F442564

General Info

Members Datasets Scaffolds Average Seq Length
432 328 310 316

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10112717|Ga0081455_101127172
Length 334
Sequence MGARRIEVPNFRGDVEMARYRDALPQRRGGIFLTDGGMETTLIFHEGVDLPHFAAFVLLDSAEGRQKLKQYYAAYLSVARNHGTGFVLDSPTWRANPDWGAKLGYDAAALNAINVRSIAFLEELRADWERPGAACVISGAIGPRGDGYKAGNMDAAEAEDYHRAQIAAFAEGGADMATAYTLNSVNEAIGIAQAARSQGMPVAISFTVETNGRLVKGETLREAIETVDRVTDRAPEYFLINCAHPTHFEDALQAGEPWTDRIHGVRANASTKSHAELDESETLDAGDPVDLGRRYVALRSTFPKMRILGGCCGTDHRHAAAICEACVPPRALTA

Samples

Sample ID Description Type Environment
1 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
2 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
7 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
8 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
9 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
13 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
14 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
15 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
16 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2791355199
19 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
20 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
21 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
22 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
23 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
24 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
25 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
26 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
32 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
35 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
36 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
37 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
38 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
39 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
40 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
41 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
42 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
43 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
44 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
45 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
46 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
47 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
48 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
49 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
50 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
51 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
52 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
53 2922368715
54 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
55 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
56 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
57 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
58 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
59 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
60 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
61 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
62 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
63 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
64 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
65 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
66 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
67 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
68 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
69 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
70 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
71 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
72 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
73 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
74 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
75 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
76 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
77 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
78 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
79 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
80 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
81 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
82 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
83 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
84 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
85 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
86 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
87 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
88 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
89 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
90 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
91 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
92 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
93 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
94 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
95 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
96 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
97 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
98 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
99 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
100 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
101 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
102 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
103 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
104 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
105 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
106 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
107 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
108 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
109 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
110 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
111 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
112 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
114 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
115 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
116 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
117 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
118 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
119 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
120 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
121 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
122 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
123 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
124 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
125 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
126 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
127 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
128 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
129 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
130 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
131 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
132 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
133 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
134 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
138 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
139 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
142 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
143 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
144 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
148 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
149 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
150 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
153 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
154 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
155 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
156 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
157 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
158 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
159 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
166 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
174 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
175 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
176 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
177 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
178 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
179 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
180 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
181 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
182 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
223 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
239 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
243 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
244 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
245 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
246 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
268 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
307 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
308 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
309 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
310 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
315 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
317 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
318 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
319 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
320 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
321 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
322 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
323 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
324 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
325 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
326 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
327 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
328 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.09
Metatranscriptomes 0
Isolates 27.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.03
Nodule 22.92
Rhizoplane 5.32
Rhizosphere 52.55
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10011538 3300002077 Bacteria 1806
2 JGI25151J46595_10037935 3300003187 Bacteria 1801
3 JGI25406J46586_10000761 3300003203 Bacteria 15096
4 rootH2_10170822 3300003320 Bacteria 1394
5 Ga0065165_1003372 3300005262 Bacteria 11322
6 Ga0070658_10057490 3300005327 Bacteria 3163
7 Ga0070676_10104128 3300005328 Bacteria 1758
8 Ga0068869_100049961 3300005334 Bacteria 3030
9 Ga0070682_100089786 3300005337 Bacteria 2008
10 Ga0070660_100090011 3300005339 Bacteria 2419
11 Ga0070687_100051146 3300005343 Bacteria 2138
12 Ga0070661_100043197 3300005344 Bacteria 3292
13 Ga0070668_100171377 3300005347 Bacteria 1767
14 Ga0070668_100266419 3300005347 Bacteria 1426
15 Ga0070668_100326033 3300005347 Bacteria 1294
16 Ga0070675_100115296 3300005354 Bacteria 2277
17 Ga0070675_100249219 3300005354 Bacteria 1554
18 Ga0070675_100251595 3300005354 Bacteria 1547
19 Ga0070671_100044290 3300005355 Bacteria 3698
20 Ga0070671_100200595 3300005355 Bacteria 1691
21 Ga0070671_100304111 3300005355 Bacteria 1358
22 Ga0070674_100020707 3300005356 Bacteria 4209
23 Ga0070659_100088919 3300005366 Bacteria 2474
24 Ga0070667_100117666 3300005367 Bacteria 2309
25 Ga0070709_10065579 3300005434 Bacteria 2326
26 Ga0070713_100195172 3300005436 Bacteria 1826
27 Ga0070710_10011483 3300005437 Bacteria 4375
28 Ga0070700_100019780 3300005441 Bacteria 3890
29 Ga0070663_100034894 3300005455 Bacteria 3486
30 Ga0070663_100053613 3300005455 Bacteria 2879
31 Ga0070663_100082116 3300005455 Bacteria 2370
32 Ga0070663_100100993 3300005455 Bacteria 2152
33 Ga0070707_100185032 3300005468 Bacteria 2031
34 Ga0070697_100065203 3300005536 Bacteria 2976
35 Ga0068853_100103615 3300005539 Bacteria 2518
36 Ga0070672_100036570 3300005543 Bacteria 3741
37 Ga0070686_100040364 3300005544 Bacteria 2911
38 Ga0070686_100054790 3300005544 Bacteria 2552
39 Ga0070695_100110803 3300005545 Bacteria 1862
40 Ga0070693_100024487 3300005547 Bacteria 3238
41 Ga0070665_100011367 3300005548 Bacteria 9002
42 Ga0070665_100016063 3300005548 Bacteria 7513
43 Ga0070665_100051093 3300005548 Bacteria 4147
44 Ga0070665_100091360 3300005548 Bacteria 3050
45 Ga0070665_100100509 3300005548 Bacteria 2896
46 Ga0070665_100131925 3300005548 Bacteria 2500
47 Ga0070665_100145334 3300005548 Bacteria 2375
48 Ga0070664_100103088 3300005564 Bacteria 2483
49 Ga0068852_100084470 3300005616 Bacteria 2825
50 Ga0068852_100153357 3300005616 Bacteria 2144
51 Ga0068866_10012734 3300005718 Bacteria 3670
52 Ga0068866_10046394 3300005718 Bacteria 2185
53 Ga0068861_100010132 3300005719 Bacteria 6536
54 Ga0068863_100017589 3300005841 Bacteria 6848
55 Ga0068863_100383911 3300005841 Bacteria 1372
56 Ga0068858_100045575 3300005842 Bacteria 4064
57 Ga0068862_100318205 3300005844 Bacteria 1435
58 Ga0068862_100341230 3300005844 Bacteria 1387
59 Ga0081455_10005228 3300005937 Bacteria 14271
60 Ga0081455_10112717 3300005937 Bacteria 2158
61 Ga0081455_10205854 3300005937 Bacteria 1470
62 Ga0081540_1001659 3300005983 Bacteria 18932
63 Ga0081540_1060616 3300005983 Bacteria 1809
64 Ga0081540_1105897 3300005983 Bacteria 1200
65 Ga0081539_10000936 3300005985 Bacteria 54722
66 Ga0081539_10003778 3300005985 Bacteria 17902
67 Ga0075365_10002290 3300006038 Bacteria 9305
68 Ga0075365_10017901 3300006038 Bacteria 4347
69 Ga0075365_10049498 3300006038 Bacteria 2769
70 Ga0075365_10066612 3300006038 Bacteria 2417
71 Ga0075365_10137368 3300006038 Bacteria 1695
72 Ga0075363_100026322 3300006048 Bacteria 2975
73 Ga0075363_100043807 3300006048 Bacteria 2368
74 Ga0070716_100049481 3300006173 Bacteria 2381
75 Ga0075362_10027123 3300006177 Bacteria 2450
76 Ga0075362_10062593 3300006177 Bacteria 1686
77 Ga0075367_10015623 3300006178 Bacteria 4132
78 Ga0075369_10054249 3300006186 Bacteria 1740
79 Ga0075370_10024056 3300006353 Bacteria 3360
80 Ga0075428_100174618 3300006844 Bacteria 2328
81 Ga0075435_100156981 3300007076 Bacteria 1915
82 Ga0111539_10080447 3300009094 Bacteria 3833
83 Ga0105245_10026410 3300009098 Bacteria 5110
84 Ga0105245_10109408 3300009098 Bacteria 2568
85 Ga0105247_10032747 3300009101 Bacteria 3158
86 Ga0105247_10073279 3300009101 Bacteria 2145
87 Ga0105243_10207409 3300009148 Bacteria 1723
88 Ga0105241_10038771 3300009174 Bacteria 3592
89 Ga0105242_10000052 3300009176 Bacteria 79244
90 Ga0105242_10505745 3300009176 Bacteria 1150
91 Ga0105248_10010677 3300009177 Bacteria 10132
92 Ga0105248_10107130 3300009177 Bacteria 3151
93 Ga0105239_10203522 3300010375 Bacteria 2218
94 Ga0105239_10237768 3300010375 Bacteria 2044
95 Ga0105246_10308043 3300011119 Bacteria 1282
96 Ga0157369_10467404 3300013105 Bacteria 1306
97 Ga0157374_10203555 3300013296 Bacteria 1939
98 Ga0157374_10403835 3300013296 Bacteria 1363
99 Ga0157378_10286028 3300013297 Bacteria 1591
100 Ga0163162_10373928 3300013306 Bacteria 1558
101 Ga0163162_10520769 3300013306 Bacteria 1319
102 Ga0157375_10046215 3300013308 Bacteria 4243
103 Ga0157375_10089918 3300013308 Bacteria 3128
104 Ga0157375_10139805 3300013308 Bacteria 2548
105 Ga0163163_10043550 3300014325 Bacteria 4401
106 Ga0163163_10055022 3300014325 Bacteria 3932
107 Ga0163163_10491285 3300014325 Unclassified 1289
108 Ga0157380_10493278 3300014326 Bacteria 1188
109 Ga0157379_10292425 3300014968 Bacteria 1484
110 Ga0157376_10367195 3300014969 Bacteria 1382
111 Ga0214544_1000016 3300021320 Bacteria 204278
112 Ga0214542_1000016 3300021321 Bacteria 210332
113 Ga0214542_1030516 3300021321 Bacteria 2091
114 Ga0214545_1000008 3300021324 Bacteria 215190
115 Ga0214545_1023901 3300021324 Bacteria 3901
116 Ga0214543_1000043 3300021327 Bacteria 160517
117 Ga0214543_1031621 3300021327 Bacteria 2091
118 Ga0228710_1000001 3300022740 Bacteria 314328
119 Ga0209129_1000078 3300025258 Bacteria 192880
120 Ga0209025_1003355 3300025294 Bacteria 15349
121 Ga0209564_1000989 3300025295 Bacteria 35547
122 Ga0209758_1009753 3300025297 Bacteria 5893
123 Ga0207426_1001680 3300025302 Bacteria 17102
124 Ga0209051_1009350 3300025303 Bacteria 5063
125 Ga0209051_1014572 3300025303 Bacteria 3661
126 Ga0207642_10025973 3300025899 Bacteria 2378
127 Ga0207710_10024580 3300025900 Bacteria 2596
128 Ga0207710_10036224 3300025900 Bacteria 2174
129 Ga0207688_10039996 3300025901 Bacteria 2605
130 Ga0207647_10059441 3300025904 Bacteria 2339
131 Ga0207699_10067498 3300025906 Bacteria 2174
132 Ga0207705_10055573 3300025909 Bacteria 2854
133 Ga0207654_10053635 3300025911 Bacteria 2328
134 Ga0207693_10112202 3300025915 Bacteria 2138
135 Ga0207657_10098552 3300025919 Bacteria 2429
136 Ga0207657_10302176 3300025919 Bacteria 1267
137 Ga0207649_10317674 3300025920 Bacteria 1143
138 Ga0207646_10209209 3300025922 Bacteria 1762
139 Ga0207687_10047727 3300025927 Bacteria 2969
140 Ga0207644_10202855 3300025931 Bacteria 1565
141 Ga0207690_10192342 3300025932 Bacteria 1544
142 Ga0207706_10030134 3300025933 Bacteria 4841
143 Ga0207706_10213355 3300025933 Bacteria 1691
144 Ga0207686_10000119 3300025934 Bacteria 64297
145 Ga0207686_10065989 3300025934 Bacteria 2310
146 Ga0207686_10217529 3300025934 Bacteria 1377
147 Ga0207709_10266871 3300025935 Bacteria 1258
148 Ga0207669_10125767 3300025937 Bacteria 1751
149 Ga0207704_10211129 3300025938 Bacteria 1429
150 Ga0207665_10138379 3300025939 Bacteria 1734
151 Ga0207691_10059179 3300025940 Bacteria 3484
152 Ga0207689_10070242 3300025942 Bacteria 2877
153 Ga0207679_10067075 3300025945 Bacteria 2691
154 Ga0207679_10123774 3300025945 Bacteria 2063
155 Ga0207668_10026096 3300025972 Bacteria 3789
156 Ga0207668_10189334 3300025972 Bacteria 1629
157 Ga0207658_10081959 3300025986 Bacteria 2476
158 Ga0207677_10072766 3300026023 Bacteria 2431
159 Ga0207703_10071432 3300026035 Bacteria 2867
160 Ga0207678_10016881 3300026067 Bacteria 6410
161 Ga0207678_10024862 3300026067 Bacteria 5230
162 Ga0207678_10080909 3300026067 Bacteria 2780
163 Ga0207678_10096327 3300026067 Bacteria 2529
164 Ga0207678_10125828 3300026067 Bacteria 2186
165 Ga0207678_10202891 3300026067 Bacteria 1696
166 Ga0207641_10018672 3300026088 Bacteria 5685
167 Ga0207641_10369164 3300026088 Bacteria 1372
168 Ga0207648_10178845 3300026089 Bacteria 1877
169 Ga0207676_10108106 3300026095 Bacteria 2321
170 Ga0207675_100057710 3300026118 Bacteria 3622
171 Ga0207675_100131221 3300026118 Bacteria 2376
172 Ga0207675_100430264 3300026118 Bacteria 1305
173 Ga0207683_10009621 3300026121 Bacteria 8237
174 Ga0207683_10011843 3300026121 Bacteria 7441
175 Ga0207683_10071349 3300026121 Bacteria 3070
176 Ga0209281_1000164 3300027111 Bacteria 157372
177 Ga0209282_1000007 3300027666 Bacteria 254917
178 Ga0268266_10008527 3300028379 Bacteria 9107
179 Ga0268266_10009743 3300028379 Bacteria 8449
180 Ga0268266_10012334 3300028379 Bacteria 7392
181 Ga0268266_10021491 3300028379 Bacteria 5497
182 Ga0268266_10052980 3300028379 Bacteria 3485
183 Ga0268266_10056012 3300028379 Bacteria 3391
184 Ga0268266_10163148 3300028379 Bacteria 2017
185 Ga0268265_10327853 3300028380 Bacteria 1389
186 Ga0268265_10472181 3300028380 Bacteria 1176
187 Ga0268264_10245229 3300028381 Bacteria 1661
188 Ga0307517_10151507 3300028786 Bacteria 1589
189 Ga0265338_10180763 3300028800 Bacteria 1608
190 Ga0265340_10005667 3300031247 Bacteria 6905
191 Ga0265339_10126471 3300031249 Bacteria 1310
192 Ga0307413_10141101 3300031824 Bacteria 1665
193 Ga0307406_10167007 3300031901 Bacteria 1589
194 Ga0307407_10247187 3300031903 Bacteria 1220
195 Ga0315914_1000006 3300031967 Bacteria 239817
196 Ga0307409_100317611 3300031995 Bacteria 1456
197 Ga0307416_100196200 3300032002 Bacteria 1910
198 Ga0307411_10123679 3300032005 Bacteria 1877
199 Ga0307411_10165853 3300032005 Bacteria 1660
200 Ga0315913_1000002 3300033430 Bacteria 241452
201 Ga0315915_1000001 3300033464 Bacteria 481518
202 Ga0439436_0025305 3300041404 Bacteria 1743
203 Ga0439465_0060076 3300041413 Bacteria 1258
204 Ga0439449_0019856 3300042007 Bacteria 2519
205 Ga0450920_012086 3300042122 Bacteria 1615
206 Ga0450906_003485 3300042145 Bacteria 3379
207 Ga0450910_015381 3300042147 Bacteria 1126
208 Ga0450918_005654 3300042531 Bacteria 2242
209 Ga0466965_0027871 3300044683 Bacteria 2742
210 Ga0466963_0024488 3300044694 Bacteria 3844
211 Ga0466960_0025704 3300044901 Bacteria 2667
212 Ga0466960_0076350 3300044901 Bacteria 1678
213 Ga0466967_0015409 3300045976 Bacteria 5990
214 Ga0466967_0017511 3300045976 Bacteria 5692
215 Ga0466967_0092152 3300045976 Bacteria 2755
216 Ga0495638_0174749 3300046460 Bacteria 1230
217 Ga0495650_0069290 3300046471 Bacteria 1389
218 Ga0495580_0002775 3300046472 Bacteria 15082
219 Ga0495605_0124657 3300046474 Bacteria 1166
220 Ga0495610_0137694 3300046512 Bacteria 1054
221 Ga0495616_0047530 3300046513 Bacteria 2161
222 Ga0495616_0143415 3300046513 Bacteria 1085
223 Ga0495620_0046453 3300046515 Bacteria 1875
224 Ga0495644_0057328 3300046523 Bacteria 1464
225 Ga0495598_0006038 3300046537 Bacteria 2716
226 Ga0495621_0023423 3300046539 Bacteria 2053
227 Ga0495625_0185607 3300046660 Bacteria 1380
228 Ga0495625_0205008 3300046660 Bacteria 1299
229 Ga0495659_0015860 3300046664 Bacteria 2480
230 Ga0495588_0009556 3300046674 Bacteria 4487
231 Ga0495669_0052121 3300046684 Bacteria 1837
232 Ga0495589_0076264 3300046794 Bacteria 1635
233 Ga0495672_0019882 3300047320 Bacteria 4416
234 Ga0495672_0026476 3300047320 Bacteria 3700
235 Ga0495672_0047878 3300047320 Bacteria 2539
236 Ga0495672_0060825 3300047320 Bacteria 2179
237 Ga0495673_0017659 3300047469 Bacteria 3615
238 Ga0495673_0028371 3300047469 Bacteria 2652
239 Ga0495681_0111082 3300047470 Bacteria 1187
240 Ga0495686_0070071 3300047472 Bacteria 2161
241 Ga0495686_0164283 3300047472 Bacteria 1295
242 Ga0495686_0233875 3300047472 Bacteria 1039
243 Ga0495626_0048355 3300048091 Bacteria 1974
244 Ga0496101_0279022 3300048904 Bacteria 1306
245 Ga0496102_0000129 3300048905 Bacteria 104478
246 Ga0496102_0185963 3300048905 Bacteria 1958
247 Ga0496102_0300650 3300048905 Bacteria 1512
248 Ga0496103_0000087 3300048906 Bacteria 104566
249 Ga0496104_0165279 3300048907 Bacteria 2122
250 Ga0496105_0057584 3300048908 Bacteria 3208
251 Ga0496105_0296144 3300048908 Bacteria 1302
252 Ga0496106_0000814 3300048909 Bacteria 22614
253 Ga0496107_0264379 3300048910 Bacteria 1280
254 Ga0496109_0014266 3300048912 Bacteria 6914
255 Ga0496109_0150583 3300048912 Bacteria 2178
256 Ga0496109_0335620 3300048912 Bacteria 1427
257 Ga0496110_0066904 3300048913 Bacteria 3178
258 Ga0496110_0074852 3300048913 Bacteria 3008
259 Ga0496110_0103642 3300048913 Bacteria 2552
260 Ga0496110_0133704 3300048913 Bacteria 2241
261 Ga0496110_0305033 3300048913 Bacteria 1450
262 Ga0496111_0053000 3300048914 Bacteria 2930
263 Ga0496112_0033627 3300048915 Bacteria 4985
264 Ga0496112_0383468 3300048915 Bacteria 1346
265 Ga0496113_0045559 3300048916 Bacteria 3253
266 Ga0496115_0143396 3300048918 Bacteria 1971
267 Ga0496116_0037137 3300048919 Unclassified 3400
268 Ga0496116_0071271 3300048919 Bacteria 2201
269 Ga0496119_0144690 3300048922 Bacteria 1280
270 Ga0496121_0000839 3300048924 Bacteria 55686
271 Ga0496121_0009250 3300048924 Bacteria 11378
272 Ga0496121_0015364 3300048924 Bacteria 8029
273 Ga0496121_0059224 3300048924 Bacteria 3159
274 Ga0496121_0180279 3300048924 Bacteria 1525
275 Ga0496124_0131615 3300048927 Bacteria 1987
276 Ga0496125_0203728 3300048928 Bacteria 1292
277 Ga0496126_0081097 3300048929 Bacteria 2869
278 Ga0496126_0367143 3300048929 Bacteria 1174
279 Ga0501033_0049801 3300049570 Bacteria 3110
280 Ga0501036_0133427 3300049572 Bacteria 2096
281 Ga0501038_0391247 3300049574 Bacteria 1077
282 Ga0501040_0052990 3300049576 Bacteria 2778
283 Ga0501043_0006074 3300049579 Bacteria 9702
284 Ga0501047_0043488 3300049581 Bacteria 4339
285 Ga0501068_0244453 3300049584 Bacteria 1143
286 Ga0501073_0030989 3300049589 Bacteria 3817
287 Ga0501044_0022354 3300049823 Bacteria 6741
288 nmdc:mga03n38_14198_c1 3300050490 Bacteria 3046
289 nmdc:mga03n38_17806_c1 3300050490 Bacteria 2790
290 nmdc:mga0yw44_153772_c1 3300050492 Bacteria 1502
291 nmdc:mga0yw44_15474_c2 3300050492 Bacteria 1832
292 nmdc:mga0yw44_17815_c1 3300050492 Bacteria 3875
293 nmdc:mga0yw44_77162_c1 3300050492 Bacteria 2081
294 nmdc:mga06z11_64591_c1 3300050494 Bacteria 1919
295 nmdc:mga07m45_16423_c1 3300050496 Bacteria 3963
296 nmdc:mga0qj67_466462_c1 3300050509 Bacteria 1016
297 nmdc:mga08y16_290701_c1 3300050511 Bacteria 1685
298 nmdc:mga0rr50_431499_c1 3300050513 Bacteria 1115
299 Ga0495655_0000010 3300053083 Bacteria 125615
300 Ga0500566_0108182 3300053094 Bacteria 1515
301 Ga0500641_0016108 3300053096 Bacteria 2781
302 Ga0500628_000024 3300053129 Bacteria 64538
303 Ga0500642_0002033 3300053130 Bacteria 5873
304 Ga0500568_0013858 3300053139 Bacteria 3661
305 Ga0500577_0002365 3300053142 Bacteria 4813
306 Ga0500577_0013852 3300053142 Bacteria 2476
307 Ga0500616_0112410 3300053153 Bacteria 1314
308 Ga0500634_0024565 3300053161 Bacteria 3277
309 Ga0500611_015242 3300053727 Bacteria 1358
310 Ga0530510_0053086 3300061734 Bacteria 2929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0022354 Ga0501044_0022354_5905_6729 264
2 3300042147 Ga0450910_015381 Ga0450910_015381_15_908 274
3 3300041404 Ga0439436_0025305 Ga0439436_0025305_215_1180 282
4 3300041413 Ga0439465_0060076 Ga0439465_0060076_30_995 282
5 3300042122 Ga0450920_012086 Ga0450920_012086_572_1537 282
6 3300042531 Ga0450918_005654 Ga0450918_005654_1226_2191 282
7 3300042145 Ga0450906_003485 Ga0450906_003485_2018_2983 285
8 3300045976 Ga0466967_0015409 Ga0466967_0015409_5084_5971 286
9 3300050509 nmdc:mga0qj67_466462_c1 nmdc:mga0qj67_466462_c1_132_998 287
10 3300005545 Ga0070695_100110803 Ga0070695_1001108033 288
11 3300047472 Ga0495686_0233875 Ga0495686_0233875_39_986 292
12 3300046460 Ga0495638_0174749 Ga0495638_0174749_234_1199 294
13 3300021321 Ga0214542_1030516 Ga0214542_10305162 295
14 3300021324 Ga0214545_1023901 Ga0214545_10239012 295
15 3300021327 Ga0214543_1031621 Ga0214543_10316212 295
16 3300045976 Ga0466967_0017511 Ga0466967_0017511_2766_3656 295
17 3300044694 Ga0466963_0024488 Ga0466963_0024488_873_1769 296
18 3300045976 Ga0466967_0092152 Ga0466967_0092152_1800_2696 296
19 3300021320 Ga0214544_1000016 Ga0214544_100001665 298
20 3300021321 Ga0214542_1000016 Ga0214542_1000016137 298
21 3300021324 Ga0214545_1000008 Ga0214545_1000008143 298
22 3300021327 Ga0214543_1000043 Ga0214543_100004393 298
23 3300006038 Ga0075365_10137368 Ga0075365_101373682 300
24 3300050492 nmdc:mga0yw44_15474_c2 nmdc:mga0yw44_15474_c2_117_1085 300
25 3300005262 Ga0065165_1003372 Ga0065165_10033722 302
26 3300025302 Ga0207426_1001680 Ga0207426_10016802 302
27 3300031247 Ga0265340_10005667 Ga0265340_100056672 302
28 3300005841 Ga0068863_100017589 Ga0068863_1000175897 304
29 3300026088 Ga0207641_10018672 Ga0207641_100186723 304
30 3300042007 Ga0439449_0019856 Ga0439449_0019856_165_1079 304
31 3300049570 Ga0501033_0049801 Ga0501033_0049801_1710_2678 306
32 3300049574 Ga0501038_0391247 Ga0501038_0391247_15_968 306
33 3300049581 Ga0501047_0043488 Ga0501047_0043488_1011_1979 306
34 3300049589 Ga0501073_0030989 Ga0501073_0030989_1233_2201 306
35 iso_pu_bacteria 2937084907 2937085240 306
36 3300053727 Ga0500611_015242 Ga0500611_015242_351_1316 307
37 iso_pu_bacteria 2513237098 2513675036 307
38 iso_pu_bacteria 2524023210 2524466977 307
39 iso_pu_bacteria 2903768456 2903773140 307
40 iso_pu_bacteria 8056681323 8056687184 307
41 3300005327 Ga0070658_10057490 Ga0070658_100574902 308
42 3300005337 Ga0070682_100089786 Ga0070682_1000897861 308
43 3300005339 Ga0070660_100090011 Ga0070660_1000900111 308
44 3300005344 Ga0070661_100043197 Ga0070661_1000431972 308
45 3300005455 Ga0070663_100082116 Ga0070663_1000821161 308
46 3300005616 Ga0068852_100084470 Ga0068852_1000844702 308
47 3300013105 Ga0157369_10467404 Ga0157369_104674041 308
48 3300025909 Ga0207705_10055573 Ga0207705_100555732 308
49 3300025919 Ga0207657_10098552 Ga0207657_100985522 308
50 3300026067 Ga0207678_10096327 Ga0207678_100963272 308
51 3300044901 Ga0466960_0025704 Ga0466960_0025704_1004_1960 308
52 3300053094 Ga0500566_0108182 Ga0500566_0108182_386_1351 308
53 3300028800 Ga0265338_10180763 Ga0265338_101807632 309
54 3300031249 Ga0265339_10126471 Ga0265339_101264711 309
55 iso_pu_bacteria 2643221623 2644133683 309
56 3300005548 Ga0070665_100016063 Ga0070665_1000160637 310
57 3300009176 Ga0105242_10000052 Ga0105242_1000005223 310
58 3300025934 Ga0207686_10000119 Ga0207686_100001199 310
59 3300028379 Ga0268266_10163148 Ga0268266_101631482 310
60 3300047472 Ga0495686_0070071 Ga0495686_0070071_25_981 310
61 3300005718 Ga0068866_10046394 Ga0068866_100463942 311
62 3300025899 Ga0207642_10025973 Ga0207642_100259733 311
63 3300048929 Ga0496126_0367143 Ga0496126_0367143_121_1056 311
64 3300053083 Ga0495655_0000010 Ga0495655_0000010_57215_58168 311
65 3300053129 Ga0500628_000024 Ga0500628_000024_51237_52190 311
66 3300048091 Ga0495626_0048355 Ga0495626_0048355_68_1021 312
67 iso_pu_bacteria 2582581294 2585202883 312
68 iso_pu_bacteria 2582581867 2585400324 313
69 iso_pu_bacteria 2585427590 2585823048 313
70 iso_pu_bacteria 2923556063 2923557749 313
71 iso_pu_bacteria 8056681323 8056686861 313
72 iso_pu_bacteria 2513237101 2513695217 314
73 iso_pu_bacteria 2513237102 2513703010 314
74 iso_pu_bacteria 2528768022 2528855089 314
75 iso_pu_bacteria 2617270741 2617373867 314
76 iso_pu_bacteria 2721755755 2723841744 314
77 iso_pu_bacteria 2791355199 2793080820 314
78 iso_pu_bacteria 2824600985 2824608803 314
79 iso_pu_bacteria 2824609381 2824616727 314
80 iso_pu_bacteria 2824617872 2824623897 314
81 iso_pu_bacteria 2824626560 2824631705 314
82 iso_pu_bacteria 2824635225 2824643613 314
83 iso_pu_bacteria 2824644064 2824652106 314
84 iso_pu_bacteria 2824653114 2824660754 314
85 iso_pu_bacteria 2824661429 2824667830 314
86 iso_pu_bacteria 2824679649 2824687501 314
87 iso_pu_bacteria 2824714736 2824722444 314
88 iso_pu_bacteria 2824723954 2824732091 314
89 iso_pu_bacteria 2824732956 2824735088 314
90 iso_pu_bacteria 2824746037 2824748590 314
91 iso_pu_bacteria 2857509624 2857516821 314
92 iso_pu_bacteria 2874604998 2874607957 314
93 iso_pu_bacteria 2876808645 2876818266 314
94 iso_pu_bacteria 2879099564 2879105915 314
95 iso_pu_bacteria 2879110137 2879113390 314
96 iso_pu_bacteria 2881364244 2881365215 314
97 iso_pu_bacteria 2885366525 2885369405 314
98 iso_pu_bacteria 2888419890 2888420198 314
99 iso_pu_bacteria 2889033259 2889035378 314
100 iso_pu_bacteria 2908775508 2908776384 314
101 iso_pu_bacteria 2915980308 2915986074 314
102 iso_pu_bacteria 2920760137 2920763011 314
103 iso_pu_bacteria 2921250672 2921250858 314
104 iso_pu_bacteria 2922368715 2922369465 314
105 iso_pu_bacteria 2922386360 2922389838 314
106 iso_pu_bacteria 2922393267 2922398939 314
107 iso_pu_bacteria 2929615660 2929618708 314
108 iso_pu_bacteria 2929624759 2929628607 314
109 iso_pu_bacteria 2932784394 2932790889 314
110 iso_pu_bacteria 2932809354 2932812059 314
111 iso_pu_bacteria 2932818245 2932825491 314
112 iso_pu_bacteria 2932828146 2932833606 314
113 iso_pu_bacteria 2933577622 2933580581 314
114 iso_pu_bacteria 2935616580 2935623132 314
115 iso_pu_bacteria 2935638405 2935644207 314
116 iso_pu_bacteria 2935665750 2935672211 314
117 iso_pu_bacteria 2935675223 2935679265 314
118 iso_pu_bacteria 2935684952 2935686509 314
119 iso_pu_bacteria 2935703347 2935710240 314
120 iso_pu_bacteria 2935713505 2935716197 314
121 iso_pu_bacteria 2935722832 2935723679 314
122 iso_pu_bacteria 2935732158 2935735234 314
123 iso_pu_bacteria 2935741537 2935743975 314
124 iso_pu_bacteria 2935750917 2935752475 314
125 iso_pu_bacteria 2935760218 2935763392 314
126 iso_pu_bacteria 2935801545 2935808231 314
127 iso_pu_bacteria 2935810662 2935816157 314
128 iso_pu_bacteria 2935827899 2935833549 314
129 iso_pu_bacteria 2935837841 2935844502 314
130 iso_pu_bacteria 2935855204 2935861380 314
131 iso_pu_bacteria 2935864058 2935869499 314
132 iso_pu_bacteria 2935873716 2935879828 314
133 iso_pu_bacteria 2935992306 2935997949 314
134 iso_pu_bacteria 2936002035 2936008786 314
135 iso_pu_bacteria 2936037263 2936041162 314
136 iso_pu_bacteria 2940556831 2940558388 314
137 iso_pu_bacteria 2941499720 2941500377 314
138 iso_pu_bacteria 2941538514 2941543325 314
139 iso_pu_bacteria 2989771324 2989771838 314
140 iso_pu_bacteria 3005409236 3005412188 314
141 iso_pu_bacteria 8005542996 8005544150 314
142 iso_pu_bacteria 8006964411 8006967564 314
143 iso_pu_bacteria 8006984368 8006991028 314
144 iso_pu_bacteria 8006994254 8007000364 314
145 iso_pu_bacteria 8017057580 8017058574 314
146 iso_pu_bacteria 8019576017 8019577086 314
147 iso_pu_bacteria 8019586578 8019595158 314
148 iso_pu_bacteria 8055742211 8055742558 314
149 iso_pu_bacteria 8056673599 8056676063 314
150 3300005985 Ga0081539_10000936 Ga0081539_1000093657 315
151 3300049576 Ga0501040_0052990 Ga0501040_0052990_1078_2037 315
152 3300053130 Ga0500642_0002033 Ga0500642_0002033_604_1569 315
153 3300053139 Ga0500568_0013858 Ga0500568_0013858_2391_3356 315
154 3300061734 Ga0530510_0053086 Ga0530510_0053086_1602_2561 315
155 iso_pu_bacteria 8001845381 8001849452 315
156 3300009177 Ga0105248_10010677 Ga0105248_100106774 316
157 3300013296 Ga0157374_10403835 Ga0157374_104038352 316
158 3300047472 Ga0495686_0164283 Ga0495686_0164283_308_1267 316
159 3300048905 Ga0496102_0000129 Ga0496102_0000129_18527_19495 316
160 3300048906 Ga0496103_0000087 Ga0496103_0000087_18525_19493 316
161 3300048909 Ga0496106_0000814 Ga0496106_0000814_8848_9807 316
162 3300048919 Ga0496116_0037137 Ga0496116_0037137_647_1606 316
163 3300048924 Ga0496121_0009250 Ga0496121_0009250_2216_3175 316
164 3300048927 Ga0496124_0131615 Ga0496124_0131615_139_1098 316
165 3300003187 JGI25151J46595_10037935 JGI25151J46595_100379352 317
166 3300005343 Ga0070687_100051146 Ga0070687_1000511461 317
167 3300005354 Ga0070675_100115296 Ga0070675_1001152963 317
168 3300006177 Ga0075362_10062593 Ga0075362_100625932 317
169 3300014325 Ga0163163_10491285 Ga0163163_104912851 317
170 3300025258 Ga0209129_1000078 Ga0209129_1000078180 317
171 3300025294 Ga0209025_1003355 Ga0209025_10033557 317
172 3300025295 Ga0209564_1000989 Ga0209564_100098920 317
173 3300025303 Ga0209051_1014572 Ga0209051_10145723 317
174 iso_pu_bacteria 2515154107 2515607992 317
175 iso_pu_bacteria 2936996657 2937000423 317
176 3300002077 JGI24744J21845_10011538 JGI24744J21845_100115383 318
177 3300003203 JGI25406J46586_10000761 JGI25406J46586_100007612 318
178 3300003320 rootH2_10170822 rootH2_101708222 318
179 3300005328 Ga0070676_10104128 Ga0070676_101041282 318
180 3300005334 Ga0068869_100049961 Ga0068869_1000499612 318
181 3300005347 Ga0070668_100171377 Ga0070668_1001713772 318
182 3300005347 Ga0070668_100266419 Ga0070668_1002664191 318
183 3300005347 Ga0070668_100326033 Ga0070668_1003260331 318
184 3300005354 Ga0070675_100249219 Ga0070675_1002492192 318
185 3300005354 Ga0070675_100251595 Ga0070675_1002515952 318
186 3300005355 Ga0070671_100044290 Ga0070671_1000442903 318
187 3300005355 Ga0070671_100200595 Ga0070671_1002005951 318
188 3300005355 Ga0070671_100304111 Ga0070671_1003041112 318
189 3300005356 Ga0070674_100020707 Ga0070674_1000207074 318
190 3300005366 Ga0070659_100088919 Ga0070659_1000889192 318
191 3300005367 Ga0070667_100117666 Ga0070667_1001176663 318
192 3300005434 Ga0070709_10065579 Ga0070709_100655792 318
193 3300005436 Ga0070713_100195172 Ga0070713_1001951722 318
194 3300005437 Ga0070710_10011483 Ga0070710_100114832 318
195 3300005441 Ga0070700_100019780 Ga0070700_1000197801 318
196 3300005455 Ga0070663_100034894 Ga0070663_1000348942 318
197 3300005455 Ga0070663_100053613 Ga0070663_1000536132 318
198 3300005455 Ga0070663_100100993 Ga0070663_1001009932 318
199 3300005468 Ga0070707_100185032 Ga0070707_1001850322 318
200 3300005536 Ga0070697_100065203 Ga0070697_1000652033 318
201 3300005539 Ga0068853_100103615 Ga0068853_1001036151 318
202 3300005543 Ga0070672_100036570 Ga0070672_1000365702 318
203 3300005544 Ga0070686_100040364 Ga0070686_1000403643 318
204 3300005544 Ga0070686_100054790 Ga0070686_1000547903 318
205 3300005547 Ga0070693_100024487 Ga0070693_1000244872 318
206 3300005548 Ga0070665_100011367 Ga0070665_1000113677 318
207 3300005548 Ga0070665_100051093 Ga0070665_1000510932 318
208 3300005548 Ga0070665_100091360 Ga0070665_1000913602 318
209 3300005548 Ga0070665_100100509 Ga0070665_1001005092 318
210 3300005548 Ga0070665_100131925 Ga0070665_1001319253 318
211 3300005548 Ga0070665_100145334 Ga0070665_1001453343 318
212 3300005564 Ga0070664_100103088 Ga0070664_1001030882 318
213 3300005616 Ga0068852_100153357 Ga0068852_1001533572 318
214 3300005718 Ga0068866_10012734 Ga0068866_100127343 318
215 3300005719 Ga0068861_100010132 Ga0068861_1000101322 318
216 3300005841 Ga0068863_100383911 Ga0068863_1003839112 318
217 3300005842 Ga0068858_100045575 Ga0068858_1000455752 318
218 3300005844 Ga0068862_100318205 Ga0068862_1003182052 318
219 3300005844 Ga0068862_100341230 Ga0068862_1003412301 318
220 3300005937 Ga0081455_10005228 Ga0081455_100052288 318
221 3300005937 Ga0081455_10112717 Ga0081455_101127172 318
222 3300005937 Ga0081455_10205854 Ga0081455_102058542 318
223 3300005983 Ga0081540_1001659 Ga0081540_10016594 318
224 3300005983 Ga0081540_1060616 Ga0081540_10606162 318
225 3300005983 Ga0081540_1105897 Ga0081540_11058971 318
226 3300005985 Ga0081539_10003778 Ga0081539_100037787 318
227 3300006038 Ga0075365_10002290 Ga0075365_100022909 318
228 3300006038 Ga0075365_10017901 Ga0075365_100179013 318
229 3300006038 Ga0075365_10049498 Ga0075365_100494983 318
230 3300006038 Ga0075365_10066612 Ga0075365_100666122 318
231 3300006048 Ga0075363_100026322 Ga0075363_1000263222 318
232 3300006048 Ga0075363_100043807 Ga0075363_1000438072 318
233 3300006173 Ga0070716_100049481 Ga0070716_1000494812 318
234 3300006177 Ga0075362_10027123 Ga0075362_100271233 318
235 3300006178 Ga0075367_10015623 Ga0075367_100156232 318
236 3300006186 Ga0075369_10054249 Ga0075369_100542492 318
237 3300006353 Ga0075370_10024056 Ga0075370_100240563 318
238 3300006844 Ga0075428_100174618 Ga0075428_1001746182 318
239 3300007076 Ga0075435_100156981 Ga0075435_1001569811 318
240 3300009094 Ga0111539_10080447 Ga0111539_100804473 318
241 3300009098 Ga0105245_10026410 Ga0105245_100264106 318
242 3300009098 Ga0105245_10109408 Ga0105245_101094082 318
243 3300009101 Ga0105247_10032747 Ga0105247_100327472 318
244 3300009101 Ga0105247_10073279 Ga0105247_100732792 318
245 3300009148 Ga0105243_10207409 Ga0105243_102074091 318
246 3300009174 Ga0105241_10038771 Ga0105241_100387713 318
247 3300009176 Ga0105242_10505745 Ga0105242_105057451 318
248 3300009177 Ga0105248_10107130 Ga0105248_101071302 318
249 3300010375 Ga0105239_10203522 Ga0105239_102035222 318
250 3300010375 Ga0105239_10237768 Ga0105239_102377683 318
251 3300011119 Ga0105246_10308043 Ga0105246_103080431 318
252 3300013296 Ga0157374_10203555 Ga0157374_102035552 318
253 3300013297 Ga0157378_10286028 Ga0157378_102860281 318
254 3300013306 Ga0163162_10373928 Ga0163162_103739281 318
255 3300013306 Ga0163162_10520769 Ga0163162_105207692 318
256 3300013308 Ga0157375_10046215 Ga0157375_100462157 318
257 3300013308 Ga0157375_10089918 Ga0157375_100899183 318
258 3300013308 Ga0157375_10139805 Ga0157375_101398052 318
259 3300014325 Ga0163163_10043550 Ga0163163_100435503 318
260 3300014325 Ga0163163_10055022 Ga0163163_100550223 318
261 3300014326 Ga0157380_10493278 Ga0157380_104932782 318
262 3300014968 Ga0157379_10292425 Ga0157379_102924252 318
263 3300014969 Ga0157376_10367195 Ga0157376_103671951 318
264 3300022740 Ga0228710_1000001 Ga0228710_1000001110 318
265 3300025297 Ga0209758_1009753 Ga0209758_10097535 318
266 3300025303 Ga0209051_1009350 Ga0209051_10093503 318
267 3300025900 Ga0207710_10024580 Ga0207710_100245803 318
268 3300025900 Ga0207710_10036224 Ga0207710_100362242 318
269 3300025901 Ga0207688_10039996 Ga0207688_100399962 318
270 3300025904 Ga0207647_10059441 Ga0207647_100594412 318
271 3300025906 Ga0207699_10067498 Ga0207699_100674982 318
272 3300025911 Ga0207654_10053635 Ga0207654_100536352 318
273 3300025915 Ga0207693_10112202 Ga0207693_101122022 318
274 3300025919 Ga0207657_10302176 Ga0207657_103021761 318
275 3300025920 Ga0207649_10317674 Ga0207649_103176741 318
276 3300025922 Ga0207646_10209209 Ga0207646_102092092 318
277 3300025927 Ga0207687_10047727 Ga0207687_100477273 318
278 3300025931 Ga0207644_10202855 Ga0207644_102028552 318
279 3300025932 Ga0207690_10192342 Ga0207690_101923422 318
280 3300025933 Ga0207706_10030134 Ga0207706_100301342 318
281 3300025933 Ga0207706_10213355 Ga0207706_102133552 318
282 3300025934 Ga0207686_10065989 Ga0207686_100659892 318
283 3300025934 Ga0207686_10217529 Ga0207686_102175291 318
284 3300025935 Ga0207709_10266871 Ga0207709_102668711 318
285 3300025937 Ga0207669_10125767 Ga0207669_101257672 318
286 3300025938 Ga0207704_10211129 Ga0207704_102111291 318
287 3300025939 Ga0207665_10138379 Ga0207665_101383792 318
288 3300025940 Ga0207691_10059179 Ga0207691_100591793 318
289 3300025942 Ga0207689_10070242 Ga0207689_100702422 318
290 3300025945 Ga0207679_10067075 Ga0207679_100670753 318
291 3300025945 Ga0207679_10123774 Ga0207679_101237743 318
292 3300025972 Ga0207668_10026096 Ga0207668_100260964 318
293 3300025972 Ga0207668_10189334 Ga0207668_101893342 318
294 3300025986 Ga0207658_10081959 Ga0207658_100819592 318
295 3300026023 Ga0207677_10072766 Ga0207677_100727663 318
296 3300026035 Ga0207703_10071432 Ga0207703_100714322 318
297 3300026067 Ga0207678_10016881 Ga0207678_100168817 318
298 3300026067 Ga0207678_10024862 Ga0207678_100248626 318
299 3300026067 Ga0207678_10080909 Ga0207678_100809092 318
300 3300026067 Ga0207678_10125828 Ga0207678_101258282 318
301 3300026067 Ga0207678_10202891 Ga0207678_102028912 318
302 3300026088 Ga0207641_10369164 Ga0207641_103691641 318
303 3300026089 Ga0207648_10178845 Ga0207648_101788452 318
304 3300026095 Ga0207676_10108106 Ga0207676_101081061 318
305 3300026118 Ga0207675_100057710 Ga0207675_1000577102 318
306 3300026118 Ga0207675_100131221 Ga0207675_1001312213 318
307 3300026118 Ga0207675_100430264 Ga0207675_1004302641 318
308 3300026121 Ga0207683_10009621 Ga0207683_100096214 318
309 3300026121 Ga0207683_10011843 Ga0207683_100118437 318
310 3300026121 Ga0207683_10071349 Ga0207683_100713492 318
311 3300027111 Ga0209281_1000164 Ga0209281_1000164119 318
312 3300027666 Ga0209282_1000007 Ga0209282_100000737 318
313 3300028379 Ga0268266_10008527 Ga0268266_100085274 318
314 3300028379 Ga0268266_10009743 Ga0268266_100097437 318
315 3300028379 Ga0268266_10012334 Ga0268266_100123347 318
316 3300028379 Ga0268266_10021491 Ga0268266_100214915 318
317 3300028379 Ga0268266_10052980 Ga0268266_100529802 318
318 3300028379 Ga0268266_10056012 Ga0268266_100560123 318
319 3300028380 Ga0268265_10327853 Ga0268265_103278532 318
320 3300028380 Ga0268265_10472181 Ga0268265_104721811 318
321 3300028381 Ga0268264_10245229 Ga0268264_102452291 318
322 3300028786 Ga0307517_10151507 Ga0307517_101515072 318
323 3300031824 Ga0307413_10141101 Ga0307413_101411011 318
324 3300031901 Ga0307406_10167007 Ga0307406_101670072 318
325 3300031903 Ga0307407_10247187 Ga0307407_102471871 318
326 3300031967 Ga0315914_1000006 Ga0315914_1000006205 318
327 3300031995 Ga0307409_100317611 Ga0307409_1003176112 318
328 3300032002 Ga0307416_100196200 Ga0307416_1001962002 318
329 3300032005 Ga0307411_10123679 Ga0307411_101236791 318
330 3300032005 Ga0307411_10165853 Ga0307411_101658532 318
331 3300033430 Ga0315913_1000002 Ga0315913_100000237 318
332 3300033464 Ga0315915_1000001 Ga0315915_1000001449 318
333 3300044683 Ga0466965_0027871 Ga0466965_0027871_608_1585 318
334 3300044901 Ga0466960_0076350 Ga0466960_0076350_111_1088 318
335 3300046471 Ga0495650_0069290 Ga0495650_0069290_63_1064 318
336 3300046472 Ga0495580_0002775 Ga0495580_0002775_11021_12058 318
337 3300046474 Ga0495605_0124657 Ga0495605_0124657_68_1024 318
338 3300046512 Ga0495610_0137694 Ga0495610_0137694_26_982 318
339 3300046513 Ga0495616_0047530 Ga0495616_0047530_64_1020 318
340 3300046513 Ga0495616_0143415 Ga0495616_0143415_18_974 318
341 3300046515 Ga0495620_0046453 Ga0495620_0046453_17_973 318
342 3300046523 Ga0495644_0057328 Ga0495644_0057328_328_1284 318
343 3300046537 Ga0495598_0006038 Ga0495598_0006038_590_1546 318
344 3300046539 Ga0495621_0023423 Ga0495621_0023423_963_1919 318
345 3300046660 Ga0495625_0185607 Ga0495625_0185607_294_1250 318
346 3300046660 Ga0495625_0205008 Ga0495625_0205008_107_1108 318
347 3300046664 Ga0495659_0015860 Ga0495659_0015860_107_1063 318
348 3300046674 Ga0495588_0009556 Ga0495588_0009556_1158_2114 318
349 3300046684 Ga0495669_0052121 Ga0495669_0052121_288_1244 318
350 3300046794 Ga0495589_0076264 Ga0495589_0076264_232_1188 318
351 3300047320 Ga0495672_0019882 Ga0495672_0019882_1504_2460 318
352 3300047320 Ga0495672_0026476 Ga0495672_0026476_794_1750 318
353 3300047320 Ga0495672_0047878 Ga0495672_0047878_335_1291 318
354 3300047320 Ga0495672_0060825 Ga0495672_0060825_558_1514 318
355 3300047469 Ga0495673_0017659 Ga0495673_0017659_2148_3104 318
356 3300047469 Ga0495673_0028371 Ga0495673_0028371_170_1126 318
357 3300047470 Ga0495681_0111082 Ga0495681_0111082_120_1121 318
358 3300048904 Ga0496101_0279022 Ga0496101_0279022_132_1088 318
359 3300048905 Ga0496102_0185963 Ga0496102_0185963_382_1338 318
360 3300048905 Ga0496102_0300650 Ga0496102_0300650_238_1194 318
361 3300048907 Ga0496104_0165279 Ga0496104_0165279_913_1869 318
362 3300048908 Ga0496105_0057584 Ga0496105_0057584_2132_3088 318
363 3300048908 Ga0496105_0296144 Ga0496105_0296144_60_1016 318
364 3300048910 Ga0496107_0264379 Ga0496107_0264379_245_1201 318
365 3300048912 Ga0496109_0014266 Ga0496109_0014266_4942_5898 318
366 3300048912 Ga0496109_0150583 Ga0496109_0150583_17_973 318
367 3300048912 Ga0496109_0335620 Ga0496109_0335620_345_1301 318
368 3300048913 Ga0496110_0066904 Ga0496110_0066904_100_1056 318
369 3300048913 Ga0496110_0074852 Ga0496110_0074852_122_1135 318
370 3300048913 Ga0496110_0103642 Ga0496110_0103642_1541_2497 318
371 3300048913 Ga0496110_0133704 Ga0496110_0133704_64_1020 318
372 3300048913 Ga0496110_0305033 Ga0496110_0305033_279_1235 318
373 3300048914 Ga0496111_0053000 Ga0496111_0053000_620_1576 318
374 3300048915 Ga0496112_0033627 Ga0496112_0033627_2267_3223 318
375 3300048915 Ga0496112_0383468 Ga0496112_0383468_177_1133 318
376 3300048916 Ga0496113_0045559 Ga0496113_0045559_2087_3043 318
377 3300048918 Ga0496115_0143396 Ga0496115_0143396_465_1421 318
378 3300048919 Ga0496116_0071271 Ga0496116_0071271_659_1615 318
379 3300048922 Ga0496119_0144690 Ga0496119_0144690_228_1184 318
380 3300048924 Ga0496121_0000839 Ga0496121_0000839_44467_45423 318
381 3300048924 Ga0496121_0015364 Ga0496121_0015364_351_1307 318
382 3300048924 Ga0496121_0059224 Ga0496121_0059224_2054_3010 318
383 3300048924 Ga0496121_0180279 Ga0496121_0180279_267_1223 318
384 3300048928 Ga0496125_0203728 Ga0496125_0203728_177_1133 318
385 3300048929 Ga0496126_0081097 Ga0496126_0081097_1436_2392 318
386 3300049572 Ga0501036_0133427 Ga0501036_0133427_157_1131 318
387 3300049579 Ga0501043_0006074 Ga0501043_0006074_5677_6723 318
388 3300049584 Ga0501068_0244453 Ga0501068_0244453_172_1128 318
389 3300050490 nmdc:mga03n38_14198_c1 nmdc:mga03n38_14198_c1_1825_2781 318
390 3300050490 nmdc:mga03n38_17806_c1 nmdc:mga03n38_17806_c1_1274_2230 318
391 3300050492 nmdc:mga0yw44_153772_c1 nmdc:mga0yw44_153772_c1_418_1374 318
392 3300050492 nmdc:mga0yw44_17815_c1 nmdc:mga0yw44_17815_c1_1559_2515 318
393 3300050492 nmdc:mga0yw44_77162_c1 nmdc:mga0yw44_77162_c1_12_968 318
394 3300050494 nmdc:mga06z11_64591_c1 nmdc:mga06z11_64591_c1_216_1172 318
395 3300050496 nmdc:mga07m45_16423_c1 nmdc:mga07m45_16423_c1_1718_2674 318
396 3300050511 nmdc:mga08y16_290701_c1 nmdc:mga08y16_290701_c1_708_1664 318
397 3300050513 nmdc:mga0rr50_431499_c1 nmdc:mga0rr50_431499_c1_68_1024 318
398 3300053096 Ga0500641_0016108 Ga0500641_0016108_1128_2084 318
399 3300053142 Ga0500577_0002365 Ga0500577_0002365_2406_3362 318
400 3300053142 Ga0500577_0013852 Ga0500577_0013852_347_1303 318
401 3300053153 Ga0500616_0112410 Ga0500616_0112410_345_1301 318
402 3300053161 Ga0500634_0024565 Ga0500634_0024565_1168_2124 318
403 iso_pu_bacteria 2512875026 2512972383 318
404 iso_pu_bacteria 2513237089 2513603462 318
405 iso_pu_bacteria 2513237156 2513985413 318
406 iso_pu_bacteria 2513237160 2514004917 318
407 iso_pu_bacteria 2517487022 2517568952 318
408 iso_pu_bacteria 2802428858 2802717595 318
409 iso_pu_bacteria 2802428859 2802723478 318
410 iso_pu_bacteria 2802428860 2802731072 318
411 iso_pu_bacteria 2802428861 2802736078 318
412 iso_pu_bacteria 2802428862 2802743711 318
413 iso_pu_bacteria 2802428863 2802750577 318
414 iso_pu_bacteria 2916061851 2916067974 318
415 iso_pu_bacteria 2937029754 2937029964 318
416 iso_pu_bacteria 2937036028 2937038042 318
417 iso_pu_bacteria 2937078374 2937083137 318
418 iso_pu_bacteria 2957375807 2957380123 318
419 iso_pu_bacteria 2957437181 2957439880 318
420 iso_pu_bacteria 2960591022 2960595474 318
421 iso_pu_bacteria 2960631154 2960633326 318
422 iso_pu_bacteria 2960680706 2960684064 318
423 iso_pu_bacteria 2960693952 2960696275 318
424 iso_pu_bacteria 2967686174 2967686317 318
425 iso_pu_bacteria 2967728569 2967730664 318
426 iso_pu_bacteria 2970026789 2970030419 318
427 iso_pu_bacteria 2970122695 2970128277 318
428 iso_pu_bacteria 2970143518 2970149045 318
429 iso_pu_bacteria 2977530762 2977533320 318
430 iso_pu_bacteria 2977544691 2977544833 318
431 iso_pu_bacteria 3005587118 3005591630 318
432 iso_pu_bacteria 8003999396 8004000084 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02574

S-methyl_trans

Homocysteine S-methyltransferase

32

326

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q8a-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+:l-hcy complex, se-met) 0.8533 14 308
3bol-assembly1.cif.gz_A cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ 0.8487 14 308
3bof-assembly1.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine 0.8388 15 308
3bol-assembly1.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ 0.8377 15 308
1q7m-assembly2.cif.gz_B cobalamin-dependent methionine synthase (meth) from thermotoga maritima (oxidized, monoclinic) 0.8345 14 308
ID Description Score Start End Superfamily
af_Q2G121_2_294_3.20.20.330 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8372 13 308 3.20.20.330
4m3pA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8211 11 308 3.20.20.330
5dmlA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8152 15 305 3.20.20.330
1q85B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8119 14 308 3.20.20.330
5dmnB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Homocysteine-binding-like domain 0.8116 15 308 3.20.20.330
ID Description Score Start End GO Terms
AF-A0A7V8HDK0-F1-model_v4 deleted 0.9914 1 232
AF-A0A069PDH5-F1-model_v4 Homocysteine methyltransferase 0.9898 1 308 GO:0008168
GO:0032259
GO:0046872
AF-A0A512N4A2-F1-model_v4 Hcy-binding domain-containing protein 0.989 159 309 GO:0008168
GO:0032259
GO:0046872
AF-A0A291P3H4-F1-model_v4 Homocysteine S-methyltransferase 0.9884 1 309 GO:0008168
GO:0032259
GO:0046872
AF-A0A815KMP1-F1-model_v4 Hcy-binding domain-containing protein 0.9878 62 310 GO:0008168
GO:0032259
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.18 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map