F442799

General Info

Members Datasets Scaffolds Average Seq Length
433 200 866 338

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100264253|Ga0068855_1002642532
Length 372
Sequence VAGLEGLNVLPRYTGHQEEKLIAMSALQSILTPKAASGKPSPLPFFQTVQSYQRSFILKTGVELDVFTAIAKGSQTAAEIARACNASERGVRILCDCLTVMGHLTKEGDSYSLTQDSAVFLDSSSPAYMGRALSFLLDPEQVRQMQNLTQTVRDGHPADDPYSMKPDDRMWVEFARGMAPLMVPPAQRIAQLLRPALDGKPAPKVLDIAAGHGVFGVTVGETCHTAQIYALDWPKVLEVARETAVAHGVSSRYNLLPGSAFDVDWGSGYEAVLLPNFLHHFDEQTCTTLLKKANAALNPGGQVVILEFVPNDDRVSPPIPAMFSMTMLSSTPTGDAYTFPQFKEMCRKAGFSEPKLTQMEESPETVLIARKP

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
192 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.31
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 23.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100264253 3300005563 Unclassified 1916
2 LJQas_1009333 3300000549 Bacteria 1183
3 JGI25406J46586_10005619 3300003203 Bacteria 5804
4 Ga0065712_10087046 3300005290 Unclassified 2601
5 Ga0065715_10206590 3300005293 Bacteria 1334
6 Ga0065707_10086661 3300005295 Bacteria 5367
7 Ga0070658_10103198 3300005327 Unclassified 2358
8 Ga0070683_100090351 3300005329 Bacteria 2875
9 Ga0070670_100087144 3300005331 Unclassified 2683
10 Ga0070670_100155330 3300005331 Bacteria 1981
11 Ga0070666_10077933 3300005335 Bacteria 2262
12 Ga0068868_100030110 3300005338 Bacteria 4162
13 Ga0068868_100062711 3300005338 Unclassified 2947
14 Ga0068868_100216944 3300005338 Bacteria 1600
15 Ga0068868_100228408 3300005338 Unclassified 1560
16 Ga0070660_100002714 3300005339 Bacteria 12161
17 Ga0070687_100109856 3300005343 Unclassified 1559
18 Ga0070668_100095735 3300005347 Bacteria 2346
19 Ga0070675_100120550 3300005354 Unclassified 2228
20 Ga0070673_100072029 3300005364 Bacteria 2778
21 Ga0070688_100260686 3300005365 Bacteria 1238
22 Ga0070667_100218779 3300005367 Unclassified 1695
23 Ga0070709_10116102 3300005434 Bacteria 1806
24 Ga0070714_100254903 3300005435 Bacteria 1623
25 Ga0070714_100280614 3300005435 Unclassified 1547
26 Ga0070713_100149959 3300005436 Unclassified 2073
27 Ga0070713_100194607 3300005436 Bacteria 1829
28 Ga0070705_100057640 3300005440 Unclassified 2292
29 Ga0070700_100141603 3300005441 Bacteria 1635
30 Ga0070708_100327123 3300005445 Bacteria 1444
31 Ga0070662_100224790 3300005457 Bacteria 1499
32 Ga0070662_100303147 3300005457 Bacteria 1298
33 Ga0070681_10010399 3300005458 Bacteria 9191
34 Ga0070681_10033250 3300005458 Bacteria 5177
35 Ga0070681_10033650 3300005458 Bacteria 5145
36 Ga0070681_10102529 3300005458 Unclassified 2806
37 Ga0070681_10305817 3300005458 Unclassified 1499
38 Ga0070681_10325875 3300005458 Bacteria 1446
39 Ga0068867_100148916 3300005459 Bacteria 1837
40 Ga0068867_100151665 3300005459 Bacteria 1821
41 Ga0068867_100387213 3300005459 Unclassified 1176
42 Ga0070699_100026253 3300005518 Bacteria 5024
43 Ga0070679_100020054 3300005530 Bacteria 6516
44 Ga0070679_100058430 3300005530 Unclassified 3843
45 Ga0070679_100324827 3300005530 Unclassified 1488
46 Ga0070679_100384760 3300005530 Unclassified 1349
47 Ga0070684_100065591 3300005535 Bacteria 3187
48 Ga0070684_100118094 3300005535 Bacteria 2383
49 Ga0070697_100068267 3300005536 Bacteria 2910
50 Ga0068853_100234963 3300005539 Bacteria 1678
51 Ga0068853_100306786 3300005539 Bacteria 1468
52 Ga0068853_100340132 3300005539 Unclassified 1394
53 Ga0070695_100029124 3300005545 Bacteria 3430
54 Ga0070695_100038862 3300005545 Unclassified 3006
55 Ga0070695_100086968 3300005545 Bacteria 2078
56 Ga0070695_100267123 3300005545 Bacteria 1252
57 Ga0070693_100218675 3300005547 Unclassified 1247
58 Ga0070665_100003708 3300005548 Bacteria 16178
59 Ga0070665_100018319 3300005548 Bacteria 7019
60 Ga0070704_100028098 3300005549 Bacteria 3738
61 Ga0068855_100003717 3300005563 Bacteria 18654
62 Ga0070664_100040077 3300005564 Unclassified 3948
63 Ga0070664_100162862 3300005564 Bacteria 1974
64 Ga0068857_100012213 3300005577 Bacteria 7471
65 Ga0068857_100041387 3300005577 Unclassified 4086
66 Ga0068856_100019474 3300005614 Bacteria 6587
67 Ga0068856_100033041 3300005614 Bacteria 5066
68 Ga0068856_100124324 3300005614 Unclassified 2582
69 Ga0068856_100253538 3300005614 Bacteria 1774
70 Ga0068852_100016695 3300005616 Bacteria 5735
71 Ga0068852_100128147 3300005616 Unclassified 2333
72 Ga0068859_100049274 3300005617 Unclassified 4230
73 Ga0068859_100129987 3300005617 Unclassified 2589
74 Ga0068859_100235954 3300005617 Bacteria 1918
75 Ga0068859_100582983 3300005617 Bacteria 1212
76 Ga0068864_100008469 3300005618 Bacteria 8487
77 Ga0068864_100027169 3300005618 Unclassified 4830
78 Ga0068864_100034662 3300005618 Bacteria 4294
79 Ga0068864_100047174 3300005618 Bacteria 3699
80 Ga0068864_100276378 3300005618 Bacteria 1566
81 Ga0068861_100005810 3300005719 Bacteria 8374
82 Ga0068861_100266501 3300005719 Unclassified 1469
83 Ga0068863_100030374 3300005841 Bacteria 5161
84 Ga0068863_100174548 3300005841 Unclassified 2062
85 Ga0068858_100022314 3300005842 Bacteria 5910
86 Ga0068858_100118223 3300005842 Bacteria 2478
87 Ga0068858_100135743 3300005842 Unclassified 2308
88 Ga0068858_100146386 3300005842 Bacteria 2218
89 Ga0068858_100230604 3300005842 Bacteria 1755
90 Ga0068860_100189152 3300005843 Bacteria 1992
91 Ga0068862_100138606 3300005844 Bacteria 2158
92 Ga0081539_10000201 3300005985 Bacteria 138553
93 Ga0081539_10002560 3300005985 Bacteria 25204
94 Ga0070717_10039507 3300006028 Bacteria 3839
95 Ga0070717_10078241 3300006028 Unclassified 2771
96 Ga0070717_10148693 3300006028 Bacteria 2025
97 Ga0070717_10168754 3300006028 Unclassified 1902
98 Ga0070717_10414919 3300006028 Bacteria 1211
99 Ga0070715_10016121 3300006163 Bacteria 2801
100 Ga0070712_100120216 3300006175 Unclassified 1975
101 Ga0070712_100243546 3300006175 Bacteria 1433
102 Ga0097621_100003144 3300006237 Bacteria 11332
103 Ga0097621_100185340 3300006237 Bacteria 1800
104 Ga0097621_100345801 3300006237 Unclassified 1321
105 Ga0068871_100033810 3300006358 Bacteria 4051
106 Ga0068871_100044941 3300006358 Unclassified 3553
107 Ga0068871_100090047 3300006358 Bacteria 2554
108 Ga0068871_100102104 3300006358 Bacteria 2403
109 Ga0068871_100107224 3300006358 Bacteria 2346
110 Ga0068871_100108776 3300006358 Bacteria 2330
111 Ga0075428_100006375 3300006844 Bacteria 13128
112 Ga0075428_100517212 3300006844 Bacteria 1277
113 Ga0075431_100068267 3300006847 Bacteria 3668
114 Ga0075431_100147103 3300006847 Bacteria 2428
115 Ga0075433_10085206 3300006852 Bacteria 2790
116 Ga0075434_100115799 3300006871 Bacteria 2693
117 Ga0068865_100152119 3300006881 Bacteria 1756
118 Ga0068865_100166699 3300006881 Bacteria 1685
119 Ga0075436_100000176 3300006914 Bacteria 39845
120 Ga0075436_100021563 3300006914 Archaea 4422
121 Ga0097620_100049273 3300006931 Unclassified 4230
122 Ga0097620_100129979 3300006931 Unclassified 2589
123 Ga0097620_100235940 3300006931 Bacteria 1918
124 Ga0097620_100582934 3300006931 Bacteria 1212
125 Ga0075435_100000606 3300007076 Bacteria 21979
126 Ga0105240_10000937 3300009093 Bacteria 51776
127 Ga0105240_10028064 3300009093 Bacteria 7360
128 Ga0105240_10152024 3300009093 Bacteria 2756
129 Ga0105240_10160707 3300009093 Bacteria 2668
130 Ga0105240_10276728 3300009093 Bacteria 1930
131 Ga0105240_10412699 3300009093 Unclassified 1518
132 Ga0105240_10462932 3300009093 Unclassified 1417
133 Ga0111539_10001939 3300009094 Bacteria 27598
134 Ga0105245_10039120 3300009098 Unclassified 4221
135 Ga0105245_10041643 3300009098 Bacteria 4094
136 Ga0105245_10060736 3300009098 Unclassified 3405
137 Ga0105245_10061916 3300009098 Bacteria 3375
138 Ga0105245_10170738 3300009098 Bacteria 2071
139 Ga0105245_10176468 3300009098 Bacteria 2038
140 Ga0105245_10575172 3300009098 Bacteria 1151
141 Ga0105247_10004857 3300009101 Bacteria 8550
142 Ga0114129_10025043 3300009147 Bacteria 8458
143 Ga0105243_10000287 3300009148 Bacteria 55910
144 Ga0105243_10171352 3300009148 Bacteria 1880
145 Ga0105241_10046930 3300009174 Bacteria 3282
146 Ga0105241_10051079 3300009174 Bacteria 3152
147 Ga0105242_10000377 3300009176 Bacteria 35439
148 Ga0105242_10004699 3300009176 Bacteria 10573
149 Ga0105242_10010650 3300009176 Bacteria 7060
150 Ga0105242_10029975 3300009176 Bacteria 4342
151 Ga0105242_10067344 3300009176 Bacteria 2960
152 Ga0105242_10176702 3300009176 Bacteria 1880
153 Ga0105242_10431962 3300009176 Unclassified 1237
154 Ga0105248_10014918 3300009177 Bacteria 8556
155 Ga0105248_10078116 3300009177 Bacteria 3722
156 Ga0105248_10081808 3300009177 Bacteria 3630
157 Ga0105248_10136900 3300009177 Bacteria 2763
158 Ga0105248_10209167 3300009177 Bacteria 2198
159 Ga0105248_10321977 3300009177 Bacteria 1741
160 Ga0105248_10563393 3300009177 Bacteria 1285
161 Ga0105237_10023416 3300009545 Bacteria 6328
162 Ga0105237_10204051 3300009545 Bacteria 1977
163 Ga0105238_10065832 3300009551 Unclassified 3625
164 Ga0105238_10112860 3300009551 Bacteria 2697
165 Ga0105238_10201137 3300009551 Bacteria 1967
166 Ga0105238_10391994 3300009551 Unclassified 1381
167 Ga0105249_10010452 3300009553 Bacteria 8156
168 Ga0105249_10159321 3300009553 Unclassified 2180
169 Ga0105239_10011562 3300010375 Bacteria 9846
170 Ga0105239_10025176 3300010375 Bacteria 6554
171 Ga0105239_10034829 3300010375 Bacteria 5530
172 Ga0105239_10154469 3300010375 Bacteria 2562
173 Ga0105239_10222732 3300010375 Bacteria 2116
174 Ga0105239_10438261 3300010375 Bacteria 1481
175 Ga0105239_10702887 3300010375 Bacteria 1156
176 Ga0157373_10186659 3300013100 Unclassified 1460
177 Ga0157370_10084700 3300013104 Bacteria 2979
178 Ga0157369_10012749 3300013105 Bacteria 9531
179 Ga0157369_10078069 3300013105 Bacteria 3548
180 Ga0157369_10139969 3300013105 Bacteria 2561
181 Ga0157369_10420237 3300013105 Unclassified 1386
182 Ga0157374_10060482 3300013296 Bacteria 3545
183 Ga0157374_10124226 3300013296 Unclassified 2493
184 Ga0157374_10262298 3300013296 Bacteria 1702
185 Ga0157374_10338385 3300013296 Bacteria 1493
186 Ga0157374_10481002 3300013296 Unclassified 1245
187 Ga0157378_10000032 3300013297 Bacteria 122562
188 Ga0157378_10014884 3300013297 Bacteria 6806
189 Ga0157378_10024075 3300013297 Bacteria 5356
190 Ga0157378_10037753 3300013297 Bacteria 4281
191 Ga0157378_10075238 3300013297 Bacteria 3040
192 Ga0157378_10180821 3300013297 Bacteria 1984
193 Ga0157378_10193691 3300013297 Bacteria 1919
194 Ga0163162_10003172 3300013306 Bacteria 15716
195 Ga0163162_10005556 3300013306 Bacteria 12194
196 Ga0163162_10051865 3300013306 Bacteria 4118
197 Ga0163162_10219442 3300013306 Bacteria 2031
198 Ga0163162_10288494 3300013306 Bacteria 1773
199 Ga0163162_10378248 3300013306 Unclassified 1549
200 Ga0163162_10487459 3300013306 Unclassified 1364
201 Ga0163162_10692796 3300013306 Bacteria 1141
202 Ga0157372_10046422 3300013307 Bacteria 4822
203 Ga0157372_10355558 3300013307 Unclassified 1707
204 Ga0157372_10461788 3300013307 Bacteria 1480
205 Ga0157372_10468898 3300013307 Bacteria 1468
206 Ga0157375_10049901 3300013308 Bacteria 4103
207 Ga0163163_10000832 3300014325 Bacteria 26263
208 Ga0163163_10014541 3300014325 Bacteria 7239
209 Ga0163163_10097727 3300014325 Unclassified 2957
210 Ga0163163_10112465 3300014325 Bacteria 2752
211 Ga0163163_10134690 3300014325 Unclassified 2511
212 Ga0163163_10579998 3300014325 Bacteria 1184
213 Ga0157380_10026666 3300014326 Bacteria 4388
214 Ga0157379_10070300 3300014968 Bacteria 3132
215 Ga0157379_10129511 3300014968 Bacteria 2271
216 Ga0157376_10049408 3300014969 Unclassified 3484
217 Ga0157376_10063513 3300014969 Bacteria 3111
218 Ga0163161_10123147 3300017792 Unclassified 1950
219 Ga0163161_10174208 3300017792 Bacteria 1646
220 Ga0154015_1519836 3300020610 Unclassified 1647
221 Ga0213875_10000170 3300021388 Bacteria 68344
222 Ga0224712_10045256 3300022467 Bacteria 1683
223 Ga0228598_1000056 3300024227 Bacteria 16202
224 Ga0207682_10008125 3300025893 Unclassified 4161
225 Ga0207692_10111213 3300025898 Unclassified 1520
226 Ga0207692_10172837 3300025898 Unclassified 1253
227 Ga0207642_10136985 3300025899 Unclassified 1285
228 Ga0207688_10066477 3300025901 Bacteria 2039
229 Ga0207699_10052274 3300025906 Bacteria 2418
230 Ga0207699_10069210 3300025906 Bacteria 2151
231 Ga0207643_10010912 3300025908 Bacteria 4900
232 Ga0207705_10141869 3300025909 Unclassified 1795
233 Ga0207654_10022427 3300025911 Unclassified 3369
234 Ga0207707_10006028 3300025912 Bacteria 10605
235 Ga0207707_10027234 3300025912 Bacteria 4999
236 Ga0207707_10044162 3300025912 Unclassified 3886
237 Ga0207707_10044632 3300025912 Bacteria 3864
238 Ga0207707_10053614 3300025912 Unclassified 3510
239 Ga0207707_10143049 3300025912 Unclassified 2091
240 Ga0207707_10371830 3300025912 Bacteria 1230
241 Ga0207695_10004326 3300025913 Bacteria 19451
242 Ga0207695_10025127 3300025913 Bacteria 6680
243 Ga0207695_10052964 3300025913 Bacteria 4248
244 Ga0207695_10240766 3300025913 Unclassified 1711
245 Ga0207671_10177637 3300025914 Bacteria 1656
246 Ga0207693_10026484 3300025915 Bacteria 4589
247 Ga0207693_10105975 3300025915 Bacteria 2204
248 Ga0207693_10229837 3300025915 Unclassified 1457
249 Ga0207663_10110526 3300025916 Unclassified 1864
250 Ga0207663_10115752 3300025916 Bacteria 1827
251 Ga0207663_10257733 3300025916 Bacteria 1287
252 Ga0207657_10007264 3300025919 Bacteria 11379
253 Ga0207657_10216682 3300025919 Bacteria 1535
254 Ga0207652_10028230 3300025921 Bacteria 4681
255 Ga0207652_10125911 3300025921 Unclassified 2282
256 Ga0207652_10323936 3300025921 Unclassified 1391
257 Ga0207694_10056749 3300025924 Unclassified 3042
258 Ga0207694_10125766 3300025924 Unclassified 2051
259 Ga0207694_10153284 3300025924 Bacteria 1857
260 Ga0207650_10017303 3300025925 Bacteria 5045
261 Ga0207650_10034649 3300025925 Bacteria 3662
262 Ga0207659_10199217 3300025926 Bacteria 1598
263 Ga0207687_10006061 3300025927 Bacteria 7999
264 Ga0207687_10078299 3300025927 Bacteria 2380
265 Ga0207687_10181124 3300025927 Bacteria 1632
266 Ga0207687_10232019 3300025927 Bacteria 1458
267 Ga0207700_10004106 3300025928 Bacteria 8541
268 Ga0207700_10024358 3300025928 Bacteria 4188
269 Ga0207700_10026574 3300025928 Bacteria 4038
270 Ga0207664_10051588 3300025929 Bacteria 3249
271 Ga0207664_10127704 3300025929 Unclassified 2136
272 Ga0207664_10160551 3300025929 Bacteria 1917
273 Ga0207664_10415107 3300025929 Unclassified 1198
274 Ga0207706_10245378 3300025933 Bacteria 1565
275 Ga0207706_10403429 3300025933 Bacteria 1185
276 Ga0207686_10001148 3300025934 Bacteria 15286
277 Ga0207686_10002446 3300025934 Bacteria 10086
278 Ga0207686_10008364 3300025934 Bacteria 5586
279 Ga0207686_10039815 3300025934 Bacteria 2853
280 Ga0207709_10000455 3300025935 Bacteria 38232
281 Ga0207709_10155893 3300025935 Bacteria 1587
282 Ga0207669_10373024 3300025937 Bacteria 1109
283 Ga0207704_10204421 3300025938 Bacteria 1448
284 Ga0207665_10027950 3300025939 Unclassified 3726
285 Ga0207665_10038997 3300025939 Bacteria 3165
286 Ga0207711_10153367 3300025941 Bacteria 2080
287 Ga0207711_10218809 3300025941 Bacteria 1741
288 Ga0207711_10310752 3300025941 Unclassified 1455
289 Ga0207711_10360865 3300025941 Bacteria 1346
290 Ga0207711_10463530 3300025941 Bacteria 1180
291 Ga0207689_10045661 3300025942 Bacteria 3621
292 Ga0207679_10094387 3300025945 Bacteria 2323
293 Ga0207679_10120062 3300025945 Unclassified 2091
294 Ga0207667_10021110 3300025949 Bacteria 7222
295 Ga0207667_10128398 3300025949 Unclassified 2611
296 Ga0207667_10557365 3300025949 Bacteria 1159
297 Ga0207651_10066096 3300025960 Bacteria 2539
298 Ga0207640_10152233 3300025981 Bacteria 1701
299 Ga0207658_10042410 3300025986 Unclassified 3301
300 Ga0207677_10014074 3300026023 Bacteria 4658
301 Ga0207677_10027139 3300026023 Bacteria 3602
302 Ga0207677_10055279 3300026023 Bacteria 2713
303 Ga0207677_10245045 3300026023 Unclassified 1452
304 Ga0207703_10015694 3300026035 Bacteria 5908
305 Ga0207703_10163297 3300026035 Bacteria 1952
306 Ga0207703_10203401 3300026035 Unclassified 1761
307 Ga0207703_10454961 3300026035 Bacteria 1196
308 Ga0207639_10106063 3300026041 Bacteria 2280
309 Ga0207639_10129294 3300026041 Bacteria 2088
310 Ga0207639_10359388 3300026041 Unclassified 1303
311 Ga0207702_10024666 3300026078 Unclassified 4990
312 Ga0207702_10037053 3300026078 Unclassified 4080
313 Ga0207702_10053070 3300026078 Bacteria 3431
314 Ga0207702_10063259 3300026078 Bacteria 3163
315 Ga0207641_10061797 3300026088 Bacteria 3195
316 Ga0207641_10127339 3300026088 Unclassified 2281
317 Ga0207641_10129078 3300026088 Bacteria 2267
318 Ga0207648_10080009 3300026089 Bacteria 2851
319 Ga0207648_10221270 3300026089 Bacteria 1683
320 Ga0207648_10299055 3300026089 Bacteria 1443
321 Ga0207676_10151891 3300026095 Bacteria 1995
322 Ga0207676_10195020 3300026095 Bacteria 1785
323 Ga0207674_10023792 3300026116 Bacteria 6555
324 Ga0207674_10024010 3300026116 Bacteria 6520
325 Ga0207675_100000607 3300026118 Bacteria 34962
326 Ga0207675_100243214 3300026118 Bacteria 1739
327 Ga0207675_100464749 3300026118 Unclassified 1256
328 Ga0207683_10155006 3300026121 Unclassified 2069
329 Ga0207698_10071662 3300026142 Unclassified 2750
330 Ga0207428_10007410 3300027907 Bacteria 10002
331 Ga0268266_10014186 3300028379 Bacteria 6854
332 Ga0268266_10049911 3300028379 Bacteria 3589
333 Ga0268266_10051374 3300028379 Bacteria 3538
334 Ga0268264_10182355 3300028381 Bacteria 1908
335 Ga0307408_100093971 3300031548 Bacteria 2270
336 Ga0307408_100206689 3300031548 Unclassified 1593
337 Ga0307408_100224443 3300031548 Bacteria 1535
338 Ga0265314_10000518 3300031711 Bacteria 49782
339 Ga0307405_10011244 3300031731 Unclassified 4679
340 Ga0307413_10000317 3300031824 Bacteria 15034
341 Ga0307413_10004142 3300031824 Bacteria 6254
342 Ga0307413_10009545 3300031824 Bacteria 4651
343 Ga0307413_10177461 3300031824 Bacteria 1515
344 Ga0307410_10014029 3300031852 Bacteria 4698
345 Ga0307410_10018001 3300031852 Bacteria 4257
346 Ga0307406_10048303 3300031901 Bacteria 2687
347 Ga0307407_10000846 3300031903 Bacteria 10215
348 Ga0307407_10006390 3300031903 Bacteria 5229
349 Ga0307412_10130890 3300031911 Unclassified 1822
350 Ga0307412_10282895 3300031911 Unclassified 1303
351 Ga0307416_100007120 3300032002 Bacteria 7071
352 Ga0307416_100039761 3300032002 Bacteria 3646
353 Ga0307416_100151807 3300032002 Bacteria 2126
354 Ga0307411_10004520 3300032005 Bacteria 6676
355 Ga0307411_10041391 3300032005 Bacteria 2931
356 Ga0307415_100006932 3300032126 Bacteria 6155
357 Ga0307415_100008276 3300032126 Bacteria 5756
358 Ga0373926_0059586 3300035083 Bacteria 1389
359 Ga0373923_0044503 3300035111 Bacteria 1840
360 Ga0373956_0036410 3300035119 Bacteria 2172
361 Ga0373943_0022227 3300035170 Bacteria 2937
362 Ga0373955_0105319 3300035172 Bacteria 1624
363 Ga0373935_0021072 3300035692 Bacteria 3988
364 Ga0373933_0021317 3300035724 Bacteria 3680
365 Ga0373933_0102935 3300035724 Unclassified 1773
366 Ga0373937_0001115 3300036401 Bacteria 22657
367 Ga0373937_0012497 3300036401 Bacteria 7472
368 Ga0373937_0077512 3300036401 Bacteria 3071
369 Ga0373937_0476281 3300036401 Bacteria 1186
370 Ga0373925_0039369 3300037068 Bacteria 3497
371 Ga0373925_0058267 3300037068 Bacteria 2896
372 Ga0373925_0188009 3300037068 Bacteria 1638
373 Ga0436364_1117034 3300037853 Bacteria 1265
374 Ga0436364_1484329 3300037853 Bacteria 65529
375 Ga0436365_1505130 3300039437 Bacteria 1094
376 Ga0436363_1041392 3300039450 Unclassified 2030
377 Ga0451853_1010550 3300041512 Bacteria 1060
378 Ga0451576_0046084 3300045051 Bacteria 4591
379 Ga0495651_0034154 3300046462 Bacteria 3965
380 Ga0495651_0036137 3300046462 Bacteria 3846
381 Ga0495580_0189917 3300046472 Bacteria 1417
382 Ga0495580_0236570 3300046472 Bacteria 1253
383 Ga0495639_0016142 3300046475 Bacteria 3240
384 Ga0495652_0163009 3300046529 Bacteria 1729
385 Ga0495645_0112876 3300046543 Unclassified 1921
386 Ga0495633_0087708 3300046558 Unclassified 1447
387 Ga0495668_0002034 3300046616 Bacteria 17625
388 Ga0495635_0054947 3300046663 Bacteria 2743
389 Ga0495635_0117245 3300046663 Bacteria 1817
390 Ga0495658_0008931 3300046683 Bacteria 4984
391 Ga0495649_0097947 3300046694 Bacteria 1560
392 Ga0495581_0039221 3300047315 Bacteria 2742
393 Ga0495604_0093203 3300047317 Bacteria 2229
394 Ga0496100_0231383 3300048903 Bacteria 1360
395 Ga0496102_0036272 3300048905 Bacteria 4442
396 Ga0496102_0071938 3300048905 Bacteria 3176
397 Ga0496104_0066902 3300048907 Bacteria 3412
398 Ga0496104_0347786 3300048907 Bacteria 1395
399 Ga0496105_0011824 3300048908 Bacteria 6912
400 Ga0496105_0045639 3300048908 Bacteria 3616
401 Ga0496106_0008505 3300048909 Bacteria 7590
402 Ga0496108_0018433 3300048911 Bacteria 5714
403 Ga0496110_0009959 3300048913 Bacteria 7710
404 Ga0496111_0006545 3300048914 Bacteria 7577
405 Ga0496111_0034390 3300048914 Unclassified 3619
406 Ga0496111_0148343 3300048914 Bacteria 1739
407 Ga0496112_0006526 3300048915 Bacteria 10257
408 Ga0496112_0033351 3300048915 Bacteria 5005
409 Ga0496112_0060973 3300048915 Bacteria 3718
410 Ga0496112_0145943 3300048915 Bacteria 2334
411 Ga0496112_0283694 3300048915 Bacteria 1603
412 Ga0496113_0000379 3300048916 Bacteria 21479
413 Ga0496113_0013913 3300048916 Bacteria 5470
414 Ga0496113_0073268 3300048916 Bacteria 2609
415 Ga0496114_0172392 3300048917 Bacteria 1886
416 Ga0496115_0022881 3300048918 Bacteria 4848
417 Ga0501299_019933 3300049522 Unclassified 1218
418 Ga0501072_0011661 3300049588 Bacteria 6715
419 Ga0501242_011339 3300049674 Unclassified 1075
420 Ga0501283_013160 3300049779 Unclassified 1251
421 nmdc:mga05p37_116199_c1 3300050507 Bacteria 3288
422 nmdc:mga09592_80316_c1 3300050508 Bacteria 2777
423 nmdc:mga06r32_746957_c1 3300050510 Unclassified 942
424 nmdc:mga06r32_84535_c1 3300050510 Bacteria 3093
425 nmdc:mga08y16_814_c1 3300050511 Bacteria 29883
426 nmdc:mga0n895_101625_c1 3300050512 Bacteria 2885
427 nmdc:mga0n895_221811_c1 3300050512 Bacteria 1919
428 nmdc:mga0n895_33148_c1 3300050512 Bacteria 4962
429 nmdc:mga0n895_466490_c1 3300050512 Bacteria 1274
430 nmdc:mga0rr50_6142_c1 3300050513 Bacteria 7272
431 nmdc:mga08x19_16927_c1 3300050514 Archaea 4454
432 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
433 Ga0501082_0007969 3300060353 Bacteria 9144
434 Ga0068855_100264253
435 LJQas_1009333
436 JGI25406J46586_10005619
437 Ga0065712_10087046
438 Ga0065715_10206590
439 Ga0065707_10086661
440 Ga0070658_10103198
441 Ga0070683_100090351
442 Ga0070670_100087144
443 Ga0070670_100155330
444 Ga0070666_10077933
445 Ga0068868_100030110
446 Ga0068868_100062711
447 Ga0068868_100216944
448 Ga0068868_100228408
449 Ga0070660_100002714
450 Ga0070687_100109856
451 Ga0070668_100095735
452 Ga0070675_100120550
453 Ga0070673_100072029
454 Ga0070688_100260686
455 Ga0070667_100218779
456 Ga0070709_10116102
457 Ga0070714_100254903
458 Ga0070714_100280614
459 Ga0070713_100149959
460 Ga0070713_100194607
461 Ga0070705_100057640
462 Ga0070700_100141603
463 Ga0070708_100327123
464 Ga0070662_100224790
465 Ga0070662_100303147
466 Ga0070681_10010399
467 Ga0070681_10033250
468 Ga0070681_10033650
469 Ga0070681_10102529
470 Ga0070681_10305817
471 Ga0070681_10325875
472 Ga0068867_100148916
473 Ga0068867_100151665
474 Ga0068867_100387213
475 Ga0070699_100026253
476 Ga0070679_100020054
477 Ga0070679_100058430
478 Ga0070679_100324827
479 Ga0070679_100384760
480 Ga0070684_100065591
481 Ga0070684_100118094
482 Ga0070697_100068267
483 Ga0068853_100234963
484 Ga0068853_100306786
485 Ga0068853_100340132
486 Ga0070695_100029124
487 Ga0070695_100038862
488 Ga0070695_100086968
489 Ga0070695_100267123
490 Ga0070693_100218675
491 Ga0070665_100003708
492 Ga0070665_100018319
493 Ga0070704_100028098
494 Ga0068855_100003717
495 Ga0070664_100040077
496 Ga0070664_100162862
497 Ga0068857_100012213
498 Ga0068857_100041387
499 Ga0068856_100019474
500 Ga0068856_100033041
501 Ga0068856_100124324
502 Ga0068856_100253538
503 Ga0068852_100016695
504 Ga0068852_100128147
505 Ga0068859_100049274
506 Ga0068859_100129987
507 Ga0068859_100235954
508 Ga0068859_100582983
509 Ga0068864_100008469
510 Ga0068864_100027169
511 Ga0068864_100034662
512 Ga0068864_100047174
513 Ga0068864_100276378
514 Ga0068861_100005810
515 Ga0068861_100266501
516 Ga0068863_100030374
517 Ga0068863_100174548
518 Ga0068858_100022314
519 Ga0068858_100118223
520 Ga0068858_100135743
521 Ga0068858_100146386
522 Ga0068858_100230604
523 Ga0068860_100189152
524 Ga0068862_100138606
525 Ga0081539_10000201
526 Ga0081539_10002560
527 Ga0070717_10039507
528 Ga0070717_10078241
529 Ga0070717_10148693
530 Ga0070717_10168754
531 Ga0070717_10414919
532 Ga0070715_10016121
533 Ga0070712_100120216
534 Ga0070712_100243546
535 Ga0097621_100003144
536 Ga0097621_100185340
537 Ga0097621_100345801
538 Ga0068871_100033810
539 Ga0068871_100044941
540 Ga0068871_100090047
541 Ga0068871_100102104
542 Ga0068871_100107224
543 Ga0068871_100108776
544 Ga0075428_100006375
545 Ga0075428_100517212
546 Ga0075431_100068267
547 Ga0075431_100147103
548 Ga0075433_10085206
549 Ga0075434_100115799
550 Ga0068865_100152119
551 Ga0068865_100166699
552 Ga0075436_100000176
553 Ga0075436_100021563
554 Ga0097620_100049273
555 Ga0097620_100129979
556 Ga0097620_100235940
557 Ga0097620_100582934
558 Ga0075435_100000606
559 Ga0105240_10000937
560 Ga0105240_10028064
561 Ga0105240_10152024
562 Ga0105240_10160707
563 Ga0105240_10276728
564 Ga0105240_10412699
565 Ga0105240_10462932
566 Ga0111539_10001939
567 Ga0105245_10039120
568 Ga0105245_10041643
569 Ga0105245_10060736
570 Ga0105245_10061916
571 Ga0105245_10170738
572 Ga0105245_10176468
573 Ga0105245_10575172
574 Ga0105247_10004857
575 Ga0114129_10025043
576 Ga0105243_10000287
577 Ga0105243_10171352
578 Ga0105241_10046930
579 Ga0105241_10051079
580 Ga0105242_10000377
581 Ga0105242_10004699
582 Ga0105242_10010650
583 Ga0105242_10029975
584 Ga0105242_10067344
585 Ga0105242_10176702
586 Ga0105242_10431962
587 Ga0105248_10014918
588 Ga0105248_10078116
589 Ga0105248_10081808
590 Ga0105248_10136900
591 Ga0105248_10209167
592 Ga0105248_10321977
593 Ga0105248_10563393
594 Ga0105237_10023416
595 Ga0105237_10204051
596 Ga0105238_10065832
597 Ga0105238_10112860
598 Ga0105238_10201137
599 Ga0105238_10391994
600 Ga0105249_10010452
601 Ga0105249_10159321
602 Ga0105239_10011562
603 Ga0105239_10025176
604 Ga0105239_10034829
605 Ga0105239_10154469
606 Ga0105239_10222732
607 Ga0105239_10438261
608 Ga0105239_10702887
609 Ga0157373_10186659
610 Ga0157370_10084700
611 Ga0157369_10012749
612 Ga0157369_10078069
613 Ga0157369_10139969
614 Ga0157369_10420237
615 Ga0157374_10060482
616 Ga0157374_10124226
617 Ga0157374_10262298
618 Ga0157374_10338385
619 Ga0157374_10481002
620 Ga0157378_10000032
621 Ga0157378_10014884
622 Ga0157378_10024075
623 Ga0157378_10037753
624 Ga0157378_10075238
625 Ga0157378_10180821
626 Ga0157378_10193691
627 Ga0163162_10003172
628 Ga0163162_10005556
629 Ga0163162_10051865
630 Ga0163162_10219442
631 Ga0163162_10288494
632 Ga0163162_10378248
633 Ga0163162_10487459
634 Ga0163162_10692796
635 Ga0157372_10046422
636 Ga0157372_10355558
637 Ga0157372_10461788
638 Ga0157372_10468898
639 Ga0157375_10049901
640 Ga0163163_10000832
641 Ga0163163_10014541
642 Ga0163163_10097727
643 Ga0163163_10112465
644 Ga0163163_10134690
645 Ga0163163_10579998
646 Ga0157380_10026666
647 Ga0157379_10070300
648 Ga0157379_10129511
649 Ga0157376_10049408
650 Ga0157376_10063513
651 Ga0163161_10123147
652 Ga0163161_10174208
653 Ga0154015_1519836
654 Ga0213875_10000170
655 Ga0224712_10045256
656 Ga0228598_1000056
657 Ga0207682_10008125
658 Ga0207692_10111213
659 Ga0207692_10172837
660 Ga0207642_10136985
661 Ga0207688_10066477
662 Ga0207699_10052274
663 Ga0207699_10069210
664 Ga0207643_10010912
665 Ga0207705_10141869
666 Ga0207654_10022427
667 Ga0207707_10006028
668 Ga0207707_10027234
669 Ga0207707_10044162
670 Ga0207707_10044632
671 Ga0207707_10053614
672 Ga0207707_10143049
673 Ga0207707_10371830
674 Ga0207695_10004326
675 Ga0207695_10025127
676 Ga0207695_10052964
677 Ga0207695_10240766
678 Ga0207671_10177637
679 Ga0207693_10026484
680 Ga0207693_10105975
681 Ga0207693_10229837
682 Ga0207663_10110526
683 Ga0207663_10115752
684 Ga0207663_10257733
685 Ga0207657_10007264
686 Ga0207657_10216682
687 Ga0207652_10028230
688 Ga0207652_10125911
689 Ga0207652_10323936
690 Ga0207694_10056749
691 Ga0207694_10125766
692 Ga0207694_10153284
693 Ga0207650_10017303
694 Ga0207650_10034649
695 Ga0207659_10199217
696 Ga0207687_10006061
697 Ga0207687_10078299
698 Ga0207687_10181124
699 Ga0207687_10232019
700 Ga0207700_10004106
701 Ga0207700_10024358
702 Ga0207700_10026574
703 Ga0207664_10051588
704 Ga0207664_10127704
705 Ga0207664_10160551
706 Ga0207664_10415107
707 Ga0207706_10245378
708 Ga0207706_10403429
709 Ga0207686_10001148
710 Ga0207686_10002446
711 Ga0207686_10008364
712 Ga0207686_10039815
713 Ga0207709_10000455
714 Ga0207709_10155893
715 Ga0207669_10373024
716 Ga0207704_10204421
717 Ga0207665_10027950
718 Ga0207665_10038997
719 Ga0207711_10153367
720 Ga0207711_10218809
721 Ga0207711_10310752
722 Ga0207711_10360865
723 Ga0207711_10463530
724 Ga0207689_10045661
725 Ga0207679_10094387
726 Ga0207679_10120062
727 Ga0207667_10021110
728 Ga0207667_10128398
729 Ga0207667_10557365
730 Ga0207651_10066096
731 Ga0207640_10152233
732 Ga0207658_10042410
733 Ga0207677_10014074
734 Ga0207677_10027139
735 Ga0207677_10055279
736 Ga0207677_10245045
737 Ga0207703_10015694
738 Ga0207703_10163297
739 Ga0207703_10203401
740 Ga0207703_10454961
741 Ga0207639_10106063
742 Ga0207639_10129294
743 Ga0207639_10359388
744 Ga0207702_10024666
745 Ga0207702_10037053
746 Ga0207702_10053070
747 Ga0207702_10063259
748 Ga0207641_10061797
749 Ga0207641_10127339
750 Ga0207641_10129078
751 Ga0207648_10080009
752 Ga0207648_10221270
753 Ga0207648_10299055
754 Ga0207676_10151891
755 Ga0207676_10195020
756 Ga0207674_10023792
757 Ga0207674_10024010
758 Ga0207675_100000607
759 Ga0207675_100243214
760 Ga0207675_100464749
761 Ga0207683_10155006
762 Ga0207698_10071662
763 Ga0207428_10007410
764 Ga0268266_10014186
765 Ga0268266_10049911
766 Ga0268266_10051374
767 Ga0268264_10182355
768 Ga0307408_100093971
769 Ga0307408_100206689
770 Ga0307408_100224443
771 Ga0265314_10000518
772 Ga0307405_10011244
773 Ga0307413_10000317
774 Ga0307413_10004142
775 Ga0307413_10009545
776 Ga0307413_10177461
777 Ga0307410_10014029
778 Ga0307410_10018001
779 Ga0307406_10048303
780 Ga0307407_10000846
781 Ga0307407_10006390
782 Ga0307412_10130890
783 Ga0307412_10282895
784 Ga0307416_100007120
785 Ga0307416_100039761
786 Ga0307416_100151807
787 Ga0307411_10004520
788 Ga0307411_10041391
789 Ga0307415_100006932
790 Ga0307415_100008276
791 Ga0373926_0059586
792 Ga0373923_0044503
793 Ga0373956_0036410
794 Ga0373943_0022227
795 Ga0373955_0105319
796 Ga0373935_0021072
797 Ga0373933_0021317
798 Ga0373933_0102935
799 Ga0373937_0001115
800 Ga0373937_0012497
801 Ga0373937_0077512
802 Ga0373937_0476281
803 Ga0373925_0039369
804 Ga0373925_0058267
805 Ga0373925_0188009
806 Ga0436364_1117034
807 Ga0436364_1484329
808 Ga0436365_1505130
809 Ga0436363_1041392
810 Ga0451853_1010550
811 Ga0451576_0046084
812 Ga0495651_0034154
813 Ga0495651_0036137
814 Ga0495580_0189917
815 Ga0495580_0236570
816 Ga0495639_0016142
817 Ga0495652_0163009
818 Ga0495645_0112876
819 Ga0495633_0087708
820 Ga0495668_0002034
821 Ga0495635_0054947
822 Ga0495635_0117245
823 Ga0495658_0008931
824 Ga0495649_0097947
825 Ga0495581_0039221
826 Ga0495604_0093203
827 Ga0496100_0231383
828 Ga0496102_0036272
829 Ga0496102_0071938
830 Ga0496104_0066902
831 Ga0496104_0347786
832 Ga0496105_0011824
833 Ga0496105_0045639
834 Ga0496106_0008505
835 Ga0496108_0018433
836 Ga0496110_0009959
837 Ga0496111_0006545
838 Ga0496111_0034390
839 Ga0496111_0148343
840 Ga0496112_0006526
841 Ga0496112_0033351
842 Ga0496112_0060973
843 Ga0496112_0145943
844 Ga0496112_0283694
845 Ga0496113_0000379
846 Ga0496113_0013913
847 Ga0496113_0073268
848 Ga0496114_0172392
849 Ga0496115_0022881
850 Ga0501299_019933
851 Ga0501072_0011661
852 Ga0501242_011339
853 Ga0501283_013160
854 nmdc:mga05p37_116199_c1
855 nmdc:mga09592_80316_c1
856 nmdc:mga06r32_746957_c1
857 nmdc:mga06r32_84535_c1
858 nmdc:mga08y16_814_c1
859 nmdc:mga0n895_101625_c1
860 nmdc:mga0n895_221811_c1
861 nmdc:mga0n895_33148_c1
862 nmdc:mga0n895_466490_c1
863 nmdc:mga0rr50_6142_c1
864 nmdc:mga08x19_16927_c1
865 nmdc:mga08x19_3_c1
866 Ga0501082_0007969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

205

301

0.96

PF08241

Methyltransf_11

Methyltransferase domain

206

305

0.95

PF08100

Dimerisation

Dimerisation domain

37

123

0.94

PF00891

Methyltransf_2

O-methyltransferase domain

163

352

0.92

PF05175

MTS

Methyltransferase small domain

188

319

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r3s-assembly1.cif.gz_B crystal structure of a putative o-methyltransferase (npun_r0239) from nostoc punctiforme pcc 73102 at 2.15 a resolution 0.9777 5 337
2r3s-assembly1.cif.gz_B crystal structure of a putative o-methyltransferase (npun_r0239) from nostoc punctiforme pcc 73102 at 2.15 a resolution 0.9748 5 337
2r3s-assembly1.cif.gz_A crystal structure of a putative o-methyltransferase (npun_r0239) from nostoc punctiforme pcc 73102 at 2.15 a resolution 0.9707 7 337
2r3s-assembly1.cif.gz_A crystal structure of a putative o-methyltransferase (npun_r0239) from nostoc punctiforme pcc 73102 at 2.15 a resolution 0.9649 7 337
8tji-assembly1.cif.gz_A sam-dependent methyltransferase redm, apo 0.9083 11 337
ID Description Score Start End Superfamily
2r3sB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9725 132 337 3.40.50.150
af_B3GSH5_14_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9592 12 90 1.10.10.10
2r3sA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9554 7 85 1.10.10.10
af_Q60307_1009_1064_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9547 43 81 1.10.10.10
2r3sB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9487 132 337 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q3AJI5-F1-model_v4 deleted 0.979 1 287
AF-A0A359M607-F1-model_v4 Methyltransferase type 12 0.9731 124 337 GO:0008171
GO:0032259
AF-A0A4Q3AJI5-F1-model_v4 deleted 0.9723 1 287
AF-A0A0G3ERP2-F1-model_v4 SAM-dependent methyltransferase 0.9715 5 335 GO:0008171
GO:0009058
GO:0032259
AF-A0A1Q7Y5E5-F1-model_v4 Methyltransferase type 12 0.9714 105 337 GO:0008171
GO:0032259

Map