F442828

General Info

Members Datasets Scaffolds Average Seq Length
433 234 866 171

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10808100|Ga0105238_108081002
Length 190
Sequence MFTGTYALLMAEYNRWMNEKIYAGCATLTDGERKRDRGAFFKSIHATLNHLLWGDGAWLTRFNGKSYPAPPPGELLHDDFDRLRAARLAMDDDLLAWARAVTPEALAEPMTWTSRLYGFTQTHPRWVQVVQMFNHQTHHRGQLHAMLTAAGVDVGPTDVPVLPILNETDGLGGGPLPTREELHDRAKLRE

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0
Rhizoplane 8.08
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10808100 3300009551 Bacteria 953
2 JGI24750J21931_1005285 3300002070 Bacteria 1586
3 Ga0070658_10001463 3300005327 Bacteria 20131
4 Ga0070676_10005574 3300005328 Bacteria 6703
5 Ga0070676_10486807 3300005328 Bacteria 874
6 Ga0070676_10645105 3300005328 Bacteria 768
7 Ga0070690_100002002 3300005330 Bacteria 10848
8 Ga0070690_100053766 3300005330 Bacteria 2576
9 Ga0070690_100242752 3300005330 Bacteria 1271
10 Ga0070690_100333132 3300005330 Bacteria 1097
11 Ga0070690_100456440 3300005330 Bacteria 948
12 Ga0070670_100009884 3300005331 Bacteria 8147
13 Ga0070670_100022975 3300005331 Bacteria 5366
14 Ga0070670_100032741 3300005331 Bacteria 4478
15 Ga0070670_100266569 3300005331 Bacteria 1494
16 Ga0070670_100557262 3300005331 Bacteria 1023
17 Ga0070677_10047962 3300005333 Bacteria 1714
18 Ga0070677_10096549 3300005333 Bacteria 1295
19 Ga0068869_100125469 3300005334 Bacteria 1968
20 Ga0068869_100244082 3300005334 Bacteria 1432
21 Ga0070680_100080519 3300005336 Bacteria 2686
22 Ga0070682_100020807 3300005337 Bacteria 3865
23 Ga0070682_101459141 3300005337 Bacteria 587
24 Ga0068868_100111436 3300005338 Bacteria 2224
25 Ga0068868_100538078 3300005338 Bacteria 1028
26 Ga0068868_100754040 3300005338 Bacteria 875
27 Ga0070689_100010526 3300005340 Bacteria 6591
28 Ga0070689_100023914 3300005340 Bacteria 4580
29 Ga0070687_100004360 3300005343 Bacteria 5633
30 Ga0070687_100040388 3300005343 Bacteria 2351
31 Ga0070668_100033576 3300005347 Bacteria 3908
32 Ga0070668_100181112 3300005347 Bacteria 1721
33 Ga0070668_100187672 3300005347 Bacteria 1692
34 Ga0070669_100003787 3300005353 Bacteria 10926
35 Ga0070669_100014709 3300005353 Bacteria 5572
36 Ga0070669_100057961 3300005353 Bacteria 2843
37 Ga0070669_100748673 3300005353 Bacteria 828
38 Ga0070675_100036665 3300005354 Bacteria 3992
39 Ga0070675_100056974 3300005354 Bacteria 3222
40 Ga0070675_100561681 3300005354 Bacteria 1033
41 Ga0070675_100639269 3300005354 Bacteria 966
42 Ga0070671_100140813 3300005355 Bacteria 2035
43 Ga0070671_100478617 3300005355 Bacteria 1070
44 Ga0070674_100190417 3300005356 Bacteria 1578
45 Ga0070674_100248035 3300005356 Bacteria 1397
46 Ga0070674_100557446 3300005356 Bacteria 962
47 Ga0070674_100607641 3300005356 Bacteria 925
48 Ga0070674_100915744 3300005356 Bacteria 764
49 Ga0070673_100005781 3300005364 Bacteria 7964
50 Ga0070673_100006443 3300005364 Bacteria 7629
51 Ga0070673_100030950 3300005364 Bacteria 4012
52 Ga0070673_100085220 3300005364 Bacteria 2571
53 Ga0070673_100449908 3300005364 Bacteria 1158
54 Ga0070673_100533219 3300005364 Bacteria 1065
55 Ga0070688_100058570 3300005365 Bacteria 2426
56 Ga0070688_100157807 3300005365 Bacteria 1556
57 Ga0070659_100017236 3300005366 Bacteria 5431
58 Ga0070659_101492992 3300005366 Bacteria 602
59 Ga0070667_100030596 3300005367 Bacteria 4489
60 Ga0070667_100051565 3300005367 Bacteria 3470
61 Ga0070667_100615012 3300005367 Bacteria 1001
62 Ga0070705_100329563 3300005440 Unclassified 1105
63 Ga0070705_100657066 3300005440 Bacteria 818
64 Ga0070700_100672295 3300005441 Bacteria 820
65 Ga0070694_101300351 3300005444 Bacteria 612
66 Ga0070694_101445643 3300005444 Unclassified 581
67 Ga0070708_100747133 3300005445 Bacteria 920
68 Ga0070663_100004992 3300005455 Bacteria 7838
69 Ga0070678_100015874 3300005456 Bacteria 4799
70 Ga0070678_100717558 3300005456 Bacteria 902
71 Ga0070662_100240839 3300005457 Bacteria 1451
72 Ga0070681_10147387 3300005458 Bacteria 2282
73 Ga0068867_100088609 3300005459 Bacteria 2345
74 Ga0068867_100121485 3300005459 Bacteria 2019
75 Ga0068867_100382961 3300005459 Bacteria 1182
76 Ga0070685_10030725 3300005466 Bacteria 2996
77 Ga0070685_10131795 3300005466 Bacteria 1564
78 Ga0070698_100539301 3300005471 Bacteria 1106
79 Ga0070679_100007829 3300005530 Bacteria 10018
80 Ga0070697_100009944 3300005536 Bacteria 7421
81 Ga0070697_100014054 3300005536 Bacteria 6289
82 Ga0068853_100497202 3300005539 Bacteria 1151
83 Ga0070672_100000171 3300005543 Bacteria 36120
84 Ga0070672_100002909 3300005543 Bacteria 11015
85 Ga0070672_100122792 3300005543 Bacteria 2128
86 Ga0070672_100247816 3300005543 Bacteria 1500
87 Ga0070672_100956608 3300005543 Bacteria 758
88 Ga0070686_100004078 3300005544 Bacteria 8032
89 Ga0070686_100012121 3300005544 Bacteria 4905
90 Ga0070686_100709746 3300005544 Bacteria 803
91 Ga0070695_100089196 3300005545 Bacteria 2055
92 Ga0070695_100218047 3300005545 Bacteria 1373
93 Ga0070696_100062085 3300005546 Bacteria 2615
94 Ga0070665_100345900 3300005548 Bacteria 1492
95 Ga0070704_100012143 3300005549 Bacteria 5316
96 Ga0070704_100534703 3300005549 Bacteria 1022
97 Ga0068857_100121160 3300005577 Bacteria 2355
98 Ga0068857_100842745 3300005577 Bacteria 877
99 Ga0068859_100076755 3300005617 Bacteria 3381
100 Ga0068859_100143601 3300005617 Bacteria 2460
101 Ga0068859_100946567 3300005617 Bacteria 945
102 Ga0068864_100008552 3300005618 Bacteria 8447
103 Ga0068864_100083848 3300005618 Bacteria 2799
104 Ga0068864_100420209 3300005618 Bacteria 1274
105 Ga0068864_100464012 3300005618 Bacteria 1213
106 Ga0068864_101153086 3300005618 Bacteria 773
107 Ga0068864_101476040 3300005618 Bacteria 683
108 Ga0068870_10142311 3300005840 Bacteria 1404
109 Ga0068863_100021615 3300005841 Bacteria 6137
110 Ga0068863_100071104 3300005841 Bacteria 3292
111 Ga0068863_100507488 3300005841 Bacteria 1188
112 Ga0068863_100742912 3300005841 Bacteria 977
113 Ga0068863_100936409 3300005841 Bacteria 867
114 Ga0068858_100164074 3300005842 Bacteria 2093
115 Ga0068858_100190193 3300005842 Bacteria 1940
116 Ga0068858_100200680 3300005842 Bacteria 1886
117 Ga0068858_100237644 3300005842 Bacteria 1728
118 Ga0068860_100003423 3300005843 Bacteria 16313
119 Ga0068860_100029610 3300005843 Bacteria 5269
120 Ga0068860_100105551 3300005843 Bacteria 2690
121 Ga0068860_100181008 3300005843 Bacteria 2037
122 Ga0068860_100234225 3300005843 Bacteria 1785
123 Ga0068860_100582583 3300005843 Bacteria 1123
124 Ga0068860_100988256 3300005843 Bacteria 859
125 Ga0068862_100012606 3300005844 Bacteria 6998
126 Ga0068862_101822925 3300005844 Bacteria 618
127 Ga0070717_10798346 3300006028 Bacteria 859
128 Ga0075365_10125822 3300006038 Bacteria 1771
129 Ga0075365_10371733 3300006038 Bacteria 1008
130 Ga0075364_10147864 3300006051 Bacteria 1582
131 Ga0075364_10312610 3300006051 Bacteria 1070
132 Ga0070715_10301969 3300006163 Bacteria 857
133 Ga0075367_10170566 3300006178 Bacteria 1355
134 Ga0075369_10173542 3300006186 Bacteria 991
135 Ga0075366_10357514 3300006195 Bacteria 897
136 Ga0097621_100007646 3300006237 Bacteria 7746
137 Ga0075428_100170164 3300006844 Bacteria 2362
138 Ga0075431_100138810 3300006847 Bacteria 2506
139 Ga0068865_100008595 3300006881 Bacteria 6312
140 Ga0068865_100080357 3300006881 Bacteria 2338
141 Ga0068865_100156946 3300006881 Bacteria 1732
142 Ga0068865_100892606 3300006881 Bacteria 773
143 Ga0075436_100002544 3300006914 Bacteria 12547
144 Ga0097620_100076751 3300006931 Bacteria 3381
145 Ga0097620_100143595 3300006931 Bacteria 2460
146 Ga0097620_100694244 3300006931 Bacteria 1109
147 Ga0097620_100946637 3300006931 Bacteria 945
148 Ga0075435_101000141 3300007076 Bacteria 730
149 Ga0105250_10065586 3300009092 Bacteria 1463
150 Ga0111539_10006990 3300009094 Bacteria 14476
151 Ga0111539_10193785 3300009094 Bacteria 2371
152 Ga0111539_11043206 3300009094 Bacteria 950
153 Ga0114129_11475863 3300009147 Bacteria 836
154 Ga0105243_10035785 3300009148 Bacteria 3850
155 Ga0105243_10177215 3300009148 Bacteria 1851
156 Ga0105243_10308362 3300009148 Bacteria 1437
157 Ga0105243_11394227 3300009148 Bacteria 721
158 Ga0105241_10321998 3300009174 Bacteria 1334
159 Ga0105248_10042889 3300009177 Bacteria 5072
160 Ga0105248_10047397 3300009177 Bacteria 4818
161 Ga0105237_10000197 3300009545 Bacteria 85308
162 Ga0105238_10006796 3300009551 Bacteria 11424
163 Ga0105249_10009256 3300009553 Bacteria 8612
164 Ga0105249_10251513 3300009553 Bacteria 1752
165 Ga0105239_10347913 3300010375 Bacteria 1673
166 Ga0157374_10254032 3300013296 Bacteria 1730
167 Ga0157378_10363368 3300013297 Bacteria 1417
168 Ga0157378_10688389 3300013297 Bacteria 1041
169 Ga0163162_10036928 3300013306 Bacteria 4873
170 Ga0163162_10219157 3300013306 Bacteria 2033
171 Ga0163162_11303442 3300013306 Bacteria 825
172 Ga0163162_11439656 3300013306 Unclassified 784
173 Ga0157375_10016253 3300013308 Bacteria 6676
174 Ga0157375_10289859 3300013308 Bacteria 1800
175 Ga0157375_10406906 3300013308 Bacteria 1527
176 Ga0157375_10870547 3300013308 Bacteria 1046
177 Ga0163163_10005561 3300014325 Bacteria 10915
178 Ga0163163_10041601 3300014325 Bacteria 4495
179 Ga0163163_10168948 3300014325 Bacteria 2233
180 Ga0163163_10224589 3300014325 Bacteria 1927
181 Ga0163163_10317865 3300014325 Bacteria 1610
182 Ga0157380_10694554 3300014326 Bacteria 1022
183 Ga0157380_10744240 3300014326 Bacteria 991
184 Ga0157377_10593403 3300014745 Bacteria 789
185 Ga0157379_10161660 3300014968 Bacteria 2021
186 Ga0157379_11224135 3300014968 Bacteria 723
187 Ga0157376_10693097 3300014969 Bacteria 1023
188 Ga0157376_10838013 3300014969 Bacteria 934
189 Ga0207697_10099560 3300025315 Bacteria 1238
190 Ga0207692_10357589 3300025898 Bacteria 902
191 Ga0207680_10392955 3300025903 Bacteria 979
192 Ga0207645_10013819 3300025907 Bacteria 5418
193 Ga0207645_10435571 3300025907 Bacteria 884
194 Ga0207643_10032352 3300025908 Bacteria 2921
195 Ga0207643_10138985 3300025908 Bacteria 1450
196 Ga0207705_10005809 3300025909 Bacteria 9190
197 Ga0207684_10101374 3300025910 Bacteria 2461
198 Ga0207654_10057389 3300025911 Bacteria 2262
199 Ga0207707_10107646 3300025912 Bacteria 2437
200 Ga0207660_10059581 3300025917 Bacteria 2741
201 Ga0207662_10008362 3300025918 Bacteria 5664
202 Ga0207662_10014428 3300025918 Bacteria 4434
203 Ga0207652_10037109 3300025921 Bacteria 4124
204 Ga0207652_10360338 3300025921 Bacteria 1312
205 Ga0207681_10009023 3300025923 Bacteria 6093
206 Ga0207681_10074286 3300025923 Bacteria 2381
207 Ga0207681_10763003 3300025923 Bacteria 807
208 Ga0207694_10005413 3300025924 Bacteria 9826
209 Ga0207694_10096334 3300025924 Bacteria 2340
210 Ga0207650_10033850 3300025925 Bacteria 3703
211 Ga0207650_10212167 3300025925 Bacteria 1555
212 Ga0207659_10012040 3300025926 Bacteria 5482
213 Ga0207659_10100780 3300025926 Bacteria 2177
214 Ga0207659_10148482 3300025926 Bacteria 1828
215 Ga0207659_10408501 3300025926 Bacteria 1137
216 Ga0207644_10198002 3300025931 Bacteria 1583
217 Ga0207690_10110716 3300025932 Bacteria 1977
218 Ga0207706_10017722 3300025933 Bacteria 6415
219 Ga0207670_10151301 3300025936 Bacteria 1722
220 Ga0207670_10603658 3300025936 Bacteria 901
221 Ga0207670_10850008 3300025936 Bacteria 762
222 Ga0207669_10102653 3300025937 Bacteria 1895
223 Ga0207669_10121719 3300025937 Bacteria 1773
224 Ga0207669_10126083 3300025937 Bacteria 1749
225 Ga0207669_10483503 3300025937 Bacteria 987
226 Ga0207669_10533782 3300025937 Bacteria 944
227 Ga0207704_10005466 3300025938 Bacteria 5859
228 Ga0207704_10214095 3300025938 Bacteria 1420
229 Ga0207704_10279844 3300025938 Bacteria 1267
230 Ga0207704_10284017 3300025938 Bacteria 1260
231 Ga0207691_10003506 3300025940 Bacteria 15269
232 Ga0207691_10006986 3300025940 Bacteria 10892
233 Ga0207691_10014611 3300025940 Bacteria 7483
234 Ga0207691_10218264 3300025940 Bacteria 1654
235 Ga0207691_10243360 3300025940 Bacteria 1555
236 Ga0207691_11028367 3300025940 Bacteria 687
237 Ga0207711_10040611 3300025941 Bacteria 3959
238 Ga0207711_10093999 3300025941 Bacteria 2642
239 Ga0207689_10149102 3300025942 Bacteria 1928
240 Ga0207689_10194537 3300025942 Bacteria 1673
241 Ga0207689_10594547 3300025942 Bacteria 931
242 Ga0207651_10065957 3300025960 Bacteria 2541
243 Ga0207651_10388122 3300025960 Bacteria 1185
244 Ga0207651_10590617 3300025960 Bacteria 970
245 Ga0207712_10050331 3300025961 Bacteria 2908
246 Ga0207712_10096400 3300025961 Bacteria 2189
247 Ga0207668_10324494 3300025972 Bacteria 1279
248 Ga0207640_10774163 3300025981 Bacteria 829
249 Ga0207658_10148553 3300025986 Bacteria 1906
250 Ga0207658_10216089 3300025986 Bacteria 1610
251 Ga0207658_10507515 3300025986 Bacteria 1075
252 Ga0207677_10053153 3300026023 Bacteria 2756
253 Ga0207677_10213403 3300026023 Bacteria 1543
254 Ga0207677_10564032 3300026023 Bacteria 994
255 Ga0207703_10017076 3300026035 Bacteria 5659
256 Ga0207703_10243099 3300026035 Bacteria 1619
257 Ga0207703_10252848 3300026035 Bacteria 1589
258 Ga0207703_10274013 3300026035 Bacteria 1530
259 Ga0207639_10446968 3300026041 Bacteria 1173
260 Ga0207678_10016368 3300026067 Bacteria 6511
261 Ga0207708_10000579 3300026075 Bacteria 28319
262 Ga0207708_10073433 3300026075 Bacteria 2621
263 Ga0207708_10239640 3300026075 Bacteria 1459
264 Ga0207641_10006938 3300026088 Bacteria 9479
265 Ga0207641_10094551 3300026088 Bacteria 2622
266 Ga0207641_10104638 3300026088 Bacteria 2499
267 Ga0207641_10216982 3300026088 Bacteria 1772
268 Ga0207641_10321926 3300026088 Bacteria 1466
269 Ga0207641_10456856 3300026088 Bacteria 1235
270 Ga0207641_10663130 3300026088 Bacteria 1025
271 Ga0207641_10983067 3300026088 Bacteria 840
272 Ga0207648_10035146 3300026089 Bacteria 4416
273 Ga0207648_10352439 3300026089 Bacteria 1327
274 Ga0207676_10044635 3300026095 Bacteria 3420
275 Ga0207676_10139553 3300026095 Bacteria 2073
276 Ga0207676_10342212 3300026095 Bacteria 1380
277 Ga0207676_10370492 3300026095 Bacteria 1330
278 Ga0207676_10445057 3300026095 Bacteria 1220
279 Ga0207676_11199614 3300026095 Bacteria 752
280 Ga0207674_10043608 3300026116 Bacteria 4624
281 Ga0207674_10126346 3300026116 Bacteria 2523
282 Ga0207675_100018946 3300026118 Bacteria 6424
283 Ga0207675_100513660 3300026118 Bacteria 1194
284 Ga0207675_100695066 3300026118 Bacteria 1026
285 Ga0207683_10029751 3300026121 Bacteria 4729
286 Ga0207683_10053851 3300026121 Bacteria 3528
287 Ga0207683_10520834 3300026121 Bacteria 1099
288 Ga0209813_10262965 3300027866 Bacteria 659
289 Ga0268266_10150519 3300028379 Bacteria 2097
290 Ga0268266_10550636 3300028379 Bacteria 1105
291 Ga0268266_10937890 3300028379 Bacteria 837
292 Ga0268265_10106542 3300028380 Bacteria 2277
293 Ga0268265_10468179 3300028380 Bacteria 1181
294 Ga0268264_10063136 3300028381 Bacteria 3113
295 Ga0268264_10341525 3300028381 Bacteria 1422
296 Ga0268264_10343797 3300028381 Bacteria 1418
297 Ga0265330_10001363 3300031235 Bacteria 14244
298 Ga0265332_10000832 3300031238 Bacteria 18732
299 Ga0265328_10009386 3300031239 Bacteria 3989
300 Ga0265320_10024564 3300031240 Bacteria 3186
301 Ga0265325_10058213 3300031241 Bacteria 1969
302 Ga0265340_10379740 3300031247 Bacteria 624
303 Ga0265339_10017413 3300031249 Bacteria 4258
304 Ga0265331_10000960 3300031250 Bacteria 22931
305 Ga0265327_10002886 3300031251 Bacteria 17287
306 Ga0265316_10024265 3300031344 Bacteria 5087
307 Ga0307509_10421640 3300031507 Bacteria 1035
308 Ga0265313_10020624 3300031595 Bacteria 3631
309 Ga0265314_10034199 3300031711 Bacteria 3717
310 Ga0373926_0054457 3300035083 Bacteria 1449
311 Ga0373944_0008112 3300035089 Bacteria 2831
312 Ga0373945_0061333 3300035116 Bacteria 1404
313 Ga0373943_0005426 3300035170 Bacteria 5737
314 Ga0373946_0005456 3300035171 Bacteria 4586
315 Ga0373946_0430761 3300035171 Bacteria 669
316 Ga0373935_0031215 3300035692 Bacteria 3306
317 Ga0373935_0072893 3300035692 Bacteria 2218
318 Ga0373927_0012267 3300035695 Bacteria 5701
319 Ga0373927_0029476 3300035695 Bacteria 3577
320 Ga0373933_0071871 3300035724 Bacteria 2107
321 Ga0373947_0006735 3300035725 Bacteria 6665
322 Ga0373937_0271865 3300036401 Bacteria 1600
323 Ga0373925_0139657 3300037068 Bacteria 1895
324 Ga0395899_0172324 3300037312 Bacteria 1523
325 Ga0395900_0109518 3300037418 Bacteria 2837
326 Ga0436364_0513762 3300037853 Bacteria 11302
327 Ga0436364_1047399 3300037853 Bacteria 3793
328 Ga0436365_0504601 3300039437 Bacteria 4025
329 Ga0436365_1551546 3300039437 Bacteria 574
330 Ga0451802_1508651 3300041460 Bacteria 791
331 Ga0451576_0065759 3300045051 Bacteria 3775
332 Ga0495603_0005604 3300046455 Bacteria 7502
333 Ga0495650_0287416 3300046471 Bacteria 553
334 Ga0495580_0556296 3300046472 Bacteria 761
335 Ga0495582_0047574 3300046473 Bacteria 2362
336 Ga0495664_0088074 3300046477 Bacteria 1866
337 Ga0495584_0116890 3300046491 Bacteria 1350
338 Ga0495585_0114511 3300046492 Bacteria 1431
339 Ga0495594_0160143 3300046499 Bacteria 1279
340 Ga0495616_0183020 3300046513 Bacteria 930
341 Ga0495630_0121163 3300046517 Bacteria 1984
342 Ga0495637_0127558 3300046520 Bacteria 974
343 Ga0495643_0173393 3300046522 Bacteria 1053
344 Ga0495644_0031582 3300046523 Bacteria 2001
345 Ga0495663_0039944 3300046525 Bacteria 1423
346 Ga0495666_0019912 3300046526 Bacteria 3328
347 Ga0495665_0187066 3300046531 Bacteria 1075
348 Ga0495640_0175291 3300046533 Bacteria 1369
349 Ga0495640_0643642 3300046533 Bacteria 638
350 Ga0495586_0045949 3300046535 Bacteria 2354
351 Ga0495598_0051205 3300046537 Bacteria 1243
352 Ga0495633_0208820 3300046558 Bacteria 895
353 Ga0495656_0012420 3300046615 Bacteria 3142
354 Ga0495668_0032061 3300046616 Bacteria 2959
355 Ga0495634_0000522 3300046642 Bacteria 37725
356 Ga0495625_0265801 3300046660 Bacteria 1109
357 Ga0495659_0129996 3300046664 Bacteria 998
358 Ga0495661_0336802 3300046665 Bacteria 746
359 Ga0495588_0107712 3300046674 Bacteria 1467
360 Ga0495646_0181190 3300046680 Bacteria 1156
361 Ga0495624_0029296 3300046690 Bacteria 3592
362 Ga0495671_0275391 3300046692 Bacteria 811
363 Ga0495589_0067818 3300046794 Bacteria 1746
364 Ga0495660_0051395 3300046810 Bacteria 2243
365 Ga0495581_0051556 3300047315 Bacteria 2376
366 Ga0495674_0034224 3300047319 Bacteria 4595
367 Ga0495676_0388570 3300047321 Bacteria 927
368 Ga0495686_0483080 3300047472 Bacteria 654
369 Ga0496100_0054597 3300048903 Bacteria 2606
370 Ga0496100_0520018 3300048903 Bacteria 918
371 Ga0496101_0013901 3300048904 Bacteria 5404
372 Ga0496101_0019506 3300048904 Bacteria 4629
373 Ga0496101_0570234 3300048904 Bacteria 895
374 Ga0496101_0760456 3300048904 Bacteria 764
375 Ga0496104_0000102 3300048907 Bacteria 81318
376 Ga0496104_0004126 3300048907 Bacteria 12614
377 Ga0496104_0082556 3300048907 Bacteria 3064
378 Ga0496104_0420480 3300048907 Bacteria 1248
379 Ga0496105_0000066 3300048908 Bacteria 83056
380 Ga0496105_0002875 3300048908 Bacteria 12614
381 Ga0496105_0070444 3300048908 Bacteria 2890
382 Ga0496105_0106673 3300048908 Bacteria 2312
383 Ga0496106_0440187 3300048909 Bacteria 1047
384 Ga0496107_0005408 3300048910 Bacteria 8740
385 Ga0496108_0258235 3300048911 Bacteria 1516
386 Ga0496109_0378800 3300048912 Bacteria 1337
387 Ga0496109_0773374 3300048912 Bacteria 898
388 Ga0496110_0010792 3300048913 Bacteria 7445
389 Ga0496111_0120713 3300048914 Bacteria 1936
390 Ga0496111_0355863 3300048914 Bacteria 1084
391 Ga0496112_0335925 3300048915 Bacteria 1454
392 Ga0496113_1396404 3300048916 Bacteria 542
393 Ga0496114_0002503 3300048917 Bacteria 14026
394 Ga0496114_0012827 3300048917 Bacteria 6710
395 Ga0496114_0032275 3300048917 Bacteria 4308
396 Ga0496114_0401182 3300048917 Bacteria 1214
397 Ga0496114_0585417 3300048917 Bacteria 984
398 Ga0496115_0017362 3300048918 Bacteria 5500
399 Ga0496115_0048074 3300048918 Bacteria 3412
400 Ga0496115_0090029 3300048918 Bacteria 2506
401 Ga0496115_0312185 3300048918 Bacteria 1287
402 Ga0496115_0621138 3300048918 Unclassified 857
403 Ga0496119_0001143 3300048922 Bacteria 33302
404 Ga0496125_0212260 3300048928 Bacteria 1256
405 Ga0501036_0017263 3300049572 Bacteria 6032
406 Ga0501039_0832761 3300049575 Bacteria 719
407 Ga0501040_0006946 3300049576 Bacteria 7332
408 Ga0501041_0492624 3300049577 Bacteria 779
409 Ga0501042_0091925 3300049578 Bacteria 2178
410 Ga0501042_1282106 3300049578 Bacteria 534
411 Ga0501046_1071873 3300049580 Bacteria 557
412 Ga0501067_0007931 3300049583 Bacteria 5897
413 Ga0501070_1103274 3300049586 Bacteria 612
414 Ga0501073_0002129 3300049589 Bacteria 14839
415 Ga0501074_0245564 3300049590 Bacteria 1273
416 Ga0501079_0106787 3300049741 Bacteria 2173
417 Ga0501080_0109920 3300049742 Bacteria 2555
418 nmdc:mga03683_25813_c1 3300050489 Bacteria 2311
419 nmdc:mga03683_434417_c1 3300050489 Bacteria 630
420 nmdc:mga00v17_258522_c1 3300050491 Bacteria 1129
421 nmdc:mga00v17_320645_c1 3300050491 Bacteria 1007
422 nmdc:mga0yw44_80823_c1 3300050492 Bacteria 2037
423 nmdc:mga06z11_72060_c1 3300050494 Bacteria 1831
424 nmdc:mga04h51_148991_c1 3300050495 Bacteria 893
425 nmdc:mga09592_347622_c1 3300050508 Bacteria 1283
426 nmdc:mga08y16_1591_c1 3300050511 Bacteria 22932
427 nmdc:mga0n895_1419102_c1 3300050512 Bacteria 662
428 Ga0495601_0105605 3300053077 Bacteria 1821
429 Ga0495655_0038100 3300053083 Bacteria 1211
430 Ga0495595_0126965 3300053084 Bacteria 1245
431 Ga0495595_0435718 3300053084 Bacteria 666
432 Ga0501084_0656836 3300054114 Bacteria 885
433 Ga0530510_0262899 3300061734 Bacteria 1287
434 Ga0105238_10808100
435 JGI24750J21931_1005285
436 Ga0070658_10001463
437 Ga0070676_10005574
438 Ga0070676_10486807
439 Ga0070676_10645105
440 Ga0070690_100002002
441 Ga0070690_100053766
442 Ga0070690_100242752
443 Ga0070690_100333132
444 Ga0070690_100456440
445 Ga0070670_100009884
446 Ga0070670_100022975
447 Ga0070670_100032741
448 Ga0070670_100266569
449 Ga0070670_100557262
450 Ga0070677_10047962
451 Ga0070677_10096549
452 Ga0068869_100125469
453 Ga0068869_100244082
454 Ga0070680_100080519
455 Ga0070682_100020807
456 Ga0070682_101459141
457 Ga0068868_100111436
458 Ga0068868_100538078
459 Ga0068868_100754040
460 Ga0070689_100010526
461 Ga0070689_100023914
462 Ga0070687_100004360
463 Ga0070687_100040388
464 Ga0070668_100033576
465 Ga0070668_100181112
466 Ga0070668_100187672
467 Ga0070669_100003787
468 Ga0070669_100014709
469 Ga0070669_100057961
470 Ga0070669_100748673
471 Ga0070675_100036665
472 Ga0070675_100056974
473 Ga0070675_100561681
474 Ga0070675_100639269
475 Ga0070671_100140813
476 Ga0070671_100478617
477 Ga0070674_100190417
478 Ga0070674_100248035
479 Ga0070674_100557446
480 Ga0070674_100607641
481 Ga0070674_100915744
482 Ga0070673_100005781
483 Ga0070673_100006443
484 Ga0070673_100030950
485 Ga0070673_100085220
486 Ga0070673_100449908
487 Ga0070673_100533219
488 Ga0070688_100058570
489 Ga0070688_100157807
490 Ga0070659_100017236
491 Ga0070659_101492992
492 Ga0070667_100030596
493 Ga0070667_100051565
494 Ga0070667_100615012
495 Ga0070705_100329563
496 Ga0070705_100657066
497 Ga0070700_100672295
498 Ga0070694_101300351
499 Ga0070694_101445643
500 Ga0070708_100747133
501 Ga0070663_100004992
502 Ga0070678_100015874
503 Ga0070678_100717558
504 Ga0070662_100240839
505 Ga0070681_10147387
506 Ga0068867_100088609
507 Ga0068867_100121485
508 Ga0068867_100382961
509 Ga0070685_10030725
510 Ga0070685_10131795
511 Ga0070698_100539301
512 Ga0070679_100007829
513 Ga0070697_100009944
514 Ga0070697_100014054
515 Ga0068853_100497202
516 Ga0070672_100000171
517 Ga0070672_100002909
518 Ga0070672_100122792
519 Ga0070672_100247816
520 Ga0070672_100956608
521 Ga0070686_100004078
522 Ga0070686_100012121
523 Ga0070686_100709746
524 Ga0070695_100089196
525 Ga0070695_100218047
526 Ga0070696_100062085
527 Ga0070665_100345900
528 Ga0070704_100012143
529 Ga0070704_100534703
530 Ga0068857_100121160
531 Ga0068857_100842745
532 Ga0068859_100076755
533 Ga0068859_100143601
534 Ga0068859_100946567
535 Ga0068864_100008552
536 Ga0068864_100083848
537 Ga0068864_100420209
538 Ga0068864_100464012
539 Ga0068864_101153086
540 Ga0068864_101476040
541 Ga0068870_10142311
542 Ga0068863_100021615
543 Ga0068863_100071104
544 Ga0068863_100507488
545 Ga0068863_100742912
546 Ga0068863_100936409
547 Ga0068858_100164074
548 Ga0068858_100190193
549 Ga0068858_100200680
550 Ga0068858_100237644
551 Ga0068860_100003423
552 Ga0068860_100029610
553 Ga0068860_100105551
554 Ga0068860_100181008
555 Ga0068860_100234225
556 Ga0068860_100582583
557 Ga0068860_100988256
558 Ga0068862_100012606
559 Ga0068862_101822925
560 Ga0070717_10798346
561 Ga0075365_10125822
562 Ga0075365_10371733
563 Ga0075364_10147864
564 Ga0075364_10312610
565 Ga0070715_10301969
566 Ga0075367_10170566
567 Ga0075369_10173542
568 Ga0075366_10357514
569 Ga0097621_100007646
570 Ga0075428_100170164
571 Ga0075431_100138810
572 Ga0068865_100008595
573 Ga0068865_100080357
574 Ga0068865_100156946
575 Ga0068865_100892606
576 Ga0075436_100002544
577 Ga0097620_100076751
578 Ga0097620_100143595
579 Ga0097620_100694244
580 Ga0097620_100946637
581 Ga0075435_101000141
582 Ga0105250_10065586
583 Ga0111539_10006990
584 Ga0111539_10193785
585 Ga0111539_11043206
586 Ga0114129_11475863
587 Ga0105243_10035785
588 Ga0105243_10177215
589 Ga0105243_10308362
590 Ga0105243_11394227
591 Ga0105241_10321998
592 Ga0105248_10042889
593 Ga0105248_10047397
594 Ga0105237_10000197
595 Ga0105238_10006796
596 Ga0105249_10009256
597 Ga0105249_10251513
598 Ga0105239_10347913
599 Ga0157374_10254032
600 Ga0157378_10363368
601 Ga0157378_10688389
602 Ga0163162_10036928
603 Ga0163162_10219157
604 Ga0163162_11303442
605 Ga0163162_11439656
606 Ga0157375_10016253
607 Ga0157375_10289859
608 Ga0157375_10406906
609 Ga0157375_10870547
610 Ga0163163_10005561
611 Ga0163163_10041601
612 Ga0163163_10168948
613 Ga0163163_10224589
614 Ga0163163_10317865
615 Ga0157380_10694554
616 Ga0157380_10744240
617 Ga0157377_10593403
618 Ga0157379_10161660
619 Ga0157379_11224135
620 Ga0157376_10693097
621 Ga0157376_10838013
622 Ga0207697_10099560
623 Ga0207692_10357589
624 Ga0207680_10392955
625 Ga0207645_10013819
626 Ga0207645_10435571
627 Ga0207643_10032352
628 Ga0207643_10138985
629 Ga0207705_10005809
630 Ga0207684_10101374
631 Ga0207654_10057389
632 Ga0207707_10107646
633 Ga0207660_10059581
634 Ga0207662_10008362
635 Ga0207662_10014428
636 Ga0207652_10037109
637 Ga0207652_10360338
638 Ga0207681_10009023
639 Ga0207681_10074286
640 Ga0207681_10763003
641 Ga0207694_10005413
642 Ga0207694_10096334
643 Ga0207650_10033850
644 Ga0207650_10212167
645 Ga0207659_10012040
646 Ga0207659_10100780
647 Ga0207659_10148482
648 Ga0207659_10408501
649 Ga0207644_10198002
650 Ga0207690_10110716
651 Ga0207706_10017722
652 Ga0207670_10151301
653 Ga0207670_10603658
654 Ga0207670_10850008
655 Ga0207669_10102653
656 Ga0207669_10121719
657 Ga0207669_10126083
658 Ga0207669_10483503
659 Ga0207669_10533782
660 Ga0207704_10005466
661 Ga0207704_10214095
662 Ga0207704_10279844
663 Ga0207704_10284017
664 Ga0207691_10003506
665 Ga0207691_10006986
666 Ga0207691_10014611
667 Ga0207691_10218264
668 Ga0207691_10243360
669 Ga0207691_11028367
670 Ga0207711_10040611
671 Ga0207711_10093999
672 Ga0207689_10149102
673 Ga0207689_10194537
674 Ga0207689_10594547
675 Ga0207651_10065957
676 Ga0207651_10388122
677 Ga0207651_10590617
678 Ga0207712_10050331
679 Ga0207712_10096400
680 Ga0207668_10324494
681 Ga0207640_10774163
682 Ga0207658_10148553
683 Ga0207658_10216089
684 Ga0207658_10507515
685 Ga0207677_10053153
686 Ga0207677_10213403
687 Ga0207677_10564032
688 Ga0207703_10017076
689 Ga0207703_10243099
690 Ga0207703_10252848
691 Ga0207703_10274013
692 Ga0207639_10446968
693 Ga0207678_10016368
694 Ga0207708_10000579
695 Ga0207708_10073433
696 Ga0207708_10239640
697 Ga0207641_10006938
698 Ga0207641_10094551
699 Ga0207641_10104638
700 Ga0207641_10216982
701 Ga0207641_10321926
702 Ga0207641_10456856
703 Ga0207641_10663130
704 Ga0207641_10983067
705 Ga0207648_10035146
706 Ga0207648_10352439
707 Ga0207676_10044635
708 Ga0207676_10139553
709 Ga0207676_10342212
710 Ga0207676_10370492
711 Ga0207676_10445057
712 Ga0207676_11199614
713 Ga0207674_10043608
714 Ga0207674_10126346
715 Ga0207675_100018946
716 Ga0207675_100513660
717 Ga0207675_100695066
718 Ga0207683_10029751
719 Ga0207683_10053851
720 Ga0207683_10520834
721 Ga0209813_10262965
722 Ga0268266_10150519
723 Ga0268266_10550636
724 Ga0268266_10937890
725 Ga0268265_10106542
726 Ga0268265_10468179
727 Ga0268264_10063136
728 Ga0268264_10341525
729 Ga0268264_10343797
730 Ga0265330_10001363
731 Ga0265332_10000832
732 Ga0265328_10009386
733 Ga0265320_10024564
734 Ga0265325_10058213
735 Ga0265340_10379740
736 Ga0265339_10017413
737 Ga0265331_10000960
738 Ga0265327_10002886
739 Ga0265316_10024265
740 Ga0307509_10421640
741 Ga0265313_10020624
742 Ga0265314_10034199
743 Ga0373926_0054457
744 Ga0373944_0008112
745 Ga0373945_0061333
746 Ga0373943_0005426
747 Ga0373946_0005456
748 Ga0373946_0430761
749 Ga0373935_0031215
750 Ga0373935_0072893
751 Ga0373927_0012267
752 Ga0373927_0029476
753 Ga0373933_0071871
754 Ga0373947_0006735
755 Ga0373937_0271865
756 Ga0373925_0139657
757 Ga0395899_0172324
758 Ga0395900_0109518
759 Ga0436364_0513762
760 Ga0436364_1047399
761 Ga0436365_0504601
762 Ga0436365_1551546
763 Ga0451802_1508651
764 Ga0451576_0065759
765 Ga0495603_0005604
766 Ga0495650_0287416
767 Ga0495580_0556296
768 Ga0495582_0047574
769 Ga0495664_0088074
770 Ga0495584_0116890
771 Ga0495585_0114511
772 Ga0495594_0160143
773 Ga0495616_0183020
774 Ga0495630_0121163
775 Ga0495637_0127558
776 Ga0495643_0173393
777 Ga0495644_0031582
778 Ga0495663_0039944
779 Ga0495666_0019912
780 Ga0495665_0187066
781 Ga0495640_0175291
782 Ga0495640_0643642
783 Ga0495586_0045949
784 Ga0495598_0051205
785 Ga0495633_0208820
786 Ga0495656_0012420
787 Ga0495668_0032061
788 Ga0495634_0000522
789 Ga0495625_0265801
790 Ga0495659_0129996
791 Ga0495661_0336802
792 Ga0495588_0107712
793 Ga0495646_0181190
794 Ga0495624_0029296
795 Ga0495671_0275391
796 Ga0495589_0067818
797 Ga0495660_0051395
798 Ga0495581_0051556
799 Ga0495674_0034224
800 Ga0495676_0388570
801 Ga0495686_0483080
802 Ga0496100_0054597
803 Ga0496100_0520018
804 Ga0496101_0013901
805 Ga0496101_0019506
806 Ga0496101_0570234
807 Ga0496101_0760456
808 Ga0496104_0000102
809 Ga0496104_0004126
810 Ga0496104_0082556
811 Ga0496104_0420480
812 Ga0496105_0000066
813 Ga0496105_0002875
814 Ga0496105_0070444
815 Ga0496105_0106673
816 Ga0496106_0440187
817 Ga0496107_0005408
818 Ga0496108_0258235
819 Ga0496109_0378800
820 Ga0496109_0773374
821 Ga0496110_0010792
822 Ga0496111_0120713
823 Ga0496111_0355863
824 Ga0496112_0335925
825 Ga0496113_1396404
826 Ga0496114_0002503
827 Ga0496114_0012827
828 Ga0496114_0032275
829 Ga0496114_0401182
830 Ga0496114_0585417
831 Ga0496115_0017362
832 Ga0496115_0048074
833 Ga0496115_0090029
834 Ga0496115_0312185
835 Ga0496115_0621138
836 Ga0496119_0001143
837 Ga0496125_0212260
838 Ga0501036_0017263
839 Ga0501039_0832761
840 Ga0501040_0006946
841 Ga0501041_0492624
842 Ga0501042_0091925
843 Ga0501042_1282106
844 Ga0501046_1071873
845 Ga0501067_0007931
846 Ga0501070_1103274
847 Ga0501073_0002129
848 Ga0501074_0245564
849 Ga0501079_0106787
850 Ga0501080_0109920
851 nmdc:mga03683_25813_c1
852 nmdc:mga03683_434417_c1
853 nmdc:mga00v17_258522_c1
854 nmdc:mga00v17_320645_c1
855 nmdc:mga0yw44_80823_c1
856 nmdc:mga06z11_72060_c1
857 nmdc:mga04h51_148991_c1
858 nmdc:mga09592_347622_c1
859 nmdc:mga08y16_1591_c1
860 nmdc:mga0n895_1419102_c1
861 Ga0495601_0105605
862 Ga0495655_0038100
863 Ga0495595_0126965
864 Ga0495595_0435718
865 Ga0501084_0656836
866 Ga0530510_0262899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

1

170

0.93

PF12867

DinB_2

DinB superfamily

16

143

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.8428 6 163
2qe9-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.8406 6 168
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.7872 6 163
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7842 15 160
2qe9-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.768 6 168
ID Description Score Start End Superfamily
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8274 8 163 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7941 8 163 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7625 15 160 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7524 6 154 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7453 8 155 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A537TCD1-F1-model_v4 Damage-inducible protein DinB 0.9885 3 168
AF-A0A537TCD1-F1-model_v4 Damage-inducible protein DinB 0.9826 3 168
AF-A0A848E9S4-F1-model_v4 Damage-inducible protein DinB 0.9823 3 167
AF-A0A1G9B1Z1-F1-model_v4 Uncharacterized damage-inducible protein DinB (Forms a four-helix bundle) 0.9813 3 167
AF-A0A3M2EJL9-F1-model_v4 Damage-inducible protein DinB 0.9794 3 167

Map