F442844

General Info

Members Datasets Scaffolds Average Seq Length
433 236 866 367

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10033410|Ga0157380_100334102
Length 422
Sequence LKLPTRGKRGDPHGSSSSRAQHGPHGRASVGDNPEHVSRQDSRDSIGAVSSPMSMALVTPAPGPTSGEAPSRSTGFGTTVFDVIAPEAVGRRRGPESAFDVCHVGVVLRALLFVHATMAIGMVFGAATFATWLSMTAAGASVALPGVLIWLLVVCALKAQLTRAPLALQWLVVIGLGAVAALGASQLILAVVPDAASAGLASLLGAGPALAGAAMAAAIFQWLRLLAQATLPAETTARLAELQSRIRPHFLFNTLNTALTLVRLDPGKAEGVLEDLAELFRVAIAESAESVSLGEEVDLAQRYLDIEQIRFGSRLHVTWELDPQAASARVPPLLLQPLVENAVRHGVEPSPEGGVIRVRTKVKLGRAVLSIANSVPKEPSRPGHGMALKNVRERLRLMHDVAAQFEMRQDEDVFRVQIVVPL

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
207 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
219 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
220 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
221 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
230 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
231 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
232 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
233 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
234 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
235 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
236 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 0
Rhizoplane 4.16
Rhizosphere 79.91
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10033410 3300014326 Bacteria 3961
2 JGI25152J39213_1003968 3300002773 Bacteria 4831
3 JGI25153J46596_10013898 3300003215 Bacteria 3378
4 JGI25153J46596_10013946 3300003215 Unclassified 3370
5 rootH1_10016312 3300003316 Bacteria 1898
6 rootL2_10178597 3300003322 Bacteria 1924
7 Ga0055526_1001909 3300003771 Bacteria 14438
8 Ga0065165_1005423 3300005262 Bacteria 7180
9 Ga0070658_10027033 3300005327 Bacteria 4607
10 Ga0070658_10078185 3300005327 Bacteria 2715
11 Ga0070676_10001611 3300005328 Bacteria 11473
12 Ga0070676_10006499 3300005328 Bacteria 6245
13 Ga0070676_10007770 3300005328 Bacteria 5760
14 Ga0070676_10024955 3300005328 Bacteria 3374
15 Ga0070683_100026824 3300005329 Bacteria 5191
16 Ga0070690_100061366 3300005330 Bacteria 2422
17 Ga0070670_100043165 3300005331 Bacteria 3876
18 Ga0070670_100301184 3300005331 Bacteria 1402
19 Ga0070670_100308750 3300005331 Bacteria 1384
20 Ga0070677_10009064 3300005333 Bacteria 3368
21 Ga0070677_10017911 3300005333 Bacteria 2543
22 Ga0070677_10020757 3300005333 Bacteria 2398
23 Ga0068869_100006643 3300005334 Bacteria 7345
24 Ga0068869_100008107 3300005334 Bacteria 6756
25 Ga0068869_100019365 3300005334 Bacteria 4648
26 Ga0068869_100158640 3300005334 Bacteria 1760
27 Ga0068869_100171399 3300005334 Bacteria 1696
28 Ga0070666_10000601 3300005335 Bacteria 21615
29 Ga0070680_100039594 3300005336 Bacteria 3813
30 Ga0068868_100006388 3300005338 Bacteria 8338
31 Ga0068868_100010447 3300005338 Bacteria 6721
32 Ga0068868_100010849 3300005338 Bacteria 6610
33 Ga0068868_100083797 3300005338 Bacteria 2560
34 Ga0068868_100162423 3300005338 Bacteria 1845
35 Ga0070660_100130246 3300005339 Bacteria 2012
36 Ga0070687_100011936 3300005343 Bacteria 3819
37 Ga0070661_100130875 3300005344 Bacteria 1884
38 Ga0070692_10020138 3300005345 Bacteria 3231
39 Ga0070668_100006370 3300005347 Bacteria 8745
40 Ga0070668_100040485 3300005347 Bacteria 3566
41 Ga0070669_100005118 3300005353 Bacteria 9479
42 Ga0070669_100088415 3300005353 Bacteria 2319
43 Ga0070675_100002437 3300005354 Bacteria 13893
44 Ga0070675_100002524 3300005354 Bacteria 13700
45 Ga0070675_100024456 3300005354 Bacteria 4837
46 Ga0070675_100041283 3300005354 Bacteria 3768
47 Ga0070675_100199485 3300005354 Bacteria 1736
48 Ga0070675_100287382 3300005354 Bacteria 1447
49 Ga0070671_100010869 3300005355 Bacteria 7306
50 Ga0070671_100012416 3300005355 Bacteria 6858
51 Ga0070671_100033458 3300005355 Bacteria 4252
52 Ga0070671_100040666 3300005355 Bacteria 3862
53 Ga0070671_100131039 3300005355 Bacteria 2112
54 Ga0070674_100012099 3300005356 Bacteria 5287
55 Ga0070674_100025061 3300005356 Bacteria 3878
56 Ga0070673_100002831 3300005364 Bacteria 10677
57 Ga0070673_100005638 3300005364 Bacteria 8036
58 Ga0070673_100020631 3300005364 Bacteria 4755
59 Ga0070673_100053157 3300005364 Bacteria 3180
60 Ga0070673_100157207 3300005364 Bacteria 1930
61 Ga0070659_100127595 3300005366 Bacteria 2064
62 Ga0070667_100002909 3300005367 Bacteria 14715
63 Ga0070667_100011298 3300005367 Bacteria 7386
64 Ga0070667_100062168 3300005367 Bacteria 3162
65 Ga0070667_100178598 3300005367 Bacteria 1877
66 Ga0070663_100001718 3300005455 Bacteria 12149
67 Ga0070663_100003146 3300005455 Bacteria 9463
68 Ga0070678_100001353 3300005456 Bacteria 13046
69 Ga0070678_100007938 3300005456 Bacteria 6322
70 Ga0070678_100225881 3300005456 Bacteria 1558
71 Ga0070662_100001682 3300005457 Bacteria 13598
72 Ga0070662_100084084 3300005457 Bacteria 2376
73 Ga0070681_10070808 3300005458 Bacteria 3452
74 Ga0068867_100000118 3300005459 Bacteria 50315
75 Ga0068867_100010409 3300005459 Bacteria 6562
76 Ga0068867_100013383 3300005459 Bacteria 5812
77 Ga0068867_100015223 3300005459 Bacteria 5454
78 Ga0068867_100018936 3300005459 Bacteria 4900
79 Ga0068867_100026546 3300005459 Bacteria 4159
80 Ga0068867_100066655 3300005459 Bacteria 2682
81 Ga0070706_100000965 3300005467 Bacteria 31374
82 Ga0070699_100123620 3300005518 Bacteria 2277
83 Ga0070679_100048911 3300005530 Bacteria 4212
84 Ga0068853_100169891 3300005539 Bacteria 1972
85 Ga0070672_100003437 3300005543 Bacteria 10261
86 Ga0070672_100003887 3300005543 Bacteria 9733
87 Ga0070672_100006503 3300005543 Bacteria 7853
88 Ga0070672_100007981 3300005543 Bacteria 7231
89 Ga0070672_100008749 3300005543 Bacteria 6949
90 Ga0070672_100030004 3300005543 Bacteria 4082
91 Ga0070672_100079552 3300005543 Bacteria 2624
92 Ga0070693_100149857 3300005547 Bacteria 1476
93 Ga0070665_100024704 3300005548 Bacteria 6054
94 Ga0070665_100078421 3300005548 Bacteria 3309
95 Ga0068855_100034936 3300005563 Bacteria 5990
96 Ga0070664_100188926 3300005564 Bacteria 1835
97 Ga0068857_100053448 3300005577 Bacteria 3583
98 Ga0068857_100056743 3300005577 Bacteria 3475
99 Ga0068854_100032217 3300005578 Bacteria 3645
100 Ga0068854_100206554 3300005578 Bacteria 1547
101 Ga0070702_100010660 3300005615 Bacteria 4539
102 Ga0068852_100013245 3300005616 Bacteria 6305
103 Ga0068852_100014306 3300005616 Bacteria 6103
104 Ga0068859_100311484 3300005617 Bacteria 1668
105 Ga0068864_100005532 3300005618 Bacteria 10357
106 Ga0068864_100021008 3300005618 Bacteria 5466
107 Ga0068864_100042789 3300005618 Bacteria 3876
108 Ga0068864_100076307 3300005618 Bacteria 2928
109 Ga0068864_100201942 3300005618 Bacteria 1827
110 Ga0068866_10044964 3300005718 Bacteria 2212
111 Ga0068861_100001984 3300005719 Bacteria 13218
112 Ga0068861_100004050 3300005719 Bacteria 9813
113 Ga0068851_10003613 3300005834 Bacteria 6896
114 Ga0068851_10019980 3300005834 Bacteria 3240
115 Ga0068870_10015312 3300005840 Bacteria 3636
116 Ga0068863_100008538 3300005841 Bacteria 10009
117 Ga0068863_100020081 3300005841 Bacteria 6391
118 Ga0068863_100368980 3300005841 Bacteria 1400
119 Ga0068858_100000366 3300005842 Bacteria 47603
120 Ga0068858_100003535 3300005842 Bacteria 15479
121 Ga0068860_100010516 3300005843 Bacteria 9149
122 Ga0068860_100012879 3300005843 Bacteria 8221
123 Ga0068860_100057768 3300005843 Bacteria 3689
124 Ga0068862_100014899 3300005844 Bacteria 6459
125 Ga0068862_100145685 3300005844 Bacteria 2105
126 Ga0075362_10005831 3300006177 Bacteria 4543
127 Ga0075367_10008921 3300006178 Bacteria 5218
128 Ga0075367_10013328 3300006178 Bacteria 4416
129 Ga0075367_10026931 3300006178 Bacteria 3265
130 Ga0075366_10003454 3300006195 Bacteria 8338
131 Ga0075366_10033486 3300006195 Bacteria 3027
132 Ga0075366_10043038 3300006195 Bacteria 2674
133 Ga0075366_10059805 3300006195 Bacteria 2263
134 Ga0097621_100039158 3300006237 Bacteria 3807
135 Ga0097621_100047833 3300006237 Bacteria 3467
136 Ga0097621_100110553 3300006237 Bacteria 2322
137 Ga0075370_10012739 3300006353 Bacteria 4452
138 Ga0075370_10031975 3300006353 Bacteria 2939
139 Ga0068871_100022996 3300006358 Bacteria 4813
140 Ga0068871_100091970 3300006358 Bacteria 2529
141 Ga0068871_100243500 3300006358 Bacteria 1564
142 Ga0075429_100001726 3300006880 Bacteria 18078
143 Ga0068865_100105504 3300006881 Bacteria 2070
144 Ga0097620_100311478 3300006931 Bacteria 1668
145 Ga0105240_10079271 3300009093 Bacteria 4042
146 Ga0105245_10100343 3300009098 Bacteria 2677
147 Ga0105243_10001408 3300009148 Bacteria 21265
148 Ga0105241_10217759 3300009174 Bacteria 1603
149 Ga0105242_10228492 3300009176 Bacteria 1666
150 Ga0105248_10002745 3300009177 Bacteria 19554
151 Ga0105248_10003694 3300009177 Bacteria 16961
152 Ga0105248_10073729 3300009177 Bacteria 3836
153 Ga0105248_10322074 3300009177 Bacteria 1741
154 Ga0105237_10001582 3300009545 Bacteria 29631
155 Ga0105237_10098029 3300009545 Bacteria 2922
156 Ga0105237_10272678 3300009545 Bacteria 1695
157 Ga0105238_10002762 3300009551 Bacteria 17514
158 Ga0105238_10016418 3300009551 Bacteria 7496
159 Ga0105249_10004419 3300009553 Bacteria 12156
160 Ga0105239_10001198 3300010375 Bacteria 35468
161 Ga0105239_10137437 3300010375 Bacteria 2721
162 Ga0157369_10065369 3300013105 Bacteria 3914
163 Ga0157374_10014987 3300013296 Bacteria 6793
164 Ga0157374_10086987 3300013296 Bacteria 2974
165 Ga0163162_10037870 3300013306 Bacteria 4813
166 Ga0163162_10065499 3300013306 Bacteria 3680
167 Ga0163162_10283684 3300013306 Bacteria 1788
168 Ga0157372_10063647 3300013307 Bacteria 4137
169 Ga0157372_10107189 3300013307 Bacteria 3197
170 Ga0157375_10007448 3300013308 Bacteria 9577
171 Ga0157375_10020991 3300013308 Bacteria 5979
172 Ga0157375_10090976 3300013308 Bacteria 3111
173 Ga0157375_10139441 3300013308 Bacteria 2551
174 Ga0157375_10197714 3300013308 Bacteria 2166
175 Ga0157375_10310855 3300013308 Bacteria 1740
176 Ga0163163_10113073 3300014325 Bacteria 2745
177 Ga0157380_10018324 3300014326 Bacteria 5195
178 Ga0157377_10000343 3300014745 Bacteria 20731
179 Ga0157377_10008399 3300014745 Bacteria 5035
180 Ga0157379_10017039 3300014968 Bacteria 6396
181 Ga0157379_10025223 3300014968 Bacteria 5279
182 Ga0157379_10027564 3300014968 Bacteria 5058
183 Ga0157379_10119755 3300014968 Bacteria 2367
184 Ga0157379_10196071 3300014968 Bacteria 1825
185 Ga0157376_10052161 3300014969 Bacteria 3400
186 Ga0157376_10076841 3300014969 Bacteria 2854
187 Ga0163161_10022192 3300017792 Bacteria 4467
188 Ga0163161_10023866 3300017792 Bacteria 4316
189 Ga0163161_10144965 3300017792 Bacteria 1800
190 Ga0209129_1000043 3300025258 Bacteria 298978
191 Ga0209673_1004179 3300025273 Bacteria 7882
192 Ga0209673_1023364 3300025273 Bacteria 2108
193 Ga0209564_1000014 3300025295 Bacteria 621501
194 Ga0209758_1000307 3300025297 Bacteria 95192
195 Ga0209758_1000492 3300025297 Bacteria 64511
196 Ga0209050_1000493 3300025298 Bacteria 67885
197 Ga0207697_10012457 3300025315 Bacteria 3564
198 Ga0207656_10006768 3300025321 Bacteria 4142
199 Ga0207682_10003952 3300025893 Bacteria 6314
200 Ga0207682_10008190 3300025893 Bacteria 4145
201 Ga0207682_10016294 3300025893 Bacteria 2899
202 Ga0207682_10030894 3300025893 Bacteria 2148
203 Ga0207642_10034537 3300025899 Bacteria 2151
204 Ga0207688_10011790 3300025901 Bacteria 4755
205 Ga0207680_10114442 3300025903 Bacteria 1755
206 Ga0207645_10001578 3300025907 Bacteria 18608
207 Ga0207645_10005999 3300025907 Bacteria 8742
208 Ga0207645_10019747 3300025907 Bacteria 4414
209 Ga0207645_10022214 3300025907 Bacteria 4130
210 Ga0207643_10055608 3300025908 Bacteria 2250
211 Ga0207643_10097118 3300025908 Bacteria 1724
212 Ga0207705_10045377 3300025909 Bacteria 3158
213 Ga0207705_10061559 3300025909 Bacteria 2711
214 Ga0207684_10002804 3300025910 Bacteria 17330
215 Ga0207671_10001614 3300025914 Bacteria 25651
216 Ga0207671_10044427 3300025914 Bacteria 3286
217 Ga0207660_10092905 3300025917 Bacteria 2240
218 Ga0207662_10001240 3300025918 Bacteria 12250
219 Ga0207646_10014090 3300025922 Bacteria 7605
220 Ga0207681_10000634 3300025923 Bacteria 23457
221 Ga0207681_10009755 3300025923 Bacteria 5873
222 Ga0207650_10001855 3300025925 Bacteria 14901
223 Ga0207650_10009236 3300025925 Bacteria 6737
224 Ga0207650_10094766 3300025925 Bacteria 2288
225 Ga0207659_10002325 3300025926 Bacteria 11323
226 Ga0207659_10002524 3300025926 Bacteria 10891
227 Ga0207659_10008200 3300025926 Bacteria 6474
228 Ga0207659_10017565 3300025926 Bacteria 4674
229 Ga0207659_10018246 3300025926 Bacteria 4597
230 Ga0207659_10055118 3300025926 Bacteria 2842
231 Ga0207687_10161501 3300025927 Bacteria 1720
232 Ga0207644_10000264 3300025931 Bacteria 35311
233 Ga0207644_10003222 3300025931 Bacteria 10521
234 Ga0207644_10020670 3300025931 Bacteria 4480
235 Ga0207690_10004434 3300025932 Bacteria 8282
236 Ga0207706_10003415 3300025933 Bacteria 15171
237 Ga0207706_10094711 3300025933 Bacteria 2627
238 Ga0207709_10000850 3300025935 Bacteria 23364
239 Ga0207670_10031970 3300025936 Bacteria 3379
240 Ga0207670_10141362 3300025936 Bacteria 1776
241 Ga0207669_10044893 3300025937 Bacteria 2600
242 Ga0207704_10055821 3300025938 Bacteria 2416
243 Ga0207691_10005307 3300025940 Bacteria 12438
244 Ga0207691_10007010 3300025940 Bacteria 10872
245 Ga0207691_10031990 3300025940 Bacteria 4909
246 Ga0207691_10036993 3300025940 Bacteria 4521
247 Ga0207691_10045319 3300025940 Bacteria 4043
248 Ga0207691_10051561 3300025940 Bacteria 3761
249 Ga0207691_10323652 3300025940 Bacteria 1322
250 Ga0207691_10323797 3300025940 Bacteria 1321
251 Ga0207711_10001750 3300025941 Bacteria 19915
252 Ga0207711_10003373 3300025941 Bacteria 13834
253 Ga0207711_10025860 3300025941 Bacteria 4922
254 Ga0207711_10175952 3300025941 Bacteria 1944
255 Ga0207689_10003399 3300025942 Bacteria 14536
256 Ga0207689_10009456 3300025942 Bacteria 8415
257 Ga0207689_10022214 3300025942 Bacteria 5334
258 Ga0207689_10069500 3300025942 Bacteria 2894
259 Ga0207679_10034885 3300025945 Bacteria 3554
260 Ga0207679_10046298 3300025945 Bacteria 3152
261 Ga0207667_10066908 3300025949 Bacteria 3744
262 Ga0207651_10000726 3300025960 Bacteria 14099
263 Ga0207651_10016312 3300025960 Bacteria 4347
264 Ga0207651_10196866 3300025960 Bacteria 1611
265 Ga0207712_10012921 3300025961 Bacteria 5344
266 Ga0207668_10000316 3300025972 Bacteria 31416
267 Ga0207668_10008970 3300025972 Bacteria 5981
268 Ga0207668_10207683 3300025972 Bacteria 1564
269 Ga0207640_10006815 3300025981 Bacteria 6282
270 Ga0207658_10001493 3300025986 Bacteria 18184
271 Ga0207658_10003581 3300025986 Bacteria 10968
272 Ga0207658_10029135 3300025986 Bacteria 3895
273 Ga0207677_10001252 3300026023 Bacteria 13677
274 Ga0207677_10001906 3300026023 Bacteria 11016
275 Ga0207677_10027519 3300026023 Bacteria 3582
276 Ga0207677_10061989 3300026023 Bacteria 2592
277 Ga0207703_10000616 3300026035 Bacteria 36009
278 Ga0207703_10005986 3300026035 Bacteria 9744
279 Ga0207703_10017344 3300026035 Bacteria 5620
280 Ga0207678_10001164 3300026067 Bacteria 24067
281 Ga0207678_10023154 3300026067 Bacteria 5434
282 Ga0207678_10052464 3300026067 Bacteria 3518
283 Ga0207678_10194502 3300026067 Bacteria 1734
284 Ga0207708_10009445 3300026075 Bacteria 7222
285 Ga0207702_10043052 3300026078 Bacteria 3789
286 Ga0207702_10073130 3300026078 Bacteria 2955
287 Ga0207641_10004967 3300026088 Bacteria 11410
288 Ga0207641_10035633 3300026088 Bacteria 4147
289 Ga0207641_10258151 3300026088 Bacteria 1630
290 Ga0207648_10002014 3300026089 Bacteria 22175
291 Ga0207648_10011503 3300026089 Bacteria 8331
292 Ga0207648_10011543 3300026089 Bacteria 8318
293 Ga0207648_10038737 3300026089 Bacteria 4193
294 Ga0207648_10041423 3300026089 Bacteria 4044
295 Ga0207648_10176147 3300026089 Bacteria 1892
296 Ga0207648_10193910 3300026089 Bacteria 1801
297 Ga0207648_10312193 3300026089 Bacteria 1411
298 Ga0207676_10002431 3300026095 Bacteria 13264
299 Ga0207676_10237980 3300026095 Bacteria 1631
300 Ga0207674_10082149 3300026116 Bacteria 3224
301 Ga0207674_10191489 3300026116 Bacteria 1995
302 Ga0207674_10252352 3300026116 Bacteria 1711
303 Ga0207674_10271062 3300026116 Bacteria 1645
304 Ga0207675_100001106 3300026118 Bacteria 26680
305 Ga0207675_100009921 3300026118 Bacteria 8914
306 Ga0207683_10004615 3300026121 Bacteria 11873
307 Ga0207683_10022132 3300026121 Bacteria 5454
308 Ga0207683_10031584 3300026121 Bacteria 4596
309 Ga0207683_10047674 3300026121 Bacteria 3752
310 Ga0207698_10010883 3300026142 Bacteria 5873
311 Ga0268266_10108979 3300028379 Bacteria 2451
312 Ga0268265_10090730 3300028380 Bacteria 2441
313 Ga0268264_10017259 3300028381 Bacteria 5913
314 Ga0307517_10002551 3300028786 Bacteria 29003
315 Ga0307517_10098134 3300028786 Bacteria 2333
316 Ga0307515_10006463 3300028794 Bacteria 23455
317 Ga0307512_10053053 3300030522 Bacteria 3228
318 Ga0307513_10013819 3300031456 Bacteria 9897
319 Ga0307513_10107132 3300031456 Bacteria 2799
320 Ga0307513_10280678 3300031456 Bacteria 1443
321 Ga0307513_10296701 3300031456 Bacteria 1385
322 Ga0307509_10003013 3300031507 Bacteria 26337
323 Ga0307509_10006419 3300031507 Bacteria 15842
324 Ga0307408_100074907 3300031548 Bacteria 2513
325 Ga0307408_100083868 3300031548 Bacteria 2389
326 Ga0307508_10002994 3300031616 Bacteria 17413
327 Ga0307508_10038790 3300031616 Bacteria 4279
328 Ga0307514_10021350 3300031649 Bacteria 5278
329 Ga0307516_10009114 3300031730 Bacteria 11114
330 Ga0307410_10126606 3300031852 Bacteria 1871
331 Ga0307406_10008188 3300031901 Bacteria 5825
332 Ga0307407_10033602 3300031903 Bacteria 2800
333 Ga0307409_100004091 3300031995 Bacteria 8115
334 Ga0307409_100309524 3300031995 Bacteria 1473
335 Ga0307416_100011104 3300032002 Bacteria 5989
336 Ga0307416_100139269 3300032002 Bacteria 2202
337 Ga0307415_100065856 3300032126 Bacteria 2526
338 Ga0307507_10036366 3300033179 Bacteria 5034
339 Ga0307510_10001378 3300033180 Bacteria 26617
340 Ga0307510_10037621 3300033180 Bacteria 5367
341 Ga0373959_0003203 3300034820 Bacteria 2604
342 Ga0373928_0017469 3300035084 Bacteria 1477
343 Ga0373945_0018072 3300035116 Bacteria 2396
344 Ga0373943_0038902 3300035170 Bacteria 2289
345 Ga0373946_0117759 3300035171 Bacteria 1210
346 Ga0373955_0075688 3300035172 Bacteria 1892
347 Ga0373931_0003277 3300035691 Bacteria 7247
348 Ga0373937_0053732 3300036401 Bacteria 3695
349 Ga0373925_0038285 3300037068 Bacteria 3545
350 Ga0395905_0086338 3300037471 Bacteria 2940
351 Ga0436363_0646332 3300039450 Bacteria 4178
352 Ga0450907_020978 3300042146 Bacteria 1098
353 Ga0439460_0030126 3300042461 Bacteria 1541
354 Ga0451577_0210545 3300042876 Bacteria 1756
355 Ga0466972_0005034 3300044658 Bacteria 6624
356 Ga0495592_0000120 3300046454 Bacteria 69531
357 Ga0495592_0162779 3300046454 Bacteria 1534
358 Ga0495603_0108246 3300046455 Bacteria 1622
359 Ga0495629_0024318 3300046459 Bacteria 4313
360 Ga0495638_0100237 3300046460 Bacteria 1733
361 Ga0495580_0058490 3300046472 Bacteria 2711
362 Ga0495605_0080795 3300046474 Bacteria 1521
363 Ga0495664_0137110 3300046477 Bacteria 1483
364 Ga0495606_0152686 3300046507 Bacteria 1354
365 Ga0495630_0082662 3300046517 Bacteria 2424
366 Ga0495632_0032296 3300046519 Bacteria 2698
367 Ga0495632_0067290 3300046519 Bacteria 1728
368 Ga0495640_0077554 3300046533 Bacteria 2215
369 Ga0495597_0040554 3300046542 Bacteria 2081
370 Ga0495645_0025713 3300046543 Bacteria 4274
371 Ga0495625_0029797 3300046660 Bacteria 4078
372 Ga0495658_0010955 3300046683 Bacteria 4546
373 Ga0495624_0016572 3300046690 Bacteria 4960
374 Ga0495649_0002611 3300046694 Bacteria 12572
375 Ga0495600_0223243 3300046809 Bacteria 1205
376 Ga0495687_002945 3300047443 Bacteria 12931
377 Ga0495687_023820 3300047443 Bacteria 2919
378 Ga0495686_0000404 3300047472 Bacteria 68315
379 Ga0495686_0069278 3300047472 Bacteria 2175
380 Ga0496100_0147563 3300048903 Bacteria 1674
381 Ga0496102_0023399 3300048905 Bacteria 5487
382 Ga0496104_0017569 3300048907 Bacteria 6517
383 Ga0496104_0076693 3300048907 Bacteria 3184
384 Ga0496104_0077098 3300048907 Bacteria 3176
385 Ga0496105_0005943 3300048908 Bacteria 9313
386 Ga0496105_0048432 3300048908 Bacteria 3508
387 Ga0496106_0011177 3300048909 Bacteria 6642
388 Ga0496106_0030810 3300048909 Bacteria 3998
389 Ga0496108_0024318 3300048911 Bacteria 4986
390 Ga0496109_0022535 3300048912 Bacteria 5581
391 Ga0496109_0067571 3300048912 Bacteria 3275
392 Ga0496109_0087332 3300048912 Bacteria 2881
393 Ga0496111_0066537 3300048914 Bacteria 2617
394 Ga0496112_0004102 3300048915 Bacteria 12246
395 Ga0496113_0070376 3300048916 Bacteria 2659
396 Ga0496114_0048659 3300048917 Bacteria 3526
397 Ga0496115_0026311 3300048918 Bacteria 4540
398 Ga0501198_000004 3300049649 Bacteria 175146
399 Ga0501222_000095 3300049662 Bacteria 23714
400 nmdc:mga0k408_13334_c1 3300050493 Bacteria 4505
401 nmdc:mga0k408_18654_c1 3300050493 Bacteria 3875
402 nmdc:mga0k408_2872_c1 3300050493 Bacteria 9148
403 nmdc:mga07m45_128830_c1 3300050496 Bacteria 1464
404 nmdc:mga07m45_501_c1 3300050496 Bacteria 16602
405 nmdc:mga07m45_6744_c1 3300050496 Bacteria 5827
406 nmdc:mga07m45_77985_c1 3300050496 Bacteria 1890
407 nmdc:mga09592_1763_c1 3300050508 Bacteria 17376
408 nmdc:mga0qj67_27872_c2 3300050509 Bacteria 3974
409 nmdc:mga0sz30_36706_c1 3300050516 Bacteria 2049
410 Ga0495601_0057621 3300053077 Bacteria 2461
411 Ga0495619_0068172 3300053085 Bacteria 2376
412 Ga0500578_0000006 3300053086 Bacteria 234598
413 Ga0500646_0002363 3300053090 Bacteria 4902
414 Ga0500583_0090644 3300053092 Bacteria 1488
415 Ga0500651_0047532 3300053093 Bacteria 2697
416 Ga0500650_0076017 3300053098 Bacteria 1570
417 Ga0500594_0000567 3300053118 Bacteria 7978
418 Ga0500628_002413 3300053129 Bacteria 3097
419 Ga0500642_0068654 3300053130 Bacteria 1608
420 Ga0500652_000642 3300053131 Bacteria 11936
421 Ga0500658_0009957 3300053134 Bacteria 3506
422 Ga0500559_0000138 3300053136 Bacteria 56620
423 Ga0500590_044154 3300053148 Bacteria 2283
424 Ga0500604_0026382 3300053151 Bacteria 1675
425 Ga0500622_0000221 3300053156 Bacteria 59833
426 2587730794 2585428057 Bacteria 6737412
427 2587737165 2585428058 Bacteria 6853932
428 2588294636 2588253510 Bacteria 6901809
429 2643971650 2643221592 Bacteria 6608788
430 2644142728 2643221625 Bacteria 6512927
431 2644272711 2643221648 Bacteria 6521465
432 2644301639 2643221654 Bacteria 5273570
433 2644340419 2643221660 Bacteria 4208257
434 Ga0157380_10033410
435 JGI25152J39213_1003968
436 JGI25153J46596_10013898
437 JGI25153J46596_10013946
438 rootH1_10016312
439 rootL2_10178597
440 Ga0055526_1001909
441 Ga0065165_1005423
442 Ga0070658_10027033
443 Ga0070658_10078185
444 Ga0070676_10001611
445 Ga0070676_10006499
446 Ga0070676_10007770
447 Ga0070676_10024955
448 Ga0070683_100026824
449 Ga0070690_100061366
450 Ga0070670_100043165
451 Ga0070670_100301184
452 Ga0070670_100308750
453 Ga0070677_10009064
454 Ga0070677_10017911
455 Ga0070677_10020757
456 Ga0068869_100006643
457 Ga0068869_100008107
458 Ga0068869_100019365
459 Ga0068869_100158640
460 Ga0068869_100171399
461 Ga0070666_10000601
462 Ga0070680_100039594
463 Ga0068868_100006388
464 Ga0068868_100010447
465 Ga0068868_100010849
466 Ga0068868_100083797
467 Ga0068868_100162423
468 Ga0070660_100130246
469 Ga0070687_100011936
470 Ga0070661_100130875
471 Ga0070692_10020138
472 Ga0070668_100006370
473 Ga0070668_100040485
474 Ga0070669_100005118
475 Ga0070669_100088415
476 Ga0070675_100002437
477 Ga0070675_100002524
478 Ga0070675_100024456
479 Ga0070675_100041283
480 Ga0070675_100199485
481 Ga0070675_100287382
482 Ga0070671_100010869
483 Ga0070671_100012416
484 Ga0070671_100033458
485 Ga0070671_100040666
486 Ga0070671_100131039
487 Ga0070674_100012099
488 Ga0070674_100025061
489 Ga0070673_100002831
490 Ga0070673_100005638
491 Ga0070673_100020631
492 Ga0070673_100053157
493 Ga0070673_100157207
494 Ga0070659_100127595
495 Ga0070667_100002909
496 Ga0070667_100011298
497 Ga0070667_100062168
498 Ga0070667_100178598
499 Ga0070663_100001718
500 Ga0070663_100003146
501 Ga0070678_100001353
502 Ga0070678_100007938
503 Ga0070678_100225881
504 Ga0070662_100001682
505 Ga0070662_100084084
506 Ga0070681_10070808
507 Ga0068867_100000118
508 Ga0068867_100010409
509 Ga0068867_100013383
510 Ga0068867_100015223
511 Ga0068867_100018936
512 Ga0068867_100026546
513 Ga0068867_100066655
514 Ga0070706_100000965
515 Ga0070699_100123620
516 Ga0070679_100048911
517 Ga0068853_100169891
518 Ga0070672_100003437
519 Ga0070672_100003887
520 Ga0070672_100006503
521 Ga0070672_100007981
522 Ga0070672_100008749
523 Ga0070672_100030004
524 Ga0070672_100079552
525 Ga0070693_100149857
526 Ga0070665_100024704
527 Ga0070665_100078421
528 Ga0068855_100034936
529 Ga0070664_100188926
530 Ga0068857_100053448
531 Ga0068857_100056743
532 Ga0068854_100032217
533 Ga0068854_100206554
534 Ga0070702_100010660
535 Ga0068852_100013245
536 Ga0068852_100014306
537 Ga0068859_100311484
538 Ga0068864_100005532
539 Ga0068864_100021008
540 Ga0068864_100042789
541 Ga0068864_100076307
542 Ga0068864_100201942
543 Ga0068866_10044964
544 Ga0068861_100001984
545 Ga0068861_100004050
546 Ga0068851_10003613
547 Ga0068851_10019980
548 Ga0068870_10015312
549 Ga0068863_100008538
550 Ga0068863_100020081
551 Ga0068863_100368980
552 Ga0068858_100000366
553 Ga0068858_100003535
554 Ga0068860_100010516
555 Ga0068860_100012879
556 Ga0068860_100057768
557 Ga0068862_100014899
558 Ga0068862_100145685
559 Ga0075362_10005831
560 Ga0075367_10008921
561 Ga0075367_10013328
562 Ga0075367_10026931
563 Ga0075366_10003454
564 Ga0075366_10033486
565 Ga0075366_10043038
566 Ga0075366_10059805
567 Ga0097621_100039158
568 Ga0097621_100047833
569 Ga0097621_100110553
570 Ga0075370_10012739
571 Ga0075370_10031975
572 Ga0068871_100022996
573 Ga0068871_100091970
574 Ga0068871_100243500
575 Ga0075429_100001726
576 Ga0068865_100105504
577 Ga0097620_100311478
578 Ga0105240_10079271
579 Ga0105245_10100343
580 Ga0105243_10001408
581 Ga0105241_10217759
582 Ga0105242_10228492
583 Ga0105248_10002745
584 Ga0105248_10003694
585 Ga0105248_10073729
586 Ga0105248_10322074
587 Ga0105237_10001582
588 Ga0105237_10098029
589 Ga0105237_10272678
590 Ga0105238_10002762
591 Ga0105238_10016418
592 Ga0105249_10004419
593 Ga0105239_10001198
594 Ga0105239_10137437
595 Ga0157369_10065369
596 Ga0157374_10014987
597 Ga0157374_10086987
598 Ga0163162_10037870
599 Ga0163162_10065499
600 Ga0163162_10283684
601 Ga0157372_10063647
602 Ga0157372_10107189
603 Ga0157375_10007448
604 Ga0157375_10020991
605 Ga0157375_10090976
606 Ga0157375_10139441
607 Ga0157375_10197714
608 Ga0157375_10310855
609 Ga0163163_10113073
610 Ga0157380_10018324
611 Ga0157377_10000343
612 Ga0157377_10008399
613 Ga0157379_10017039
614 Ga0157379_10025223
615 Ga0157379_10027564
616 Ga0157379_10119755
617 Ga0157379_10196071
618 Ga0157376_10052161
619 Ga0157376_10076841
620 Ga0163161_10022192
621 Ga0163161_10023866
622 Ga0163161_10144965
623 Ga0209129_1000043
624 Ga0209673_1004179
625 Ga0209673_1023364
626 Ga0209564_1000014
627 Ga0209758_1000307
628 Ga0209758_1000492
629 Ga0209050_1000493
630 Ga0207697_10012457
631 Ga0207656_10006768
632 Ga0207682_10003952
633 Ga0207682_10008190
634 Ga0207682_10016294
635 Ga0207682_10030894
636 Ga0207642_10034537
637 Ga0207688_10011790
638 Ga0207680_10114442
639 Ga0207645_10001578
640 Ga0207645_10005999
641 Ga0207645_10019747
642 Ga0207645_10022214
643 Ga0207643_10055608
644 Ga0207643_10097118
645 Ga0207705_10045377
646 Ga0207705_10061559
647 Ga0207684_10002804
648 Ga0207671_10001614
649 Ga0207671_10044427
650 Ga0207660_10092905
651 Ga0207662_10001240
652 Ga0207646_10014090
653 Ga0207681_10000634
654 Ga0207681_10009755
655 Ga0207650_10001855
656 Ga0207650_10009236
657 Ga0207650_10094766
658 Ga0207659_10002325
659 Ga0207659_10002524
660 Ga0207659_10008200
661 Ga0207659_10017565
662 Ga0207659_10018246
663 Ga0207659_10055118
664 Ga0207687_10161501
665 Ga0207644_10000264
666 Ga0207644_10003222
667 Ga0207644_10020670
668 Ga0207690_10004434
669 Ga0207706_10003415
670 Ga0207706_10094711
671 Ga0207709_10000850
672 Ga0207670_10031970
673 Ga0207670_10141362
674 Ga0207669_10044893
675 Ga0207704_10055821
676 Ga0207691_10005307
677 Ga0207691_10007010
678 Ga0207691_10031990
679 Ga0207691_10036993
680 Ga0207691_10045319
681 Ga0207691_10051561
682 Ga0207691_10323652
683 Ga0207691_10323797
684 Ga0207711_10001750
685 Ga0207711_10003373
686 Ga0207711_10025860
687 Ga0207711_10175952
688 Ga0207689_10003399
689 Ga0207689_10009456
690 Ga0207689_10022214
691 Ga0207689_10069500
692 Ga0207679_10034885
693 Ga0207679_10046298
694 Ga0207667_10066908
695 Ga0207651_10000726
696 Ga0207651_10016312
697 Ga0207651_10196866
698 Ga0207712_10012921
699 Ga0207668_10000316
700 Ga0207668_10008970
701 Ga0207668_10207683
702 Ga0207640_10006815
703 Ga0207658_10001493
704 Ga0207658_10003581
705 Ga0207658_10029135
706 Ga0207677_10001252
707 Ga0207677_10001906
708 Ga0207677_10027519
709 Ga0207677_10061989
710 Ga0207703_10000616
711 Ga0207703_10005986
712 Ga0207703_10017344
713 Ga0207678_10001164
714 Ga0207678_10023154
715 Ga0207678_10052464
716 Ga0207678_10194502
717 Ga0207708_10009445
718 Ga0207702_10043052
719 Ga0207702_10073130
720 Ga0207641_10004967
721 Ga0207641_10035633
722 Ga0207641_10258151
723 Ga0207648_10002014
724 Ga0207648_10011503
725 Ga0207648_10011543
726 Ga0207648_10038737
727 Ga0207648_10041423
728 Ga0207648_10176147
729 Ga0207648_10193910
730 Ga0207648_10312193
731 Ga0207676_10002431
732 Ga0207676_10237980
733 Ga0207674_10082149
734 Ga0207674_10191489
735 Ga0207674_10252352
736 Ga0207674_10271062
737 Ga0207675_100001106
738 Ga0207675_100009921
739 Ga0207683_10004615
740 Ga0207683_10022132
741 Ga0207683_10031584
742 Ga0207683_10047674
743 Ga0207698_10010883
744 Ga0268266_10108979
745 Ga0268265_10090730
746 Ga0268264_10017259
747 Ga0307517_10002551
748 Ga0307517_10098134
749 Ga0307515_10006463
750 Ga0307512_10053053
751 Ga0307513_10013819
752 Ga0307513_10107132
753 Ga0307513_10280678
754 Ga0307513_10296701
755 Ga0307509_10003013
756 Ga0307509_10006419
757 Ga0307408_100074907
758 Ga0307408_100083868
759 Ga0307508_10002994
760 Ga0307508_10038790
761 Ga0307514_10021350
762 Ga0307516_10009114
763 Ga0307410_10126606
764 Ga0307406_10008188
765 Ga0307407_10033602
766 Ga0307409_100004091
767 Ga0307409_100309524
768 Ga0307416_100011104
769 Ga0307416_100139269
770 Ga0307415_100065856
771 Ga0307507_10036366
772 Ga0307510_10001378
773 Ga0307510_10037621
774 Ga0373959_0003203
775 Ga0373928_0017469
776 Ga0373945_0018072
777 Ga0373943_0038902
778 Ga0373946_0117759
779 Ga0373955_0075688
780 Ga0373931_0003277
781 Ga0373937_0053732
782 Ga0373925_0038285
783 Ga0395905_0086338
784 Ga0436363_0646332
785 Ga0450907_020978
786 Ga0439460_0030126
787 Ga0451577_0210545
788 Ga0466972_0005034
789 Ga0495592_0000120
790 Ga0495592_0162779
791 Ga0495603_0108246
792 Ga0495629_0024318
793 Ga0495638_0100237
794 Ga0495580_0058490
795 Ga0495605_0080795
796 Ga0495664_0137110
797 Ga0495606_0152686
798 Ga0495630_0082662
799 Ga0495632_0032296
800 Ga0495632_0067290
801 Ga0495640_0077554
802 Ga0495597_0040554
803 Ga0495645_0025713
804 Ga0495625_0029797
805 Ga0495658_0010955
806 Ga0495624_0016572
807 Ga0495649_0002611
808 Ga0495600_0223243
809 Ga0495687_002945
810 Ga0495687_023820
811 Ga0495686_0000404
812 Ga0495686_0069278
813 Ga0496100_0147563
814 Ga0496102_0023399
815 Ga0496104_0017569
816 Ga0496104_0076693
817 Ga0496104_0077098
818 Ga0496105_0005943
819 Ga0496105_0048432
820 Ga0496106_0011177
821 Ga0496106_0030810
822 Ga0496108_0024318
823 Ga0496109_0022535
824 Ga0496109_0067571
825 Ga0496109_0087332
826 Ga0496111_0066537
827 Ga0496112_0004102
828 Ga0496113_0070376
829 Ga0496114_0048659
830 Ga0496115_0026311
831 Ga0501198_000004
832 Ga0501222_000095
833 nmdc:mga0k408_13334_c1
834 nmdc:mga0k408_18654_c1
835 nmdc:mga0k408_2872_c1
836 nmdc:mga07m45_128830_c1
837 nmdc:mga07m45_501_c1
838 nmdc:mga07m45_6744_c1
839 nmdc:mga07m45_77985_c1
840 nmdc:mga09592_1763_c1
841 nmdc:mga0qj67_27872_c2
842 nmdc:mga0sz30_36706_c1
843 Ga0495601_0057621
844 Ga0495619_0068172
845 Ga0500578_0000006
846 Ga0500646_0002363
847 Ga0500583_0090644
848 Ga0500651_0047532
849 Ga0500650_0076017
850 Ga0500594_0000567
851 Ga0500628_002413
852 Ga0500642_0068654
853 Ga0500652_000642
854 Ga0500658_0009957
855 Ga0500559_0000138
856 Ga0500590_044154
857 Ga0500604_0026382
858 Ga0500622_0000221
859 2587730794
860 2587737165
861 2588294636
862 2643971650
863 2644142728
864 2644272711
865 2644301639
866 2644340419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

237

315

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a0z-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.7399 243 374
3a0w-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.7364 243 374
3a0y-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) 0.7358 245 374
3a0w-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.722 243 374
3a0z-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.7183 243 374
ID Description Score Start End Superfamily
af_Q2G1E0_342_515_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7961 219 375 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7794 244 375 3.30.565.10
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.76 97 183 1.10.1760.20
af_P0AFB5_191_349_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7596 243 375 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7593 244 375 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A350JJX8-F1-model_v4 Signal transduction histidine kinase internal region domain-containing protein 0.9349 243 334 GO:0000155
GO:0016020
AF-A0A1I2QZS1-F1-model_v4 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 0.9056 218 328 GO:0000155
GO:0016020
AF-A0A395YH45-F1-model_v4 Uncharacterized protein 0.8507 166 326 GO:0000155
GO:0016020
AF-A0A4Q5SAN6-F1-model_v4 Sensor histidine kinase 0.8427 179 374 GO:0000155
GO:0016020
AF-A0A4Q3PDM4-F1-model_v4 deleted 0.8388 15 277

Map