F442880

General Info

Members Datasets Scaffolds Average Seq Length
433 240 866 114

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10096772|Ga0307413_100967722
Length 124
Sequence MAGRSAIDEAKKGSAEILILAIVEGESHHGYEIAKLIEQRSGGDLRFTLASLYATLYRLEDRGWIKGRWVEKAGQRRRCHYRITDTGRKVLVEQRADWQRFVAALGQVAGVRYLPAEALAKPGA

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
196 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
197 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
210 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
211 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 0
Rhizoplane 3
Rhizosphere 87.99
Stem 0
Stem Tuber 0
Unclassified 37.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10096772 3300031824 Unclassified 1939
2 ARSoilOldRDRAFT_c011720 3300000044 Bacteria 736
3 Ga0065715_10123734 3300005293 Unclassified 2166
4 Ga0065715_10439526 3300005293 Bacteria 838
5 Ga0070676_10539604 3300005328 Unclassified 833
6 Ga0070676_11098069 3300005328 Unclassified 601
7 Ga0070676_11554404 3300005328 Unclassified 510
8 Ga0070683_100001291 3300005329 Bacteria 19074
9 Ga0070690_100720624 3300005330 Bacteria 767
10 Ga0070670_100004508 3300005331 Bacteria 11673
11 Ga0070670_100018958 3300005331 Bacteria 5900
12 Ga0070670_100098644 3300005331 Bacteria 2514
13 Ga0070670_100540411 3300005331 Unclassified 1039
14 Ga0070670_100830181 3300005331 Unclassified 836
15 Ga0068869_100016854 3300005334 Bacteria 4937
16 Ga0068869_101706520 3300005334 Unclassified 562
17 Ga0070666_10084544 3300005335 Unclassified 2172
18 Ga0070666_10867642 3300005335 Unclassified 666
19 Ga0070680_101013679 3300005336 Bacteria 717
20 Ga0070680_101962899 3300005336 Unclassified 507
21 Ga0068868_100073387 3300005338 Bacteria 2732
22 Ga0070660_100702604 3300005339 Unclassified 848
23 Ga0070660_101408864 3300005339 Unclassified 592
24 Ga0070689_100044393 3300005340 Bacteria 3419
25 Ga0070689_100951015 3300005340 Unclassified 762
26 Ga0070691_10062122 3300005341 Unclassified 1798
27 Ga0070687_100021347 3300005343 Bacteria 3042
28 Ga0070661_100005089 3300005344 Bacteria 9071
29 Ga0070661_100432895 3300005344 Bacteria 1044
30 Ga0070661_101729874 3300005344 Bacteria 530
31 Ga0070692_11074266 3300005345 Bacteria 567
32 Ga0070668_100073673 3300005347 Bacteria 2662
33 Ga0070668_100368409 3300005347 Unclassified 1220
34 Ga0070669_100188437 3300005353 Bacteria 1617
35 Ga0070669_101292512 3300005353 Unclassified 632
36 Ga0070675_100005678 3300005354 Bacteria 9552
37 Ga0070675_100052850 3300005354 Bacteria 3341
38 Ga0070675_100420308 3300005354 Bacteria 1195
39 Ga0070674_100030256 3300005356 Bacteria 3575
40 Ga0070674_100076792 3300005356 Bacteria 2376
41 Ga0070674_100085304 3300005356 Bacteria 2266
42 Ga0070674_101638010 3300005356 Unclassified 581
43 Ga0070673_100164498 3300005364 Unclassified 1889
44 Ga0070673_100715944 3300005364 Bacteria 920
45 Ga0070673_100973057 3300005364 Unclassified 789
46 Ga0070688_100070288 3300005365 Unclassified 2238
47 Ga0070667_100058651 3300005367 Bacteria 3255
48 Ga0070701_10299069 3300005438 Bacteria 989
49 Ga0070711_100536115 3300005439 Unclassified 969
50 Ga0070700_100543141 3300005441 Unclassified 902
51 Ga0070694_100104642 3300005444 Bacteria 2007
52 Ga0070694_101291099 3300005444 Unclassified 614
53 Ga0070694_101405191 3300005444 Unclassified 589
54 Ga0070663_100057657 3300005455 Unclassified 2787
55 Ga0070678_100008937 3300005456 Bacteria 6034
56 Ga0070662_100169288 3300005457 Unclassified 1715
57 Ga0070662_101149023 3300005457 Unclassified 667
58 Ga0070662_101635084 3300005457 Unclassified 556
59 Ga0070681_10427876 3300005458 Bacteria 1236
60 Ga0070681_10524972 3300005458 Bacteria 1097
61 Ga0068867_100059178 3300005459 Bacteria 2840
62 Ga0070685_10010990 3300005466 Bacteria 4723
63 Ga0070685_11367895 3300005466 Bacteria 542
64 Ga0070706_100721389 3300005467 Bacteria 924
65 Ga0070699_100109892 3300005518 Bacteria 2420
66 Ga0070699_100289800 3300005518 Bacteria 1468
67 Ga0070679_100307290 3300005530 Unclassified 1536
68 Ga0070684_100002598 3300005535 Bacteria 13334
69 Ga0070672_100051872 3300005543 Bacteria 3201
70 Ga0070686_100033017 3300005544 Bacteria 3177
71 Ga0070695_100423756 3300005545 Bacteria 1014
72 Ga0070696_100104703 3300005546 Bacteria 2032
73 Ga0070693_100011551 3300005547 Bacteria 4450
74 Ga0070665_100229772 3300005548 Unclassified 1855
75 Ga0070665_101643631 3300005548 Bacteria 650
76 Ga0070704_100039551 3300005549 Bacteria 3239
77 Ga0070704_101378500 3300005549 Unclassified 646
78 Ga0068855_100088644 3300005563 Bacteria 3574
79 Ga0070664_100001167 3300005564 Bacteria 20855
80 Ga0070664_100059400 3300005564 Unclassified 3253
81 Ga0070664_100187018 3300005564 Bacteria 1844
82 Ga0070664_101249068 3300005564 Unclassified 701
83 Ga0068857_100016084 3300005577 Bacteria 6555
84 Ga0068854_100607810 3300005578 Bacteria 934
85 Ga0068856_100464659 3300005614 Bacteria 1286
86 Ga0070702_100225309 3300005615 Unclassified 1256
87 Ga0068852_101825751 3300005616 Unclassified 630
88 Ga0068859_100033779 3300005617 Bacteria 5135
89 Ga0068859_100139935 3300005617 Bacteria 2494
90 Ga0068859_100864088 3300005617 Bacteria 990
91 Ga0068864_100663138 3300005618 Unclassified 1017
92 Ga0068864_100975343 3300005618 Bacteria 840
93 Ga0068866_10010213 3300005718 Bacteria 4016
94 Ga0068861_100073378 3300005719 Unclassified 2658
95 Ga0068863_100026718 3300005841 Bacteria 5504
96 Ga0068858_100027665 3300005842 Bacteria 5268
97 Ga0068860_100023059 3300005843 Bacteria 6020
98 Ga0068862_100201544 3300005844 Unclassified 1794
99 Ga0068862_101030565 3300005844 Bacteria 815
100 Ga0081455_10686733 3300005937 Unclassified 654
101 Ga0075365_10232608 3300006038 Bacteria 1294
102 Ga0075368_10022457 3300006042 Bacteria 2403
103 Ga0075363_100137472 3300006048 Bacteria 1374
104 Ga0075364_10006716 3300006051 Bacteria 6783
105 Ga0075364_10014480 3300006051 Bacteria 4874
106 Ga0075364_10059271 3300006051 Bacteria 2509
107 Ga0075362_10043257 3300006177 Bacteria 1994
108 Ga0075362_10648712 3300006177 Unclassified 548
109 Ga0075367_10000811 3300006178 Bacteria 12333
110 Ga0075366_10000053 3300006195 Bacteria 41498
111 Ga0075366_10477507 3300006195 Unclassified 770
112 Ga0097621_100616277 3300006237 Bacteria 993
113 Ga0075370_10010513 3300006353 Bacteria 4840
114 Ga0075370_10674752 3300006353 Bacteria 628
115 Ga0075428_100003387 3300006844 Bacteria 17432
116 Ga0075428_100010142 3300006844 Bacteria 10466
117 Ga0075428_100012136 3300006844 Bacteria 9586
118 Ga0075428_100133032 3300006844 Unclassified 2704
119 Ga0075428_100474257 3300006844 Bacteria 1339
120 Ga0075430_100034108 3300006846 Bacteria 4318
121 Ga0075430_100076753 3300006846 Unclassified 2801
122 Ga0075430_100360967 3300006846 Unclassified 1200
123 Ga0075431_100019635 3300006847 Bacteria 6894
124 Ga0075431_100022774 3300006847 Bacteria 6403
125 Ga0075431_100114172 3300006847 Unclassified 2788
126 Ga0075431_100177324 3300006847 Bacteria 2188
127 Ga0075431_100318110 3300006847 Unclassified 1570
128 Ga0075431_100470822 3300006847 Bacteria 1250
129 Ga0075431_100710988 3300006847 Bacteria 982
130 Ga0075431_100974378 3300006847 Bacteria 816
131 Ga0075433_10030444 3300006852 Bacteria 4605
132 Ga0075433_10252063 3300006852 Bacteria 1566
133 Ga0075433_10499011 3300006852 Unclassified 1071
134 Ga0075433_10856308 3300006852 Unclassified 793
135 Ga0075433_10928748 3300006852 Unclassified 759
136 Ga0075434_100018392 3300006871 Bacteria 6751
137 Ga0075434_100079447 3300006871 Bacteria 3276
138 Ga0075429_100020077 3300006880 Bacteria 5794
139 Ga0075429_100068257 3300006880 Bacteria 3094
140 Ga0075429_100069289 3300006880 Unclassified 3071
141 Ga0075429_100231436 3300006880 Unclassified 1619
142 Ga0075429_100308336 3300006880 Bacteria 1386
143 Ga0068865_100391722 3300006881 Unclassified 1136
144 Ga0075436_100957269 3300006914 Unclassified 642
145 Ga0097620_100033780 3300006931 Bacteria 5135
146 Ga0097620_100139936 3300006931 Bacteria 2494
147 Ga0097620_100864317 3300006931 Bacteria 990
148 Ga0075435_100080528 3300007076 Unclassified 2674
149 Ga0075435_100537543 3300007076 Unclassified 1012
150 Ga0075435_100574980 3300007076 Unclassified 976
151 Ga0075435_100800588 3300007076 Unclassified 821
152 Ga0105240_11112700 3300009093 Unclassified 840
153 Ga0111539_10000060 3300009094 Bacteria 113197
154 Ga0111539_10021362 3300009094 Bacteria 7969
155 Ga0111539_10138659 3300009094 Bacteria 2848
156 Ga0111539_10475842 3300009094 Bacteria 1455
157 Ga0111539_11066858 3300009094 Unclassified 939
158 Ga0111539_11229709 3300009094 Bacteria 870
159 Ga0111539_12362222 3300009094 Bacteria 617
160 Ga0111539_12484801 3300009094 Unclassified 601
161 Ga0105245_10065831 3300009098 Bacteria 3278
162 Ga0114129_10008098 3300009147 Bacteria 14978
163 Ga0114129_10013047 3300009147 Bacteria 11836
164 Ga0114129_10065625 3300009147 Bacteria 5065
165 Ga0114129_10066040 3300009147 Bacteria 5046
166 Ga0114129_10218679 3300009147 Bacteria 2571
167 Ga0114129_10243504 3300009147 Bacteria 2417
168 Ga0105243_10003419 3300009148 Bacteria 12864
169 Ga0105243_10985202 3300009148 Unclassified 844
170 Ga0105243_11469078 3300009148 Unclassified 704
171 Ga0105243_11555908 3300009148 Unclassified 686
172 Ga0105242_10047262 3300009176 Bacteria 3494
173 Ga0105248_10017600 3300009177 Bacteria 7882
174 Ga0105248_10049359 3300009177 Bacteria 4720
175 Ga0105248_11681872 3300009177 Unclassified 719
176 Ga0105248_13093092 3300009177 Bacteria 530
177 Ga0105249_10091608 3300009553 Unclassified 2844
178 Ga0105249_12334683 3300009553 Bacteria 608
179 Ga0105239_11981064 3300010375 Unclassified 676
180 Ga0105246_10587016 3300011119 Unclassified 961
181 Ga0157374_10082924 3300013296 Unclassified 3045
182 Ga0163162_12533455 3300013306 Bacteria 590
183 Ga0157372_10318607 3300013307 Unclassified 1810
184 Ga0157375_10060534 3300013308 Bacteria 3755
185 Ga0163163_10099607 3300014325 Unclassified 2928
186 Ga0163163_10725279 3300014325 Bacteria 1057
187 Ga0157380_11935362 3300014326 Bacteria 651
188 Ga0157380_12159643 3300014326 Unclassified 620
189 Ga0157377_11488952 3300014745 Unclassified 537
190 Ga0157379_10346959 3300014968 Unclassified 1358
191 Ga0213876_10637158 3300021384 Archaea 567
192 Ga0207697_10195658 3300025315 Unclassified 888
193 Ga0207680_10701032 3300025903 Bacteria 725
194 Ga0207707_10159393 3300025912 Bacteria 1973
195 Ga0207707_11275326 3300025912 Unclassified 591
196 Ga0207695_10789543 3300025913 Unclassified 829
197 Ga0207660_11688428 3300025917 Unclassified 509
198 Ga0207662_10007229 3300025918 Bacteria 6040
199 Ga0207657_10474888 3300025919 Unclassified 980
200 Ga0207649_10041261 3300025920 Unclassified 2809
201 Ga0207649_10506368 3300025920 Bacteria 919
202 Ga0207652_11701047 3300025921 Unclassified 535
203 Ga0207650_10076534 3300025925 Bacteria 2528
204 Ga0207650_10243037 3300025925 Unclassified 1455
205 Ga0207650_10575868 3300025925 Unclassified 945
206 Ga0207650_11803740 3300025925 Unclassified 517
207 Ga0207659_10174911 3300025926 Bacteria 1696
208 Ga0207659_10400073 3300025926 Bacteria 1148
209 Ga0207659_10417887 3300025926 Bacteria 1124
210 Ga0207687_10437683 3300025927 Bacteria 1082
211 Ga0207644_10947852 3300025931 Unclassified 722
212 Ga0207690_10154186 3300025932 Unclassified 1706
213 Ga0207706_10034969 3300025933 Bacteria 4469
214 Ga0207706_10421902 3300025933 Unclassified 1156
215 Ga0207706_11421751 3300025933 Bacteria 569
216 Ga0207686_10049051 3300025934 Bacteria 2619
217 Ga0207709_10039594 3300025935 Bacteria 2816
218 Ga0207670_10919449 3300025936 Bacteria 733
219 Ga0207669_10124112 3300025937 Unclassified 1760
220 Ga0207704_10203753 3300025938 Bacteria 1450
221 Ga0207691_10008992 3300025940 Bacteria 9578
222 Ga0207691_10810894 3300025940 Bacteria 786
223 Ga0207711_10065065 3300025941 Unclassified 3151
224 Ga0207711_11379189 3300025941 Bacteria 647
225 Ga0207711_11571365 3300025941 Unclassified 601
226 Ga0207689_10026509 3300025942 Bacteria 4853
227 Ga0207689_11375590 3300025942 Unclassified 592
228 Ga0207661_10007488 3300025944 Bacteria 7766
229 Ga0207661_10009120 3300025944 Bacteria 7111
230 Ga0207679_10050875 3300025945 Unclassified 3030
231 Ga0207679_10150813 3300025945 Unclassified 1891
232 Ga0207679_11058499 3300025945 Unclassified 744
233 Ga0207679_11871015 3300025945 Unclassified 548
234 Ga0207667_10135582 3300025949 Bacteria 2535
235 Ga0207651_10749900 3300025960 Unclassified 863
236 Ga0207651_12118133 3300025960 Unclassified 505
237 Ga0207712_10266449 3300025961 Bacteria 1392
238 Ga0207668_10179894 3300025972 Bacteria 1667
239 Ga0207668_10594831 3300025972 Bacteria 963
240 Ga0207658_10435676 3300025986 Bacteria 1158
241 Ga0207677_10029945 3300026023 Unclassified 3467
242 Ga0207703_11623136 3300026035 Bacteria 622
243 Ga0207678_10006607 3300026067 Bacteria 10280
244 Ga0207678_10040652 3300026067 Bacteria 4032
245 Ga0207708_10094952 3300026075 Unclassified 2303
246 Ga0207708_10765234 3300026075 Bacteria 829
247 Ga0207648_10003039 3300026089 Bacteria 17729
248 Ga0207676_10154202 3300026095 Unclassified 1982
249 Ga0207676_11198616 3300026095 Bacteria 752
250 Ga0207676_12514683 3300026095 Unclassified 511
251 Ga0207674_10008498 3300026116 Bacteria 11854
252 Ga0207675_100005022 3300026118 Bacteria 12748
253 Ga0207675_102222398 3300026118 Unclassified 563
254 Ga0207683_10070272 3300026121 Bacteria 3093
255 Ga0209983_1021775 3300027665 Bacteria 1342
256 Ga0209813_10056380 3300027866 Unclassified 1243
257 Ga0209813_10160490 3300027866 Unclassified 811
258 Ga0207428_10000065 3300027907 Bacteria 151182
259 Ga0207428_10212250 3300027907 Bacteria 1454
260 Ga0207428_10304778 3300027907 Bacteria 1178
261 Ga0268266_11301547 3300028379 Bacteria 702
262 Ga0268266_11320340 3300028379 Bacteria 697
263 Ga0268265_10238669 3300028380 Unclassified 1602
264 Ga0268265_10370931 3300028380 Bacteria 1313
265 Ga0268264_10124317 3300028381 Unclassified 2278
266 Ga0307408_100752908 3300031548 Unclassified 880
267 Ga0316576_10865323 3300031727 Bacteria 648
268 Ga0316578_10305139 3300031728 Bacteria 951
269 Ga0307405_10024322 3300031731 Bacteria 3458
270 Ga0307413_10321086 3300031824 Bacteria 1183
271 Ga0307410_10028225 3300031852 Bacteria 3557
272 Ga0307410_10296418 3300031852 Unclassified 1274
273 Ga0307410_10659153 3300031852 Bacteria 879
274 Ga0307410_11561241 3300031852 Unclassified 582
275 Ga0307406_10702431 3300031901 Bacteria 844
276 Ga0307407_10023468 3300031903 Bacteria 3220
277 Ga0307407_10087515 3300031903 Unclassified 1901
278 Ga0307407_10715336 3300031903 Bacteria 755
279 Ga0307407_10835354 3300031903 Unclassified 703
280 Ga0307412_11152922 3300031911 Bacteria 692
281 Ga0307409_100047681 3300031995 Bacteria 3254
282 Ga0307409_100438072 3300031995 Bacteria 1258
283 Ga0307409_100446606 3300031995 Bacteria 1247
284 Ga0307409_100768246 3300031995 Bacteria 969
285 Ga0307416_100011134 3300032002 Bacteria 5982
286 Ga0307416_100225356 3300032002 Bacteria 1802
287 Ga0307416_100671932 3300032002 Bacteria 1122
288 Ga0307416_100826005 3300032002 Bacteria 1024
289 Ga0307416_103432219 3300032002 Bacteria 530
290 Ga0307414_10817125 3300032004 Bacteria 851
291 Ga0307411_10005992 3300032005 Bacteria 6040
292 Ga0307411_10070299 3300032005 Bacteria 2368
293 Ga0307411_10511952 3300032005 Unclassified 1017
294 Ga0307411_10781673 3300032005 Unclassified 839
295 Ga0307411_11018370 3300032005 Bacteria 742
296 Ga0307411_11426754 3300032005 Bacteria 634
297 Ga0307411_11772617 3300032005 Unclassified 573
298 Ga0307415_100310695 3300032126 Bacteria 1310
299 Ga0307415_100437061 3300032126 Bacteria 1127
300 Ga0373926_0114433 3300035083 Unclassified 1015
301 Ga0373932_0290690 3300035112 Unclassified 607
302 Ga0373936_0274526 3300035113 Viruses 757
303 Ga0373945_0507514 3300035116 Unclassified 538
304 Ga0373946_0432543 3300035171 Bacteria 668
305 Ga0373947_0079114 3300035725 Unclassified 2031
306 Ga0316584_0866866 3300036712 Bacteria 610
307 Ga0373925_0588530 3300037068 Unclassified 916
308 Ga0436365_0566076 3300039437 Bacteria 3145
309 Ga0439439_0149555 3300041406 Unclassified 662
310 Ga0451835_0651754 3300041492 Bacteria 640
311 Ga0451853_0387463 3300041512 Unclassified 530
312 Ga0451853_3811894 3300041512 Unclassified 934
313 Ga0439462_0035385 3300042015 Bacteria 1328
314 Ga0439462_0064633 3300042015 Unclassified 991
315 Ga0450923_010362 3300042125 Bacteria 1652
316 Ga0450904_030992 3300042139 Unclassified 559
317 Ga0439434_0217673 3300042435 Unclassified 647
318 Ga0439434_0374179 3300042435 Unclassified 500
319 Ga0439435_0003253 3300042436 Unclassified 3357
320 Ga0439435_0012690 3300042436 Bacteria 2047
321 Ga0439435_0030219 3300042436 Bacteria 1468
322 Ga0439444_0160131 3300042437 Bacteria 549
323 Ga0451577_1510276 3300042876 Unclassified 594
324 Ga0466967_0690985 3300045976 Bacteria 1010
325 Ga0495653_0009110 3300046463 Bacteria 8117
326 Ga0495632_0349303 3300046519 Unclassified 650
327 Ga0495621_0502663 3300046539 Unclassified 523
328 Ga0495656_0325810 3300046615 Bacteria 792
329 Ga0495658_0413860 3300046683 Bacteria 860
330 Ga0495669_0125557 3300046684 Bacteria 1205
331 Ga0496100_1022955 3300048903 Bacteria 650
332 Ga0496101_0454320 3300048904 Unclassified 1011
333 Ga0496103_0574087 3300048906 Bacteria 719
334 Ga0496104_0232715 3300048907 Unclassified 1754
335 Ga0496107_0759599 3300048910 Bacteria 711
336 Ga0496108_0005393 3300048911 Bacteria 10337
337 Ga0496109_0000593 3300048912 Bacteria 30294
338 Ga0496109_1822009 3300048912 Unclassified 541
339 Ga0496110_0103288 3300048913 Unclassified 2556
340 Ga0496111_0007585 3300048914 Bacteria 7124
341 Ga0496112_0011781 3300048915 Bacteria 8005
342 Ga0496113_0490926 3300048916 Unclassified 986
343 Ga0496113_0800426 3300048916 Bacteria 749
344 Ga0501292_101544 3300049515 Bacteria 570
345 Ga0501293_027048 3300049516 Unclassified 595
346 Ga0501299_044356 3300049522 Bacteria 902
347 Ga0501034_0026059 3300049571 Bacteria 5955
348 Ga0501036_0254453 3300049572 Bacteria 1471
349 Ga0501039_0095624 3300049575 Bacteria 2316
350 Ga0501039_0695269 3300049575 Unclassified 795
351 Ga0501040_0164564 3300049576 Bacteria 1569
352 Ga0501046_0315421 3300049580 Bacteria 1140
353 Ga0501048_0105225 3300049582 Bacteria 1992
354 Ga0501071_1561679 3300049587 Bacteria 509
355 Ga0501072_0167809 3300049588 Bacteria 1751
356 Ga0501074_1133350 3300049590 Bacteria 549
357 Ga0501075_0076052 3300049591 Unclassified 2539
358 Ga0501075_0319824 3300049591 Bacteria 1182
359 Ga0501076_0176372 3300049592 Bacteria 1742
360 Ga0501209_213999 3300049656 Bacteria 596
361 Ga0501216_141223 3300049660 Bacteria 566
362 Ga0501221_043108 3300049704 Unclassified 991
363 Ga0501079_0364903 3300049741 Unclassified 1132
364 Ga0501080_0314345 3300049742 Bacteria 1419
365 Ga0501080_0684250 3300049742 Bacteria 906
366 Ga0501081_0145470 3300049743 Bacteria 1701
367 Ga0501083_0551292 3300049744 Bacteria 750
368 Ga0501273_019502 3300049770 Bacteria 910
369 Ga0501035_0330249 3300049822 Bacteria 1280
370 Ga0501045_0141749 3300049824 Bacteria 1787
371 nmdc:mga03683_101998_c1 3300050489 Bacteria 1262
372 nmdc:mga03683_15921_c1 3300050489 Bacteria 2816
373 nmdc:mga03n38_124379_c1 3300050490 Bacteria 1271
374 nmdc:mga00v17_1048689_c1 3300050491 Unclassified 512
375 nmdc:mga00v17_180356_c1 3300050491 Unclassified 1363
376 nmdc:mga00v17_223648_c1 3300050491 Bacteria 1219
377 nmdc:mga00v17_3512_c1 3300050491 Bacteria 8101
378 nmdc:mga00v17_435612_c1 3300050491 Bacteria 851
379 nmdc:mga0yw44_353360_c1 3300050492 Bacteria 990
380 nmdc:mga0yw44_685590_c1 3300050492 Bacteria 696
381 nmdc:mga0yw44_78076_c1 3300050492 Unclassified 2070
382 nmdc:mga0k408_1852_c1 3300050493 Bacteria 11361
383 nmdc:mga0k408_546533_c1 3300050493 Unclassified 685
384 nmdc:mga06z11_2186_c1 3300050494 Bacteria 7426
385 nmdc:mga04h51_1219_c1 3300050495 Bacteria 5943
386 nmdc:mga04h51_185353_c1 3300050495 Unclassified 812
387 nmdc:mga07m45_151314_c1 3300050496 Bacteria 1346
388 nmdc:mga07m45_89422_c1 3300050496 Unclassified 1763
389 nmdc:mga05p37_170029_c1 3300050507 Bacteria 2658
390 nmdc:mga05p37_184914_c1 3300050507 Bacteria 2534
391 nmdc:mga05p37_19664_c1 3300050507 Bacteria 8170
392 nmdc:mga05p37_282761_c1 3300050507 Bacteria 1978
393 nmdc:mga05p37_29618_c1 3300050507 Bacteria 6680
394 nmdc:mga05p37_681315_c1 3300050507 Bacteria 1146
395 nmdc:mga09592_107815_c1 3300050508 Unclassified 2389
396 nmdc:mga09592_137686_c1 3300050508 Bacteria 2103
397 nmdc:mga09592_157109_c1 3300050508 Unclassified 1963
398 nmdc:mga09592_35917_c1 3300050508 Bacteria 4150
399 nmdc:mga09592_64366_c1 3300050508 Bacteria 3104
400 nmdc:mga0qj67_112580_c1 3300050509 Bacteria 2197
401 nmdc:mga0qj67_219704_c1 3300050509 Unclassified 1543
402 nmdc:mga0qj67_772780_c1 3300050509 Bacteria 761
403 nmdc:mga06r32_1185228_c1 3300050510 Unclassified 710
404 nmdc:mga06r32_271520_c1 3300050510 Bacteria 1683
405 nmdc:mga06r32_477983_c1 3300050510 Bacteria 1224
406 nmdc:mga06r32_5855_c1 3300050510 Bacteria 11063
407 nmdc:mga06r32_616947_c1 3300050510 Unclassified 1055
408 nmdc:mga06r32_67632_c1 3300050510 Bacteria 3450
409 nmdc:mga06r32_723274_c1 3300050510 Bacteria 960
410 nmdc:mga06r32_923277_c1 3300050510 Unclassified 828
411 nmdc:mga08y16_181_c1 3300050511 Bacteria 55651
412 nmdc:mga08y16_28256_c1 3300050511 Bacteria 5911
413 nmdc:mga08y16_45607_c1 3300050511 Bacteria 4593
414 nmdc:mga08y16_911874_c1 3300050511 Bacteria 864
415 nmdc:mga0n895_1124938_c1 3300050512 Unclassified 762
416 nmdc:mga0n895_464581_c1 3300050512 Unclassified 1277
417 nmdc:mga0n895_55653_c1 3300050512 Unclassified 3893
418 nmdc:mga0n895_940023_c1 3300050512 Unclassified 848
419 nmdc:mga0rr50_1645256_c1 3300050513 Unclassified 541
420 nmdc:mga0rr50_21868_c1 3300050513 Bacteria 4377
421 nmdc:mga0rr50_68062_c1 3300050513 Unclassified 977
422 nmdc:mga0a205_1062335_c1 3300050515 Unclassified 657
423 nmdc:mga0a205_30216_c1 3300050515 Bacteria 5187
424 nmdc:mga0a205_372566_c1 3300050515 Bacteria 1294
425 nmdc:mga0a205_418336_c1 3300050515 Bacteria 1202
426 nmdc:mga0a205_818897_c1 3300050515 Unclassified 779
427 nmdc:mga0sz30_42837_c1 3300050516 Unclassified 1905
428 Ga0495655_0364104 3300053083 Unclassified 508
429 Ga0501084_0516503 3300054114 Bacteria 1010
430 Ga0590075_009071 3300059424 Unclassified 2381
431 Ga0590077_034493 3300059426 Bacteria 1112
432 Ga0501082_0255122 3300060353 Bacteria 1526
433 Ga0501082_0888302 3300060353 Bacteria 780
434 Ga0307413_10096772
435 ARSoilOldRDRAFT_c011720
436 Ga0065715_10123734
437 Ga0065715_10439526
438 Ga0070676_10539604
439 Ga0070676_11098069
440 Ga0070676_11554404
441 Ga0070683_100001291
442 Ga0070690_100720624
443 Ga0070670_100004508
444 Ga0070670_100018958
445 Ga0070670_100098644
446 Ga0070670_100540411
447 Ga0070670_100830181
448 Ga0068869_100016854
449 Ga0068869_101706520
450 Ga0070666_10084544
451 Ga0070666_10867642
452 Ga0070680_101013679
453 Ga0070680_101962899
454 Ga0068868_100073387
455 Ga0070660_100702604
456 Ga0070660_101408864
457 Ga0070689_100044393
458 Ga0070689_100951015
459 Ga0070691_10062122
460 Ga0070687_100021347
461 Ga0070661_100005089
462 Ga0070661_100432895
463 Ga0070661_101729874
464 Ga0070692_11074266
465 Ga0070668_100073673
466 Ga0070668_100368409
467 Ga0070669_100188437
468 Ga0070669_101292512
469 Ga0070675_100005678
470 Ga0070675_100052850
471 Ga0070675_100420308
472 Ga0070674_100030256
473 Ga0070674_100076792
474 Ga0070674_100085304
475 Ga0070674_101638010
476 Ga0070673_100164498
477 Ga0070673_100715944
478 Ga0070673_100973057
479 Ga0070688_100070288
480 Ga0070667_100058651
481 Ga0070701_10299069
482 Ga0070711_100536115
483 Ga0070700_100543141
484 Ga0070694_100104642
485 Ga0070694_101291099
486 Ga0070694_101405191
487 Ga0070663_100057657
488 Ga0070678_100008937
489 Ga0070662_100169288
490 Ga0070662_101149023
491 Ga0070662_101635084
492 Ga0070681_10427876
493 Ga0070681_10524972
494 Ga0068867_100059178
495 Ga0070685_10010990
496 Ga0070685_11367895
497 Ga0070706_100721389
498 Ga0070699_100109892
499 Ga0070699_100289800
500 Ga0070679_100307290
501 Ga0070684_100002598
502 Ga0070672_100051872
503 Ga0070686_100033017
504 Ga0070695_100423756
505 Ga0070696_100104703
506 Ga0070693_100011551
507 Ga0070665_100229772
508 Ga0070665_101643631
509 Ga0070704_100039551
510 Ga0070704_101378500
511 Ga0068855_100088644
512 Ga0070664_100001167
513 Ga0070664_100059400
514 Ga0070664_100187018
515 Ga0070664_101249068
516 Ga0068857_100016084
517 Ga0068854_100607810
518 Ga0068856_100464659
519 Ga0070702_100225309
520 Ga0068852_101825751
521 Ga0068859_100033779
522 Ga0068859_100139935
523 Ga0068859_100864088
524 Ga0068864_100663138
525 Ga0068864_100975343
526 Ga0068866_10010213
527 Ga0068861_100073378
528 Ga0068863_100026718
529 Ga0068858_100027665
530 Ga0068860_100023059
531 Ga0068862_100201544
532 Ga0068862_101030565
533 Ga0081455_10686733
534 Ga0075365_10232608
535 Ga0075368_10022457
536 Ga0075363_100137472
537 Ga0075364_10006716
538 Ga0075364_10014480
539 Ga0075364_10059271
540 Ga0075362_10043257
541 Ga0075362_10648712
542 Ga0075367_10000811
543 Ga0075366_10000053
544 Ga0075366_10477507
545 Ga0097621_100616277
546 Ga0075370_10010513
547 Ga0075370_10674752
548 Ga0075428_100003387
549 Ga0075428_100010142
550 Ga0075428_100012136
551 Ga0075428_100133032
552 Ga0075428_100474257
553 Ga0075430_100034108
554 Ga0075430_100076753
555 Ga0075430_100360967
556 Ga0075431_100019635
557 Ga0075431_100022774
558 Ga0075431_100114172
559 Ga0075431_100177324
560 Ga0075431_100318110
561 Ga0075431_100470822
562 Ga0075431_100710988
563 Ga0075431_100974378
564 Ga0075433_10030444
565 Ga0075433_10252063
566 Ga0075433_10499011
567 Ga0075433_10856308
568 Ga0075433_10928748
569 Ga0075434_100018392
570 Ga0075434_100079447
571 Ga0075429_100020077
572 Ga0075429_100068257
573 Ga0075429_100069289
574 Ga0075429_100231436
575 Ga0075429_100308336
576 Ga0068865_100391722
577 Ga0075436_100957269
578 Ga0097620_100033780
579 Ga0097620_100139936
580 Ga0097620_100864317
581 Ga0075435_100080528
582 Ga0075435_100537543
583 Ga0075435_100574980
584 Ga0075435_100800588
585 Ga0105240_11112700
586 Ga0111539_10000060
587 Ga0111539_10021362
588 Ga0111539_10138659
589 Ga0111539_10475842
590 Ga0111539_11066858
591 Ga0111539_11229709
592 Ga0111539_12362222
593 Ga0111539_12484801
594 Ga0105245_10065831
595 Ga0114129_10008098
596 Ga0114129_10013047
597 Ga0114129_10065625
598 Ga0114129_10066040
599 Ga0114129_10218679
600 Ga0114129_10243504
601 Ga0105243_10003419
602 Ga0105243_10985202
603 Ga0105243_11469078
604 Ga0105243_11555908
605 Ga0105242_10047262
606 Ga0105248_10017600
607 Ga0105248_10049359
608 Ga0105248_11681872
609 Ga0105248_13093092
610 Ga0105249_10091608
611 Ga0105249_12334683
612 Ga0105239_11981064
613 Ga0105246_10587016
614 Ga0157374_10082924
615 Ga0163162_12533455
616 Ga0157372_10318607
617 Ga0157375_10060534
618 Ga0163163_10099607
619 Ga0163163_10725279
620 Ga0157380_11935362
621 Ga0157380_12159643
622 Ga0157377_11488952
623 Ga0157379_10346959
624 Ga0213876_10637158
625 Ga0207697_10195658
626 Ga0207680_10701032
627 Ga0207707_10159393
628 Ga0207707_11275326
629 Ga0207695_10789543
630 Ga0207660_11688428
631 Ga0207662_10007229
632 Ga0207657_10474888
633 Ga0207649_10041261
634 Ga0207649_10506368
635 Ga0207652_11701047
636 Ga0207650_10076534
637 Ga0207650_10243037
638 Ga0207650_10575868
639 Ga0207650_11803740
640 Ga0207659_10174911
641 Ga0207659_10400073
642 Ga0207659_10417887
643 Ga0207687_10437683
644 Ga0207644_10947852
645 Ga0207690_10154186
646 Ga0207706_10034969
647 Ga0207706_10421902
648 Ga0207706_11421751
649 Ga0207686_10049051
650 Ga0207709_10039594
651 Ga0207670_10919449
652 Ga0207669_10124112
653 Ga0207704_10203753
654 Ga0207691_10008992
655 Ga0207691_10810894
656 Ga0207711_10065065
657 Ga0207711_11379189
658 Ga0207711_11571365
659 Ga0207689_10026509
660 Ga0207689_11375590
661 Ga0207661_10007488
662 Ga0207661_10009120
663 Ga0207679_10050875
664 Ga0207679_10150813
665 Ga0207679_11058499
666 Ga0207679_11871015
667 Ga0207667_10135582
668 Ga0207651_10749900
669 Ga0207651_12118133
670 Ga0207712_10266449
671 Ga0207668_10179894
672 Ga0207668_10594831
673 Ga0207658_10435676
674 Ga0207677_10029945
675 Ga0207703_11623136
676 Ga0207678_10006607
677 Ga0207678_10040652
678 Ga0207708_10094952
679 Ga0207708_10765234
680 Ga0207648_10003039
681 Ga0207676_10154202
682 Ga0207676_11198616
683 Ga0207676_12514683
684 Ga0207674_10008498
685 Ga0207675_100005022
686 Ga0207675_102222398
687 Ga0207683_10070272
688 Ga0209983_1021775
689 Ga0209813_10056380
690 Ga0209813_10160490
691 Ga0207428_10000065
692 Ga0207428_10212250
693 Ga0207428_10304778
694 Ga0268266_11301547
695 Ga0268266_11320340
696 Ga0268265_10238669
697 Ga0268265_10370931
698 Ga0268264_10124317
699 Ga0307408_100752908
700 Ga0316576_10865323
701 Ga0316578_10305139
702 Ga0307405_10024322
703 Ga0307413_10321086
704 Ga0307410_10028225
705 Ga0307410_10296418
706 Ga0307410_10659153
707 Ga0307410_11561241
708 Ga0307406_10702431
709 Ga0307407_10023468
710 Ga0307407_10087515
711 Ga0307407_10715336
712 Ga0307407_10835354
713 Ga0307412_11152922
714 Ga0307409_100047681
715 Ga0307409_100438072
716 Ga0307409_100446606
717 Ga0307409_100768246
718 Ga0307416_100011134
719 Ga0307416_100225356
720 Ga0307416_100671932
721 Ga0307416_100826005
722 Ga0307416_103432219
723 Ga0307414_10817125
724 Ga0307411_10005992
725 Ga0307411_10070299
726 Ga0307411_10511952
727 Ga0307411_10781673
728 Ga0307411_11018370
729 Ga0307411_11426754
730 Ga0307411_11772617
731 Ga0307415_100310695
732 Ga0307415_100437061
733 Ga0373926_0114433
734 Ga0373932_0290690
735 Ga0373936_0274526
736 Ga0373945_0507514
737 Ga0373946_0432543
738 Ga0373947_0079114
739 Ga0316584_0866866
740 Ga0373925_0588530
741 Ga0436365_0566076
742 Ga0439439_0149555
743 Ga0451835_0651754
744 Ga0451853_0387463
745 Ga0451853_3811894
746 Ga0439462_0035385
747 Ga0439462_0064633
748 Ga0450923_010362
749 Ga0450904_030992
750 Ga0439434_0217673
751 Ga0439434_0374179
752 Ga0439435_0003253
753 Ga0439435_0012690
754 Ga0439435_0030219
755 Ga0439444_0160131
756 Ga0451577_1510276
757 Ga0466967_0690985
758 Ga0495653_0009110
759 Ga0495632_0349303
760 Ga0495621_0502663
761 Ga0495656_0325810
762 Ga0495658_0413860
763 Ga0495669_0125557
764 Ga0496100_1022955
765 Ga0496101_0454320
766 Ga0496103_0574087
767 Ga0496104_0232715
768 Ga0496107_0759599
769 Ga0496108_0005393
770 Ga0496109_0000593
771 Ga0496109_1822009
772 Ga0496110_0103288
773 Ga0496111_0007585
774 Ga0496112_0011781
775 Ga0496113_0490926
776 Ga0496113_0800426
777 Ga0501292_101544
778 Ga0501293_027048
779 Ga0501299_044356
780 Ga0501034_0026059
781 Ga0501036_0254453
782 Ga0501039_0095624
783 Ga0501039_0695269
784 Ga0501040_0164564
785 Ga0501046_0315421
786 Ga0501048_0105225
787 Ga0501071_1561679
788 Ga0501072_0167809
789 Ga0501074_1133350
790 Ga0501075_0076052
791 Ga0501075_0319824
792 Ga0501076_0176372
793 Ga0501209_213999
794 Ga0501216_141223
795 Ga0501221_043108
796 Ga0501079_0364903
797 Ga0501080_0314345
798 Ga0501080_0684250
799 Ga0501081_0145470
800 Ga0501083_0551292
801 Ga0501273_019502
802 Ga0501035_0330249
803 Ga0501045_0141749
804 nmdc:mga03683_101998_c1
805 nmdc:mga03683_15921_c1
806 nmdc:mga03n38_124379_c1
807 nmdc:mga00v17_1048689_c1
808 nmdc:mga00v17_180356_c1
809 nmdc:mga00v17_223648_c1
810 nmdc:mga00v17_3512_c1
811 nmdc:mga00v17_435612_c1
812 nmdc:mga0yw44_353360_c1
813 nmdc:mga0yw44_685590_c1
814 nmdc:mga0yw44_78076_c1
815 nmdc:mga0k408_1852_c1
816 nmdc:mga0k408_546533_c1
817 nmdc:mga06z11_2186_c1
818 nmdc:mga04h51_1219_c1
819 nmdc:mga04h51_185353_c1
820 nmdc:mga07m45_151314_c1
821 nmdc:mga07m45_89422_c1
822 nmdc:mga05p37_170029_c1
823 nmdc:mga05p37_184914_c1
824 nmdc:mga05p37_19664_c1
825 nmdc:mga05p37_282761_c1
826 nmdc:mga05p37_29618_c1
827 nmdc:mga05p37_681315_c1
828 nmdc:mga09592_107815_c1
829 nmdc:mga09592_137686_c1
830 nmdc:mga09592_157109_c1
831 nmdc:mga09592_35917_c1
832 nmdc:mga09592_64366_c1
833 nmdc:mga0qj67_112580_c1
834 nmdc:mga0qj67_219704_c1
835 nmdc:mga0qj67_772780_c1
836 nmdc:mga06r32_1185228_c1
837 nmdc:mga06r32_271520_c1
838 nmdc:mga06r32_477983_c1
839 nmdc:mga06r32_5855_c1
840 nmdc:mga06r32_616947_c1
841 nmdc:mga06r32_67632_c1
842 nmdc:mga06r32_723274_c1
843 nmdc:mga06r32_923277_c1
844 nmdc:mga08y16_181_c1
845 nmdc:mga08y16_28256_c1
846 nmdc:mga08y16_45607_c1
847 nmdc:mga08y16_911874_c1
848 nmdc:mga0n895_1124938_c1
849 nmdc:mga0n895_464581_c1
850 nmdc:mga0n895_55653_c1
851 nmdc:mga0n895_940023_c1
852 nmdc:mga0rr50_1645256_c1
853 nmdc:mga0rr50_21868_c1
854 nmdc:mga0rr50_68062_c1
855 nmdc:mga0a205_1062335_c1
856 nmdc:mga0a205_30216_c1
857 nmdc:mga0a205_372566_c1
858 nmdc:mga0a205_418336_c1
859 nmdc:mga0a205_818897_c1
860 nmdc:mga0sz30_42837_c1
861 Ga0495655_0364104
862 Ga0501084_0516503
863 Ga0590075_009071
864 Ga0590077_034493
865 Ga0501082_0255122
866 Ga0501082_0888302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

19

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9305 9 107
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9111 1 107
5h20-assembly1.cif.gz_A-2 x-ray structure of padr-like transcription factor from bacteroid fragilis 0.9104 8 108
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9021 5 109
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.8965 14 84
ID Description Score Start End Superfamily
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9434 16 97 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9305 9 107 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9106 16 92 1.10.10.10
5h20A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9104 8 108 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.906 16 92 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A534KDG9-F1-model_v4 PadR family transcriptional regulator 0.986 12 108
AF-A0A7V9SMK9-F1-model_v4 PadR family transcriptional regulator 0.9778 15 93
AF-R6PLB6-F1-model_v4 Transcriptional regulator PadR-like family protein 0.9651 18 110
AF-A0A7C5QRK1-F1-model_v4 PadR family transcriptional regulator 0.9628 16 92
AF-A0A847HVX9-F1-model_v4 PadR family transcriptional regulator 0.9624 14 96

Map