983 2916971899 Bacteria 4250608
347 2919096913 2919093281 Bacteria 3660974
348 2919149531 2919143609 Bacteria 6219228
349 2919418431 2919414237 Bacteria 5429133
350 2919426869 2919425241 Bacteria 8055701
351 2919523093 2919517244 Bacteria 5858162
352 2919726250 2919720352 Bacteria 5986006
353 2919730367 2919726948 Bacteria 3696050
354 2928099760 2928093941 Bacteria 5965005
355 2928512923 2928510474 Bacteria 4815308
356 2929010268 2929004312 Bacteria 5678476
357 2929185203 2929183550 Bacteria 6377511
358 2929209518 2929206907 Bacteria 5918291
359 2929233710 2929233124 Bacteria 5948380
360 2936345272 2936340661 Bacteria 5139038
361 2936365965 2936361878 Bacteria 5632809
362 2938649309 2938649242 Bacteria 7118381
363 2938917878 2938917290 Bacteria 5914775
364 2939595816 2939593269 Bacteria 4798695
365 2939682770 2939679117 Bacteria 6921672
366 2939707717 2939702853 Bacteria 5139229
367 2946055486 2946053406 Bacteria 6978655
368 2947427197 2947426588 Bacteria 5357194
369 2954775401 2954773129 Bacteria 3741715
370 2956898592 2956897341 Bacteria 5447711
371 2960323212 2960319331 Bacteria 5502575
372 2960379833 2960375949 Bacteria 5361395
373 2962291533 2962290636 Bacteria 4072939
374 2964379425 2964375228 Bacteria 4909004
375 2965761768 2965761152 Bacteria 5806513
376 2968564252 2968558590 Bacteria 6956864
377 2969137597 2969136845 Bacteria 3923176
378 2969141739 2969141011 Bacteria 4118468
379 2969769439 2969765954 Bacteria 4216713
380 2969774161 2969770375 Bacteria 4271280
381 2971406144 2971403814 Bacteria 7370929
382 2971414004 2971410472 Bacteria 8311090
383 2971513338 2971511577 Bacteria 5404012
384 2971894110 2971893375 Bacteria 3929648
385 2977257556 2977254563 Bacteria 4828420
386 2979084194 2979083700 Bacteria 5894929
387 2980129393 2980125574 Bacteria 5567337
388 2980179302 2980176882 Bacteria 5397533
389 2980183690 2980182181 Bacteria 9454109
390 2980493363 2980492589 Bacteria 4072961
391 2981287017 2981284811 Bacteria 4641497
392 2981291967 2981289755 Bacteria 4641509
393 2981982652 2981980479 Bacteria 4641628
394 2981987561 2981985349 Bacteria 4641497
395 2984529554 2984527788 Bacteria 5288478
396 2984535661 2984532647 Bacteria 5288506
397 2988231535 2988225383 Bacteria 7221625
398 2990278525 2990275345 Bacteria 4887158
399 2996633550 2996632988 Bacteria 6921523
400 2996708405 2996706504 Bacteria 5757485
401 3001269995 3001267043 Bacteria 4823521
402 3001275331 3001272096 Bacteria 4729684
403 3001892811 3001892409 Bacteria 6328293
404 3006827663 3006826541 Bacteria 4678913
405 3006859177 3006858327 Bacteria 4317835
406 3006880007 3006879489 Bacteria 4064221
407 3006975272 3006973921 Bacteria 4423788
408 3006982562 3006978542 Bacteria 5328100
409 3006984714 3006984091 Bacteria 4207523
410 3006990518 3006988479 Bacteria 4767936
411 648170151 648028048 Bacteria 5394884
412 8002322501 8002317523 Bacteria 8051857
413 8022621634 8022621104 Bacteria 5241040
414 8022631545 8022630665 Bacteria 3886130
415 8022655410 8022653035 Bacteria 4035078
416 8022793623 8022792930 Bacteria 5693794
417 8022896431 8022893055 Bacteria 5300455
418 8022918176 8022914991 Bacteria 5584517
419 8022954129 8022948649 Bacteria 5366783
420 8023438960 8023438354 Bacteria 5779374
421 8023450326 8023444577 Bacteria 5661597
422 8046998147 8046991243 Bacteria 8497463
423 8051956309 8051952484 Bacteria 3926774
424 8052177345 8052174270 Bacteria 3881265
425 8054284584 8054280661 Bacteria 4232245
426 8054468429 8054465665 Bacteria 7323556
427 8055536820 8055531788 Bacteria 5249694
428 8055636851 8055632911 Bacteria 5283357
429 8056538203 8056533031 Bacteria 8964429
430 8057474539 8057473075 Bacteria 5892720
431 8057583262 8057582654 Bacteria 5218944
432 8057633425 8057632132 Bacteria 4726859
433 8057736026 8057733483 Bacteria 6578323
434 Ga0466969_0002245
435 JGI25159J45721_1012541
436 JGI25151J46595_10000094
437 JGI25151J46595_10000103
438 JGI25151J46595_10000902
439 JGI25151J46595_10004542
440 JGI25151J46595_10004682
441 JGI25151J46595_10005602
442 JGI25151J46595_10016183
443 rootH1_10005496
444 rootL2_10259518
445 rootH1_10193155
446 JGI25160J50197_1036866
447 Ga0006562J51391_1000899
448 Ga0006562J51391_1001036
449 Ga0006562J51391_1004210
450 Ga0006562J51391_1004240
451 Ga0055538_1000179
452 Ga0055538_1000802
453 Ga0055532_1000060
454 Ga0055532_1001184
455 Ga0055532_1007180
456 Ga0055535_1004491
457 Ga0055536_1054229
458 Ga0055534_1022966
459 Ga0055528_1002043
460 Ga0055528_1020321
461 Ga0055541_1000466
462 Ga0055541_1004713
463 Ga0055541_1004914
464 Ga0070675_100405102
465 Ga0070671_100025936
466 Ga0070674_100146945
467 Ga0105251_10016171
468 Ga0105244_10017031
469 Ga0105250_10008643
470 Ga0105245_10268454
471 Ga0105247_10003417
472 Ga0105243_10004376
473 Ga0105242_10050041
474 Ga0105249_10126978
475 Ga0105246_10006455
476 Ga0105246_10022954
477 Ga0157371_10036311
478 Ga0157378_10108813
479 Ga0157372_10578886
480 Ga0157377_10108714
481 Ga0157376_10030622
482 Ga0209784_100129
483 Ga0209566_100190
484 Ga0209566_100362
485 Ga0209566_101202
486 Ga0209147_100080
487 Ga0209147_100110
488 Ga0209147_102340
489 Ga0209147_103376
490 Ga0209147_108932
491 Ga0209258_106769
492 Ga0209673_1017739
493 Ga0209130_1001153
494 Ga0209130_1008876
495 Ga0209130_1010941
496 Ga0209675_1001787
497 Ga0209675_1015341
498 Ga0209675_1027664
499 Ga0209676_1000381
500 Ga0209676_1000530
501 Ga0209676_1009110
502 Ga0209676_1042212
503 Ga0209025_1000067
504 Ga0209025_1000170
505 Ga0209025_1000262
506 Ga0209025_1000388
507 Ga0209025_1000646
508 Ga0209025_1000958
509 Ga0209025_1001655
510 Ga0209025_1003802
511 Ga0209025_1004745
512 Ga0209025_1005716
513 Ga0209025_1014546
514 Ga0209025_1018673
515 Ga0209025_1021405
516 Ga0209025_1037361
517 Ga0209025_1039632
518 Ga0209025_1103533
519 Ga0207426_1017374
520 Ga0207696_1005982
521 Ga0207696_1010950
522 Ga0207696_1043603
523 Ga0207655_1008422
524 Ga0207655_1043813
525 Ga0207655_1051180
526 Ga0207713_1003132
527 Ga0207713_1016466
528 Ga0207713_1091158
529 Ga0207710_10031638
530 Ga0207650_10137097
531 Ga0207659_10234972
532 Ga0207687_10289318
533 Ga0207686_10094169
534 Ga0207709_10002602
535 Ga0207712_10195544
536 Ga0209371_1011271
537 Ga0237817_10424
538 Ga0268256_1013510
539 Ga0307408_100009020
540 Ga0307408_100054078
541 Ga0307409_100014845
542 Ga0307409_100568494
543 Ga0307416_100059586
544 Ga0395899_0005941
545 Ga0237819_00036
546 Ga0237819_00672
547 Ga0466965_0072594
548 Ga0466968_0007154
549 Ga0466970_0242947
550 Ga0466957_0233712
551 Ga0466959_0022863
552 Ga0466967_0000762
553 Ga0466967_0043610
554 Ga0495585_0010393
555 Ga0495637_0051325
556 Ga0495622_0012583
557 Ga0495661_0246444
558 Ga0495670_0077782
559 Ga0495589_0183615
560 Ga0495660_0008325
561 Ga0495660_0052693
562 Ga0495676_0378109
563 Ga0495683_0003820
564 Ga0495681_0152590
565 Ga0495686_0248935
566 Ga0495626_0051867
567 Ga0496100_0001369
568 Ga0496101_0001393
569 Ga0496102_0002434
570 Ga0496102_0188750
571 Ga0496103_0067262
572 Ga0496104_0000546
573 Ga0496104_0468176
574 Ga0496105_0003765
575 Ga0496106_0003223
576 Ga0496107_0065475
577 Ga0496108_0004036
578 Ga0496108_0101094
579 Ga0496109_0001758
580 Ga0496110_0001252
581 Ga0496110_0004342
582 Ga0496110_0302161
583 Ga0496111_0000890
584 Ga0496112_0004635
585 Ga0496113_0000155
586 Ga0496116_0006514
587 Ga0496116_0069381
588 Ga0496116_0099975
589 Ga0496116_0121556
590 Ga0496116_0209050
591 Ga0496116_0249555
592 Ga0496117_0010874
593 Ga0496118_0006051
594 Ga0496119_0001026
595 Ga0496119_0006000
596 Ga0496119_0014132
597 Ga0496119_0083324
598 Ga0496120_0000644
599 Ga0496121_0025454
600 Ga0496121_0026178
601 Ga0496122_0001451
602 Ga0496122_0008321
603 Ga0496122_0080739
604 Ga0496122_0086881
605 Ga0496122_0124343
606 Ga0496123_0031960
607 Ga0496124_0000062
608 Ga0496124_0000793
609 Ga0496124_0041235
610 Ga0496124_0224013
611 Ga0496125_0005689
612 Ga0496125_0029186
613 Ga0496125_0060916
614 Ga0496125_0186075
615 Ga0496126_0000250
616 Ga0496126_0001501
617 Ga0496126_0006821
618 Ga0496126_0022257
619 Ga0501306_025592
620 Ga0501309_008364
621 Ga0501309_023086
622 Ga0501343_001828
623 Ga0501344_00612
624 Ga0501344_03944
625 Ga0501304_010462
626 Ga0501305_006367
627 Ga0501305_006891
628 Ga0501305_022432
629 Ga0501307_005236
630 Ga0501307_005859
631 Ga0501342_00623
632 Ga0501311_014575
633 Ga0501312_002961
634 Ga0501312_008128
635 Ga0501312_025285
636 Ga0501313_005981
637 Ga0501313_016682
638 Ga0501314_010205
639 Ga0501314_010583
640 Ga0501315_002093
641 Ga0501315_006215
642 Ga0501315_023402
643 Ga0501316_004194
644 Ga0501316_005312
645 Ga0501317_001801
646 Ga0501317_004886
647 Ga0501317_021055
648 Ga0501317_033613
649 Ga0501318_003448
650 Ga0501318_004288
651 Ga0501318_012386
652 Ga0501319_004492
653 Ga0501321_003772
654 Ga0501321_004755
655 Ga0501322_003561
656 Ga0501323_006671
657 Ga0501323_007932
658 Ga0501324_009877
659 Ga0501326_00595
660 Ga0501328_02628
661 Ga0501331_00583
662 Ga0501331_00869
663 Ga0501332_00876
664 Ga0501333_003473
665 Ga0501334_00799
666 Ga0501335_001351
667 Ga0501335_003190
668 Ga0501335_012178
669 Ga0501336_001370
670 Ga0501336_007266
671 Ga0501336_009373
672 Ga0501337_001207
673 Ga0501338_01043
674 Ga0501338_03900
675 Ga0501340_001011
676 Ga0501340_004622
677 2511180409
678 2511698615
679 2512638888
680 2512734035
681 2524190927
682 2540605829
683 2545558628
684 2550902777
685 2553397182
686 2555470445
687 2571528406
688 2573040151
689 2578334745
690 2578933086
691 2580934346
692 2587744294
693 2595091445
694 2595317416
695 2600199619
696 2600402374
697 2601637825
698 2621272774
699 2631985948
700 2643736409
701 2644427270
702 2644708437
703 2644715035
704 2644718519
705 2644724346
706 2644741140
707 2651529857
708 2672338152
709 2673822159
710 2674420566
711 2685148459
712 2686996002
713 2687497245
714 2695630466
715 2698324715
716 2705992402
717 2717917625
718 2721503839
719 2728534919
720 2738813139
721 2738838615
722 2739158425
723 2739211197
724 2739234420
725 2739269185
726 2753810717
727 2757566617
728 2777760507
729 2777839019
730 2791215645
731 2793182137
732 2802440287
733 2808867086
734 2809056563
735 2812315123
736 2816861374
737 2817478857
738 2819571231
739 2819583259
740 2819627160
741 2819668546
742 2819712142
743 2819725446
744 2823527087
745 2842687127
746 2842888007
747 2849143749
748 2852676700
749 2857358494
750 2857454744
751 2857464953
752 2857471305
753 2857585958
754 2857591274
755 2857592508
756 2857606872
757 2857612618
758 2860838178
759 2864739018
760 2865001784
761 2865003862
762 2877769359
763 2880170368
764 2881641466
765 2888581565
766 2889049804
767 2889279789
768 2889299896
769 2897110335
770 2904530257
771 2904563874
772 2904600711
773 2904609322
774 2904757524
775 2907202675
776 2908669158
777 2915600028
778 2915609608
779 2916973983
780 2919096913
781 2919149531
782 2919418431
783 2919426869
784 2919523093
785 2919726250
786 2919730367
787 2928099760
788 2928512923
789 2929010268
790 2929185203
791 2929209518
792 2929233710
793 2936345272
794 2936365965
795 2938649309
796 2938917878
797 2939595816
798 2939682770
799 2939707717
800 2946055486
801 2947427197
802 2954775401
803 2956898592
804 2960323212
805 2960379833
806 2962291533
807 2964379425
808 2965761768
809 2968564252
810 2969137597
811 2969141739
812 2969769439
813 2969774161
814 2971406144
815 2971414004
816 2971513338
817 2971894110
818 2977257556
819 2979084194
820 2980129393
821 2980179302
822 2980183690
823 2980493363
824 2981287017
825 2981291967
826 2981982652
827 2981987561
828 2984529554
829 2984535661
830 2988231535
831 2990278525
832 2996633550
833 2996708405
834 3001269995
835 3001275331
836 3001892811
837 3006827663
838 3006859177
839 3006880007
840 3006975272
841 3006982562
842 3006984714
843 3006990518
844 648170151
845 8002322501
846 8022621634
847 8022631545
848 8022655410
849 8022793623
850 8022896431
851 8022918176
852 8022954129
853 8023438960
854 8023450326
855 8046998147
856 8051956309
857 8052177345
858 8054284584
859 8054468429
860 8055536820
861 8055636851
862 8056538203
863 8057474539
864 8057583262
865 8057633425
866 8057736026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

36

107

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

112

268

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9092 24 235
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8741 24 235
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8616 5 238
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8452 5 238
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8419 1 235
ID Description Score Start End Superfamily
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9552 16 78 1.10.10.200
af_Q6F2Z2_64_139_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9515 16 79 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9488 80 238 3.30.70.980
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9107 25 77 1.10.10.200
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.8999 16 76 1.10.10.200
ID Description Score Start End GO Terms
AF-A0A645G2F6-F1-model_v4 Putative transcriptional regulatory protein YeeN 0.977 80 234 GO:0005829
AF-A0A624X8K8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9759 20 223 GO:0003677
GO:0005829
AF-A0A726F968-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9753 97 234 GO:0003677
GO:0005829
AF-A0A754HAK2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9752 14 234 GO:0003677
GO:0005829
AF-A0A5D4MG52-F1-model_v4 deleted 0.9688 73 234

Map