F442544

General Info

Members Datasets Scaffolds Average Seq Length
432 167 864 123

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_101383246|Ga0070694_1013832461
Length 140
Sequence LSASTRHRRRRPVRLRSVPKVVAVIGASNNRSKFGNRAVRAFRQQGYTVVPINPHEAEVEGLKAYASVLDVPGTVDMASLYVPPEIGVRVIEEIARKGIAEVWLNPGAESDALIARARALTIQPIVACSIVAIGENPYAF

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 18.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_101383246 3300005444 Unclassified 593
2 Ga0065712_10260629 3300005290 Bacteria 938
3 Ga0065715_10004099 3300005293 Bacteria 4789
4 Ga0065715_10956052 3300005293 Unclassified 558
5 Ga0065715_10966283 3300005293 Bacteria 555
6 Ga0065707_10373685 3300005295 Bacteria 886
7 Ga0065707_10584570 3300005295 Bacteria 700
8 Ga0065707_10597712 3300005295 Bacteria 692
9 Ga0065707_10951226 3300005295 Unclassified 552
10 Ga0070676_10000772 3300005328 Bacteria 15769
11 Ga0070676_10063587 3300005328 Bacteria 2199
12 Ga0070676_10544442 3300005328 Unclassified 830
13 Ga0070676_10608862 3300005328 Bacteria 789
14 Ga0070676_10946558 3300005328 Unclassified 644
15 Ga0070676_11463921 3300005328 Bacteria 525
16 Ga0070690_100015319 3300005330 Bacteria 4571
17 Ga0070670_100011102 3300005331 Bacteria 7695
18 Ga0070670_100320075 3300005331 Unclassified 1359
19 Ga0070670_100540853 3300005331 Bacteria 1039
20 Ga0068869_100028433 3300005334 Bacteria 3906
21 Ga0068869_100407358 3300005334 Unclassified 1120
22 Ga0070680_100175531 3300005336 Bacteria 1804
23 Ga0070680_100735323 3300005336 Unclassified 849
24 Ga0068868_100203321 3300005338 Bacteria 1652
25 Ga0068868_100805350 3300005338 Unclassified 848
26 Ga0070689_100132414 3300005340 Bacteria 2000
27 Ga0070691_10003323 3300005341 Bacteria 7216
28 Ga0070687_100039922 3300005343 Bacteria 2362
29 Ga0070687_100082971 3300005343 Bacteria 1754
30 Ga0070687_100706132 3300005343 Unclassified 705
31 Ga0070661_100305106 3300005344 Bacteria 1240
32 Ga0070692_10611016 3300005345 Bacteria 723
33 Ga0070692_11096855 3300005345 Bacteria 562
34 Ga0070668_100093197 3300005347 Bacteria 2376
35 Ga0070668_100827339 3300005347 Unclassified 824
36 Ga0070669_100011922 3300005353 Bacteria 6167
37 Ga0070669_100239955 3300005353 Bacteria 1440
38 Ga0070669_100314854 3300005353 Bacteria 1262
39 Ga0070669_101022610 3300005353 Bacteria 710
40 Ga0070675_100000134 3300005354 Bacteria 44325
41 Ga0070675_100002703 3300005354 Bacteria 13321
42 Ga0070675_100004521 3300005354 Bacteria 10620
43 Ga0070675_100010078 3300005354 Bacteria 7367
44 Ga0070675_100013460 3300005354 Bacteria 6429
45 Ga0070675_100093147 3300005354 Bacteria 2526
46 Ga0070675_101769947 3300005354 Unclassified 570
47 Ga0070671_100395081 3300005355 Bacteria 1182
48 Ga0070671_101691815 3300005355 Unclassified 561
49 Ga0070674_100115119 3300005356 Unclassified 1982
50 Ga0070674_100271409 3300005356 Bacteria 1341
51 Ga0070674_100702120 3300005356 Bacteria 865
52 Ga0070673_100038290 3300005364 Bacteria 3661
53 Ga0070673_100451104 3300005364 Bacteria 1157
54 Ga0070673_100579407 3300005364 Bacteria 1022
55 Ga0070673_100790386 3300005364 Unclassified 876
56 Ga0070688_100152885 3300005365 Bacteria 1579
57 Ga0070688_100215101 3300005365 Bacteria 1352
58 Ga0070667_101430512 3300005367 Bacteria 649
59 Ga0070667_101701867 3300005367 Unclassified 593
60 Ga0070714_100071785 3300005435 Bacteria 2995
61 Ga0070701_10029606 3300005438 Bacteria 2702
62 Ga0070701_10159400 3300005438 Bacteria 1306
63 Ga0070701_11033050 3300005438 Unclassified 575
64 Ga0070705_100161315 3300005440 Bacteria 1499
65 Ga0070705_100613172 3300005440 Unclassified 843
66 Ga0070705_100702104 3300005440 Unclassified 795
67 Ga0070700_100115552 3300005441 Bacteria 1791
68 Ga0070700_100287487 3300005441 Bacteria 1195
69 Ga0070700_100348072 3300005441 Bacteria 1098
70 Ga0070700_100351532 3300005441 Bacteria 1093
71 Ga0070694_100108561 3300005444 Bacteria 1974
72 Ga0070694_100198605 3300005444 Bacteria 1493
73 Ga0070694_100214432 3300005444 Bacteria 1441
74 Ga0070694_101063715 3300005444 Bacteria 674
75 Ga0070708_101786835 3300005445 Unclassified 571
76 Ga0070708_102201704 3300005445 Unclassified 509
77 Ga0070678_100316312 3300005456 Bacteria 1332
78 Ga0070662_100375089 3300005457 Bacteria 1170
79 Ga0070662_100475477 3300005457 Bacteria 1040
80 Ga0070662_100625686 3300005457 Bacteria 907
81 Ga0068867_100002471 3300005459 Bacteria 12999
82 Ga0068867_100077859 3300005459 Bacteria 2493
83 Ga0068867_101680600 3300005459 Bacteria 595
84 Ga0070706_100271019 3300005467 Bacteria 1584
85 Ga0070706_100675143 3300005467 Bacteria 959
86 Ga0070706_100806930 3300005467 Bacteria 869
87 Ga0070707_100225396 3300005468 Bacteria 1825
88 Ga0070698_100237049 3300005471 Bacteria 1757
89 Ga0070698_100245859 3300005471 Bacteria 1722
90 Ga0070698_100433514 3300005471 Bacteria 1249
91 Ga0070698_100584547 3300005471 Bacteria 1057
92 Ga0070699_100995075 3300005518 Bacteria 769
93 Ga0070699_101207953 3300005518 Bacteria 694
94 Ga0070699_101271942 3300005518 Unclassified 675
95 Ga0070697_100010261 3300005536 Bacteria 7299
96 Ga0070697_100525901 3300005536 Viruses 1036
97 Ga0070697_101066377 3300005536 Bacteria 719
98 Ga0070697_102089153 3300005536 Unclassified 507
99 Ga0070672_100103909 3300005543 Unclassified 2308
100 Ga0070672_100125883 3300005543 Bacteria 2102
101 Ga0070672_101064989 3300005543 Unclassified 718
102 Ga0070686_100778376 3300005544 Bacteria 769
103 Ga0070695_100016394 3300005545 Bacteria 4483
104 Ga0070695_100045021 3300005545 Bacteria 2811
105 Ga0070695_100071548 3300005545 Bacteria 2272
106 Ga0070696_100205875 3300005546 Bacteria 1471
107 Ga0070696_100433920 3300005546 Bacteria 1034
108 Ga0070696_100662132 3300005546 Unclassified 847
109 Ga0070696_100970282 3300005546 Unclassified 708
110 Ga0070693_100487929 3300005547 Bacteria 872
111 Ga0070665_100003241 3300005548 Bacteria 17488
112 Ga0070704_100006526 3300005549 Bacteria 6880
113 Ga0070704_100028176 3300005549 Bacteria 3733
114 Ga0070704_100043538 3300005549 Bacteria 3113
115 Ga0070704_100195300 3300005549 Bacteria 1630
116 Ga0070704_100571885 3300005549 Bacteria 990
117 Ga0070704_100719464 3300005549 Viruses 887
118 Ga0070664_100004179 3300005564 Bacteria 11604
119 Ga0070664_100576940 3300005564 Bacteria 1042
120 Ga0068857_101222967 3300005577 Bacteria 728
121 Ga0068854_100027196 3300005578 Bacteria 3940
122 Ga0070702_100012752 3300005615 Bacteria 4226
123 Ga0070702_101249667 3300005615 Unclassified 601
124 Ga0068852_101385923 3300005616 Bacteria 725
125 Ga0068859_100118683 3300005617 Bacteria 2711
126 Ga0068859_100162151 3300005617 Bacteria 2315
127 Ga0068859_100707802 3300005617 Bacteria 1098
128 Ga0068859_100896007 3300005617 Bacteria 972
129 Ga0068859_101166858 3300005617 Bacteria 848
130 Ga0068864_100206721 3300005618 Bacteria 1806
131 Ga0068864_100506087 3300005618 Bacteria 1163
132 Ga0068866_10031285 3300005718 Bacteria 2562
133 Ga0068866_10768834 3300005718 Unclassified 667
134 Ga0068861_100084604 3300005719 Bacteria 2490
135 Ga0068861_100161943 3300005719 Bacteria 1846
136 Ga0068861_100450249 3300005719 Unclassified 1153
137 Ga0068861_100547816 3300005719 Bacteria 1054
138 Ga0068861_100709909 3300005719 Unclassified 935
139 Ga0068861_101494574 3300005719 Bacteria 663
140 Ga0068870_10182186 3300005840 Unclassified 1262
141 Ga0068863_100841998 3300005841 Bacteria 916
142 Ga0068858_100053011 3300005842 Bacteria 3754
143 Ga0068858_100121838 3300005842 Bacteria 2439
144 Ga0068858_100135937 3300005842 Bacteria 2307
145 Ga0068858_100270268 3300005842 Bacteria 1618
146 Ga0068858_100781899 3300005842 Bacteria 931
147 Ga0068858_101571539 3300005842 Bacteria 649
148 Ga0068860_100031680 3300005843 Bacteria 5083
149 Ga0068860_100181362 3300005843 Bacteria 2035
150 Ga0068860_100308750 3300005843 Bacteria 1551
151 Ga0068862_100091363 3300005844 Bacteria 2651
152 Ga0068862_100112959 3300005844 Bacteria 2386
153 Ga0068862_100338178 3300005844 Bacteria 1394
154 Ga0068862_100393159 3300005844 Bacteria 1296
155 Ga0068862_100533218 3300005844 Bacteria 1119
156 Ga0068862_101120995 3300005844 Bacteria 783
157 Ga0068862_102065677 3300005844 Unclassified 581
158 Ga0068862_102660205 3300005844 Unclassified 512
159 Ga0097621_100103884 3300006237 Bacteria 2394
160 Ga0097621_100349306 3300006237 Unclassified 1315
161 Ga0097621_100608972 3300006237 Bacteria 999
162 Ga0068871_100480960 3300006358 Bacteria 1117
163 Ga0068871_100509066 3300006358 Unclassified 1086
164 Ga0068871_100898158 3300006358 Bacteria 821
165 Ga0075431_100027642 3300006847 Bacteria 5822
166 Ga0075433_10094811 3300006852 Bacteria 2641
167 Ga0075433_10180539 3300006852 Bacteria 1878
168 Ga0075433_10221383 3300006852 Bacteria 1681
169 Ga0075433_10484241 3300006852 Unclassified 1090
170 Ga0075433_10551277 3300006852 Bacteria 1013
171 Ga0075434_100006512 3300006871 Bacteria 10709
172 Ga0075434_100453016 3300006871 Bacteria 1304
173 Ga0075434_100456080 3300006871 Bacteria 1299
174 Ga0075434_100550042 3300006871 Bacteria 1174
175 Ga0075434_100570862 3300006871 Bacteria 1151
176 Ga0075434_100860805 3300006871 Bacteria 922
177 Ga0075434_101310961 3300006871 Bacteria 735
178 Ga0068865_100116681 3300006881 Bacteria 1978
179 Ga0068865_100146897 3300006881 Bacteria 1784
180 Ga0068865_100371654 3300006881 Bacteria 1164
181 Ga0068865_100715980 3300006881 Bacteria 857
182 Ga0068865_102176477 3300006881 Bacteria 505
183 Ga0075436_100201556 3300006914 Bacteria 1409
184 Ga0075436_100347949 3300006914 Bacteria 1068
185 Ga0075436_100733439 3300006914 Unclassified 733
186 Ga0097620_100118692 3300006931 Bacteria 2711
187 Ga0097620_100162151 3300006931 Bacteria 2315
188 Ga0097620_100707769 3300006931 Bacteria 1098
189 Ga0097620_100895998 3300006931 Bacteria 972
190 Ga0097620_101166924 3300006931 Bacteria 848
191 Ga0075435_100001872 3300007076 Bacteria 13688
192 Ga0075435_100002472 3300007076 Bacteria 12288
193 Ga0111539_10006183 3300009094 Bacteria 15445
194 Ga0111539_10180224 3300009094 Bacteria 2468
195 Ga0111539_10325037 3300009094 Bacteria 1790
196 Ga0111539_11855493 3300009094 Bacteria 699
197 Ga0105245_11180841 3300009098 Unclassified 813
198 Ga0105247_10016032 3300009101 Bacteria 4489
199 Ga0105247_10954489 3300009101 Bacteria 666
200 Ga0114129_10002338 3300009147 Bacteria 26309
201 Ga0114129_10003015 3300009147 Bacteria 23608
202 Ga0114129_10008349 3300009147 Bacteria 14765
203 Ga0114129_10011933 3300009147 Bacteria 12357
204 Ga0114129_10267176 3300009147 Bacteria 2290
205 Ga0114129_10332135 3300009147 Bacteria 2018
206 Ga0114129_10521056 3300009147 Bacteria 1550
207 Ga0114129_10720094 3300009147 Bacteria 1280
208 Ga0114129_12343899 3300009147 Bacteria 640
209 Ga0105243_10018413 3300009148 Bacteria 5290
210 Ga0105243_10040910 3300009148 Bacteria 3623
211 Ga0105243_11110617 3300009148 Unclassified 799
212 Ga0105243_11319373 3300009148 Bacteria 739
213 Ga0105243_11321441 3300009148 Bacteria 739
214 Ga0105242_10003811 3300009176 Bacteria 11728
215 Ga0105242_10275423 3300009176 Bacteria 1526
216 Ga0105242_10372413 3300009176 Bacteria 1325
217 Ga0105242_10579698 3300009176 Bacteria 1080
218 Ga0105248_10475992 3300009177 Bacteria 1408
219 Ga0105248_10497640 3300009177 Bacteria 1374
220 Ga0105248_10530983 3300009177 Unclassified 1327
221 Ga0105248_10643888 3300009177 Bacteria 1196
222 Ga0105248_10836842 3300009177 Bacteria 1039
223 Ga0105248_12188994 3300009177 Bacteria 629
224 Ga0105248_12318309 3300009177 Unclassified 611
225 Ga0105238_10009232 3300009551 Bacteria 9869
226 Ga0105249_10076304 3300009553 Bacteria 3106
227 Ga0105249_10136146 3300009553 Bacteria 2350
228 Ga0105249_10392426 3300009553 Bacteria 1416
229 Ga0105249_11001182 3300009553 Bacteria 904
230 Ga0105249_11319282 3300009553 Unclassified 793
231 Ga0105249_12374363 3300009553 Bacteria 603
232 Ga0105246_10095252 3300011119 Bacteria 2155
233 Ga0105246_10468986 3300011119 Bacteria 1062
234 Ga0157374_10775031 3300013296 Bacteria 974
235 Ga0157378_10355253 3300013297 Archaea 1433
236 Ga0163162_11186418 3300013306 Unclassified 866
237 Ga0163162_11605626 3300013306 Unclassified 742
238 Ga0157375_11716411 3300013308 Bacteria 744
239 Ga0157375_12437788 3300013308 Unclassified 624
240 Ga0157375_13280316 3300013308 Bacteria 539
241 Ga0163163_10013225 3300014325 Bacteria 7546
242 Ga0163163_10031372 3300014325 Bacteria 5128
243 Ga0157380_10007495 3300014326 Bacteria 7748
244 Ga0157380_10063926 3300014326 Bacteria 2952
245 Ga0157380_10205100 3300014326 Bacteria 1752
246 Ga0157380_10246992 3300014326 Bacteria 1613
247 Ga0157380_10268796 3300014326 Bacteria 1553
248 Ga0157380_10309954 3300014326 Bacteria 1458
249 Ga0157380_10951018 3300014326 Unclassified 889
250 Ga0157380_11489910 3300014326 Bacteria 729
251 Ga0157377_10092174 3300014745 Bacteria 1791
252 Ga0157379_10017769 3300014968 Bacteria 6265
253 Ga0157379_11206798 3300014968 Bacteria 728
254 Ga0163161_10563171 3300017792 Bacteria 935
255 Ga0163161_10719320 3300017792 Bacteria 833
256 Ga0207656_10019414 3300025321 Bacteria 2689
257 Ga0207682_10051023 3300025893 Bacteria 1712
258 Ga0207642_10036146 3300025899 Bacteria 2117
259 Ga0207642_10211369 3300025899 Bacteria 1078
260 Ga0207680_10790538 3300025903 Unclassified 680
261 Ga0207699_10003219 3300025906 Bacteria 7777
262 Ga0207645_10006143 3300025907 Bacteria 8627
263 Ga0207645_10009358 3300025907 Bacteria 6782
264 Ga0207645_10026243 3300025907 Unclassified 3765
265 Ga0207645_10550974 3300025907 Bacteria 782
266 Ga0207645_10582533 3300025907 Bacteria 759
267 Ga0207645_10776749 3300025907 Unclassified 651
268 Ga0207643_10175007 3300025908 Bacteria 1297
269 Ga0207643_10227997 3300025908 Unclassified 1142
270 Ga0207643_10383590 3300025908 Bacteria 886
271 Ga0207684_10217424 3300025910 Unclassified 1649
272 Ga0207684_10478228 3300025910 Bacteria 1068
273 Ga0207684_10928632 3300025910 Unclassified 730
274 Ga0207693_10926389 3300025915 Bacteria 668
275 Ga0207660_10662149 3300025917 Unclassified 851
276 Ga0207662_10128175 3300025918 Bacteria 1597
277 Ga0207662_10650109 3300025918 Unclassified 736
278 Ga0207646_10151441 3300025922 Bacteria 2092
279 Ga0207646_10591322 3300025922 Unclassified 996
280 Ga0207681_10045885 3300025923 Bacteria 2937
281 Ga0207681_10082634 3300025923 Bacteria 2271
282 Ga0207681_10489670 3300025923 Bacteria 1005
283 Ga0207681_10581934 3300025923 Bacteria 923
284 Ga0207694_10105278 3300025924 Bacteria 2239
285 Ga0207650_10023087 3300025925 Bacteria 4410
286 Ga0207650_11141134 3300025925 Unclassified 663
287 Ga0207659_10003405 3300025926 Bacteria 9533
288 Ga0207659_10005870 3300025926 Bacteria 7492
289 Ga0207659_10011934 3300025926 Bacteria 5503
290 Ga0207659_10021247 3300025926 Bacteria 4305
291 Ga0207664_10226592 3300025929 Bacteria 1623
292 Ga0207644_10465135 3300025931 Bacteria 1040
293 Ga0207706_10299928 3300025933 Bacteria 1400
294 Ga0207706_10381794 3300025933 Bacteria 1222
295 Ga0207686_10049431 3300025934 Bacteria 2610
296 Ga0207686_10206304 3300025934 Bacteria 1410
297 Ga0207709_10018269 3300025935 Bacteria 3925
298 Ga0207669_10078930 3300025937 Bacteria 2099
299 Ga0207669_10251089 3300025937 Bacteria 1317
300 Ga0207669_10542144 3300025937 Unclassified 937
301 Ga0207704_10182611 3300025938 Unclassified 1517
302 Ga0207704_10327150 3300025938 Bacteria 1185
303 Ga0207691_10041792 3300025940 Bacteria 4230
304 Ga0207691_10061776 3300025940 Bacteria 3403
305 Ga0207691_10062653 3300025940 Bacteria 3374
306 Ga0207691_10117284 3300025940 Bacteria 2362
307 Ga0207691_10173697 3300025940 Bacteria 1886
308 Ga0207691_10963228 3300025940 Bacteria 713
309 Ga0207711_10134013 3300025941 Bacteria 2223
310 Ga0207711_10473934 3300025941 Unclassified 1166
311 Ga0207689_10004999 3300025942 Bacteria 11942
312 Ga0207679_10037705 3300025945 Bacteria 3438
313 Ga0207679_10456875 3300025945 Bacteria 1133
314 Ga0207651_10346533 3300025960 Bacteria 1249
315 Ga0207651_10391409 3300025960 Bacteria 1180
316 Ga0207712_10075642 3300025961 Bacteria 2435
317 Ga0207668_10081944 3300025972 Bacteria 2342
318 Ga0207668_10163891 3300025972 Bacteria 1735
319 Ga0207668_10827281 3300025972 Unclassified 821
320 Ga0207640_10075431 3300025981 Bacteria 2286
321 Ga0207640_10127977 3300025981 Bacteria 1831
322 Ga0207658_10657834 3300025986 Bacteria 945
323 Ga0207677_10407515 3300026023 Bacteria 1154
324 Ga0207677_10796073 3300026023 Bacteria 846
325 Ga0207677_11416726 3300026023 Unclassified 640
326 Ga0207703_10035293 3300026035 Bacteria 3974
327 Ga0207703_10167725 3300026035 Bacteria 1928
328 Ga0207703_10419437 3300026035 Bacteria 1245
329 Ga0207703_11515332 3300026035 Bacteria 645
330 Ga0207708_10004832 3300026075 Bacteria 9928
331 Ga0207708_10056354 3300026075 Bacteria 2998
332 Ga0207708_10157195 3300026075 Bacteria 1793
333 Ga0207708_11000505 3300026075 Bacteria 726
334 Ga0207641_10806270 3300026088 Bacteria 929
335 Ga0207641_11302814 3300026088 Bacteria 727
336 Ga0207648_10000427 3300026089 Bacteria 46398
337 Ga0207648_10029767 3300026089 Bacteria 4842
338 Ga0207648_10411048 3300026089 Bacteria 1227
339 Ga0207676_10065565 3300026095 Bacteria 2892
340 Ga0207676_10468962 3300026095 Bacteria 1190
341 Ga0207676_10595011 3300026095 Bacteria 1062
342 Ga0207674_10400941 3300026116 Bacteria 1326
343 Ga0207674_11840701 3300026116 Bacteria 572
344 Ga0207675_100029356 3300026118 Bacteria 5125
345 Ga0207675_100105870 3300026118 Bacteria 2651
346 Ga0207675_100173276 3300026118 Unclassified 2063
347 Ga0207675_100239376 3300026118 Bacteria 1753
348 Ga0207675_100344818 3300026118 Bacteria 1459
349 Ga0207675_100490314 3300026118 Bacteria 1222
350 Ga0207683_10135105 3300026121 Bacteria 2220
351 Ga0207683_11502745 3300026121 Bacteria 622
352 Ga0207428_10238569 3300027907 Bacteria 1359
353 Ga0268266_10014977 3300028379 Bacteria 6656
354 Ga0268265_10050623 3300028380 Bacteria 3130
355 Ga0268265_10169218 3300028380 Bacteria 1865
356 Ga0268265_10439933 3300028380 Bacteria 1215
357 Ga0268265_11075306 3300028380 Unclassified 798
358 Ga0268264_10040918 3300028381 Bacteria 3830
359 Ga0268264_10105102 3300028381 Bacteria 2462
360 Ga0268264_10112417 3300028381 Bacteria 2388
361 Ga0268264_10290521 3300028381 Unclassified 1535
362 Ga0268264_10399415 3300028381 Unclassified 1320
363 Ga0307517_10466016 3300028786 Bacteria 651
364 Ga0265314_10022431 3300031711 Bacteria 4836
365 Ga0307416_102302584 3300032002 Bacteria 639
366 Ga0373958_0086853 3300034819 Bacteria 716
367 Ga0373947_0548401 3300035725 Unclassified 787
368 Ga0373925_0744545 3300037068 Bacteria 808
369 Ga0373925_0928399 3300037068 Bacteria 717
370 Ga0373925_1413131 3300037068 Bacteria 570
371 Ga0451577_0043391 3300042876 Bacteria 4028
372 Ga0466963_0053935 3300044694 Bacteria 2671
373 Ga0453684_0028794 3300044712 Bacteria 7910
374 Ga0453684_2072960 3300044712 Unclassified 571
375 Ga0466967_0171270 3300045976 Bacteria 2043
376 Ga0495603_0220265 3300046455 Bacteria 1095
377 Ga0495639_0263159 3300046475 Bacteria 855
378 Ga0495608_0310200 3300046511 Bacteria 976
379 Ga0495622_0295680 3300046557 Unclassified 706
380 Ga0495657_0820585 3300046675 Unclassified 531
381 Ga0495658_0052328 3300046683 Bacteria 2316
382 Ga0495658_0105500 3300046683 Bacteria 1688
383 Ga0495613_0211846 3300046689 Bacteria 1363
384 Ga0495581_0587888 3300047315 Bacteria 645
385 Ga0495674_0939579 3300047319 Bacteria 666
386 Ga0495676_0564828 3300047321 Unclassified 743
387 Ga0496104_0364244 3300048907 Bacteria 1358
388 Ga0496104_0469228 3300048907 Bacteria 1170
389 Ga0496106_1428186 3300048909 Unclassified 534
390 Ga0496112_0633083 3300048915 Bacteria 1000
391 Ga0496113_0113361 3300048916 Bacteria 2113
392 Ga0496114_0158937 3300048917 Bacteria 1964
393 Ga0496114_1142127 3300048917 Unclassified 664
394 Ga0501047_0582822 3300049581 Bacteria 941
395 Ga0501072_0759900 3300049588 Bacteria 760
396 nmdc:mga05p37_142887_c1 3300050507 Bacteria 2931
397 nmdc:mga05p37_1519075_c1 3300050507 Bacteria 665
398 nmdc:mga05p37_188067_c1 3300050507 Bacteria 2509
399 nmdc:mga05p37_28045_c1 3300050507 Bacteria 6861
400 nmdc:mga05p37_302449_c1 3300050507 Bacteria 1900
401 nmdc:mga05p37_45445_c1 3300050507 Bacteria 5401
402 nmdc:mga05p37_58555_c1 3300050507 Bacteria 4745
403 nmdc:mga05p37_59260_c1 3300050507 Bacteria 4715
404 nmdc:mga05p37_733170_c1 3300050507 Bacteria 1092
405 nmdc:mga06r32_31673_c1 3300050510 Bacteria 4968
406 nmdc:mga08y16_116221_c1 3300050511 Bacteria 2785
407 nmdc:mga08y16_1325237_c1 3300050511 Bacteria 686
408 nmdc:mga08y16_1518367_c1 3300050511 Unclassified 630
409 nmdc:mga08y16_19902_c1 3300050511 Bacteria 7079
410 nmdc:mga08y16_206757_c1 3300050511 Bacteria 1321
411 nmdc:mga0n895_174204_c1 3300050512 Bacteria 2183
412 nmdc:mga0n895_1771284_c1 3300050512 Bacteria 579
413 nmdc:mga0n895_283900_c1 3300050512 Bacteria 1679
414 nmdc:mga0n895_498391_c1 3300050512 Bacteria 1227
415 nmdc:mga0n895_666324_c1 3300050512 Bacteria 1038
416 nmdc:mga0n895_909557_c1 3300050512 Unclassified 865
417 nmdc:mga0rr50_2147_c1 3300050513 Bacteria 11026
418 nmdc:mga0rr50_48858_c1 3300050513 Bacteria 3129
419 nmdc:mga0rr50_638909_c1 3300050513 Unclassified 908
420 nmdc:mga0rr50_9851_c1 3300050513 Bacteria 6037
421 nmdc:mga08x19_300940_c1 3300050514 Bacteria 1114
422 nmdc:mga08x19_384154_c1 3300050514 Bacteria 984
423 nmdc:mga08x19_41567_c1 3300050514 Bacteria 2928
424 nmdc:mga0a205_274768_c1 3300050515 Bacteria 1561
425 nmdc:mga0a205_316535_c1 3300050515 Bacteria 1432
426 nmdc:mga0a205_349284_c1 3300050515 Bacteria 1347
427 nmdc:mga0a205_35671_c1 3300050515 Bacteria 4775
428 nmdc:mga0a205_374878_c1 3300050515 Bacteria 1289
429 nmdc:mga0a205_889189_c1 3300050515 Bacteria 738
430 Ga0495601_0686495 3300053077 Unclassified 654
431 Ga0495595_0279375 3300053084 Unclassified 838
432 Ga0590077_115868 3300059426 Bacteria 632
433 Ga0070694_101383246
434 Ga0065712_10260629
435 Ga0065715_10004099
436 Ga0065715_10956052
437 Ga0065715_10966283
438 Ga0065707_10373685
439 Ga0065707_10584570
440 Ga0065707_10597712
441 Ga0065707_10951226
442 Ga0070676_10000772
443 Ga0070676_10063587
444 Ga0070676_10544442
445 Ga0070676_10608862
446 Ga0070676_10946558
447 Ga0070676_11463921
448 Ga0070690_100015319
449 Ga0070670_100011102
450 Ga0070670_100320075
451 Ga0070670_100540853
452 Ga0068869_100028433
453 Ga0068869_100407358
454 Ga0070680_100175531
455 Ga0070680_100735323
456 Ga0068868_100203321
457 Ga0068868_100805350
458 Ga0070689_100132414
459 Ga0070691_10003323
460 Ga0070687_100039922
461 Ga0070687_100082971
462 Ga0070687_100706132
463 Ga0070661_100305106
464 Ga0070692_10611016
465 Ga0070692_11096855
466 Ga0070668_100093197
467 Ga0070668_100827339
468 Ga0070669_100011922
469 Ga0070669_100239955
470 Ga0070669_100314854
471 Ga0070669_101022610
472 Ga0070675_100000134
473 Ga0070675_100002703
474 Ga0070675_100004521
475 Ga0070675_100010078
476 Ga0070675_100013460
477 Ga0070675_100093147
478 Ga0070675_101769947
479 Ga0070671_100395081
480 Ga0070671_101691815
481 Ga0070674_100115119
482 Ga0070674_100271409
483 Ga0070674_100702120
484 Ga0070673_100038290
485 Ga0070673_100451104
486 Ga0070673_100579407
487 Ga0070673_100790386
488 Ga0070688_100152885
489 Ga0070688_100215101
490 Ga0070667_101430512
491 Ga0070667_101701867
492 Ga0070714_100071785
493 Ga0070701_10029606
494 Ga0070701_10159400
495 Ga0070701_11033050
496 Ga0070705_100161315
497 Ga0070705_100613172
498 Ga0070705_100702104
499 Ga0070700_100115552
500 Ga0070700_100287487
501 Ga0070700_100348072
502 Ga0070700_100351532
503 Ga0070694_100108561
504 Ga0070694_100198605
505 Ga0070694_100214432
506 Ga0070694_101063715
507 Ga0070708_101786835
508 Ga0070708_102201704
509 Ga0070678_100316312
510 Ga0070662_100375089
511 Ga0070662_100475477
512 Ga0070662_100625686
513 Ga0068867_100002471
514 Ga0068867_100077859
515 Ga0068867_101680600
516 Ga0070706_100271019
517 Ga0070706_100675143
518 Ga0070706_100806930
519 Ga0070707_100225396
520 Ga0070698_100237049
521 Ga0070698_100245859
522 Ga0070698_100433514
523 Ga0070698_100584547
524 Ga0070699_100995075
525 Ga0070699_101207953
526 Ga0070699_101271942
527 Ga0070697_100010261
528 Ga0070697_100525901
529 Ga0070697_101066377
530 Ga0070697_102089153
531 Ga0070672_100103909
532 Ga0070672_100125883
533 Ga0070672_101064989
534 Ga0070686_100778376
535 Ga0070695_100016394
536 Ga0070695_100045021
537 Ga0070695_100071548
538 Ga0070696_100205875
539 Ga0070696_100433920
540 Ga0070696_100662132
541 Ga0070696_100970282
542 Ga0070693_100487929
543 Ga0070665_100003241
544 Ga0070704_100006526
545 Ga0070704_100028176
546 Ga0070704_100043538
547 Ga0070704_100195300
548 Ga0070704_100571885
549 Ga0070704_100719464
550 Ga0070664_100004179
551 Ga0070664_100576940
552 Ga0068857_101222967
553 Ga0068854_100027196
554 Ga0070702_100012752
555 Ga0070702_101249667
556 Ga0068852_101385923
557 Ga0068859_100118683
558 Ga0068859_100162151
559 Ga0068859_100707802
560 Ga0068859_100896007
561 Ga0068859_101166858
562 Ga0068864_100206721
563 Ga0068864_100506087
564 Ga0068866_10031285
565 Ga0068866_10768834
566 Ga0068861_100084604
567 Ga0068861_100161943
568 Ga0068861_100450249
569 Ga0068861_100547816
570 Ga0068861_100709909
571 Ga0068861_101494574
572 Ga0068870_10182186
573 Ga0068863_100841998
574 Ga0068858_100053011
575 Ga0068858_100121838
576 Ga0068858_100135937
577 Ga0068858_100270268
578 Ga0068858_100781899
579 Ga0068858_101571539
580 Ga0068860_100031680
581 Ga0068860_100181362
582 Ga0068860_100308750
583 Ga0068862_100091363
584 Ga0068862_100112959
585 Ga0068862_100338178
586 Ga0068862_100393159
587 Ga0068862_100533218
588 Ga0068862_101120995
589 Ga0068862_102065677
590 Ga0068862_102660205
591 Ga0097621_100103884
592 Ga0097621_100349306
593 Ga0097621_100608972
594 Ga0068871_100480960
595 Ga0068871_100509066
596 Ga0068871_100898158
597 Ga0075431_100027642
598 Ga0075433_10094811
599 Ga0075433_10180539
600 Ga0075433_10221383
601 Ga0075433_10484241
602 Ga0075433_10551277
603 Ga0075434_100006512
604 Ga0075434_100453016
605 Ga0075434_100456080
606 Ga0075434_100550042
607 Ga0075434_100570862
608 Ga0075434_100860805
609 Ga0075434_101310961
610 Ga0068865_100116681
611 Ga0068865_100146897
612 Ga0068865_100371654
613 Ga0068865_100715980
614 Ga0068865_102176477
615 Ga0075436_100201556
616 Ga0075436_100347949
617 Ga0075436_100733439
618 Ga0097620_100118692
619 Ga0097620_100162151
620 Ga0097620_100707769
621 Ga0097620_100895998
622 Ga0097620_101166924
623 Ga0075435_100001872
624 Ga0075435_100002472
625 Ga0111539_10006183
626 Ga0111539_10180224
627 Ga0111539_10325037
628 Ga0111539_11855493
629 Ga0105245_11180841
630 Ga0105247_10016032
631 Ga0105247_10954489
632 Ga0114129_10002338
633 Ga0114129_10003015
634 Ga0114129_10008349
635 Ga0114129_10011933
636 Ga0114129_10267176
637 Ga0114129_10332135
638 Ga0114129_10521056
639 Ga0114129_10720094
640 Ga0114129_12343899
641 Ga0105243_10018413
642 Ga0105243_10040910
643 Ga0105243_11110617
644 Ga0105243_11319373
645 Ga0105243_11321441
646 Ga0105242_10003811
647 Ga0105242_10275423
648 Ga0105242_10372413
649 Ga0105242_10579698
650 Ga0105248_10475992
651 Ga0105248_10497640
652 Ga0105248_10530983
653 Ga0105248_10643888
654 Ga0105248_10836842
655 Ga0105248_12188994
656 Ga0105248_12318309
657 Ga0105238_10009232
658 Ga0105249_10076304
659 Ga0105249_10136146
660 Ga0105249_10392426
661 Ga0105249_11001182
662 Ga0105249_11319282
663 Ga0105249_12374363
664 Ga0105246_10095252
665 Ga0105246_10468986
666 Ga0157374_10775031
667 Ga0157378_10355253
668 Ga0163162_11186418
669 Ga0163162_11605626
670 Ga0157375_11716411
671 Ga0157375_12437788
672 Ga0157375_13280316
673 Ga0163163_10013225
674 Ga0163163_10031372
675 Ga0157380_10007495
676 Ga0157380_10063926
677 Ga0157380_10205100
678 Ga0157380_10246992
679 Ga0157380_10268796
680 Ga0157380_10309954
681 Ga0157380_10951018
682 Ga0157380_11489910
683 Ga0157377_10092174
684 Ga0157379_10017769
685 Ga0157379_11206798
686 Ga0163161_10563171
687 Ga0163161_10719320
688 Ga0207656_10019414
689 Ga0207682_10051023
690 Ga0207642_10036146
691 Ga0207642_10211369
692 Ga0207680_10790538
693 Ga0207699_10003219
694 Ga0207645_10006143
695 Ga0207645_10009358
696 Ga0207645_10026243
697 Ga0207645_10550974
698 Ga0207645_10582533
699 Ga0207645_10776749
700 Ga0207643_10175007
701 Ga0207643_10227997
702 Ga0207643_10383590
703 Ga0207684_10217424
704 Ga0207684_10478228
705 Ga0207684_10928632
706 Ga0207693_10926389
707 Ga0207660_10662149
708 Ga0207662_10128175
709 Ga0207662_10650109
710 Ga0207646_10151441
711 Ga0207646_10591322
712 Ga0207681_10045885
713 Ga0207681_10082634
714 Ga0207681_10489670
715 Ga0207681_10581934
716 Ga0207694_10105278
717 Ga0207650_10023087
718 Ga0207650_11141134
719 Ga0207659_10003405
720 Ga0207659_10005870
721 Ga0207659_10011934
722 Ga0207659_10021247
723 Ga0207664_10226592
724 Ga0207644_10465135
725 Ga0207706_10299928
726 Ga0207706_10381794
727 Ga0207686_10049431
728 Ga0207686_10206304
729 Ga0207709_10018269
730 Ga0207669_10078930
731 Ga0207669_10251089
732 Ga0207669_10542144
733 Ga0207704_10182611
734 Ga0207704_10327150
735 Ga0207691_10041792
736 Ga0207691_10061776
737 Ga0207691_10062653
738 Ga0207691_10117284
739 Ga0207691_10173697
740 Ga0207691_10963228
741 Ga0207711_10134013
742 Ga0207711_10473934
743 Ga0207689_10004999
744 Ga0207679_10037705
745 Ga0207679_10456875
746 Ga0207651_10346533
747 Ga0207651_10391409
748 Ga0207712_10075642
749 Ga0207668_10081944
750 Ga0207668_10163891
751 Ga0207668_10827281
752 Ga0207640_10075431
753 Ga0207640_10127977
754 Ga0207658_10657834
755 Ga0207677_10407515
756 Ga0207677_10796073
757 Ga0207677_11416726
758 Ga0207703_10035293
759 Ga0207703_10167725
760 Ga0207703_10419437
761 Ga0207703_11515332
762 Ga0207708_10004832
763 Ga0207708_10056354
764 Ga0207708_10157195
765 Ga0207708_11000505
766 Ga0207641_10806270
767 Ga0207641_11302814
768 Ga0207648_10000427
769 Ga0207648_10029767
770 Ga0207648_10411048
771 Ga0207676_10065565
772 Ga0207676_10468962
773 Ga0207676_10595011
774 Ga0207674_10400941
775 Ga0207674_11840701
776 Ga0207675_100029356
777 Ga0207675_100105870
778 Ga0207675_100173276
779 Ga0207675_100239376
780 Ga0207675_100344818
781 Ga0207675_100490314
782 Ga0207683_10135105
783 Ga0207683_11502745
784 Ga0207428_10238569
785 Ga0268266_10014977
786 Ga0268265_10050623
787 Ga0268265_10169218
788 Ga0268265_10439933
789 Ga0268265_11075306
790 Ga0268264_10040918
791 Ga0268264_10105102
792 Ga0268264_10112417
793 Ga0268264_10290521
794 Ga0268264_10399415
795 Ga0307517_10466016
796 Ga0265314_10022431
797 Ga0307416_102302584
798 Ga0373958_0086853
799 Ga0373947_0548401
800 Ga0373925_0744545
801 Ga0373925_0928399
802 Ga0373925_1413131
803 Ga0451577_0043391
804 Ga0466963_0053935
805 Ga0453684_0028794
806 Ga0453684_2072960
807 Ga0466967_0171270
808 Ga0495603_0220265
809 Ga0495639_0263159
810 Ga0495608_0310200
811 Ga0495622_0295680
812 Ga0495657_0820585
813 Ga0495658_0052328
814 Ga0495658_0105500
815 Ga0495613_0211846
816 Ga0495581_0587888
817 Ga0495674_0939579
818 Ga0495676_0564828
819 Ga0496104_0364244
820 Ga0496104_0469228
821 Ga0496106_1428186
822 Ga0496112_0633083
823 Ga0496113_0113361
824 Ga0496114_0158937
825 Ga0496114_1142127
826 Ga0501047_0582822
827 Ga0501072_0759900
828 nmdc:mga05p37_142887_c1
829 nmdc:mga05p37_1519075_c1
830 nmdc:mga05p37_188067_c1
831 nmdc:mga05p37_28045_c1
832 nmdc:mga05p37_302449_c1
833 nmdc:mga05p37_45445_c1
834 nmdc:mga05p37_58555_c1
835 nmdc:mga05p37_59260_c1
836 nmdc:mga05p37_733170_c1
837 nmdc:mga06r32_31673_c1
838 nmdc:mga08y16_116221_c1
839 nmdc:mga08y16_1325237_c1
840 nmdc:mga08y16_1518367_c1
841 nmdc:mga08y16_19902_c1
842 nmdc:mga08y16_206757_c1
843 nmdc:mga0n895_174204_c1
844 nmdc:mga0n895_1771284_c1
845 nmdc:mga0n895_283900_c1
846 nmdc:mga0n895_498391_c1
847 nmdc:mga0n895_666324_c1
848 nmdc:mga0n895_909557_c1
849 nmdc:mga0rr50_2147_c1
850 nmdc:mga0rr50_48858_c1
851 nmdc:mga0rr50_638909_c1
852 nmdc:mga0rr50_9851_c1
853 nmdc:mga08x19_300940_c1
854 nmdc:mga08x19_384154_c1
855 nmdc:mga08x19_41567_c1
856 nmdc:mga0a205_274768_c1
857 nmdc:mga0a205_316535_c1
858 nmdc:mga0a205_349284_c1
859 nmdc:mga0a205_35671_c1
860 nmdc:mga0a205_374878_c1
861 nmdc:mga0a205_889189_c1
862 Ga0495601_0686495
863 Ga0495595_0279375
864 Ga0590077_115868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

20

134

0.95

PF02629

CoA_binding

CoA binding domain

18

106

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9489 2 114
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9321 2 116
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9245 2 101
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9182 3 114
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9088 2 114
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9088 2 114 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8935 1 114 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8926 1 114 3.40.50.720
af_Q5A3M0_1_157_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8922 2 114 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8783 1 114 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8E4Y9-F1-model_v4 CoA-binding protein 0.997 1 109
AF-A0A2W4U2J1-F1-model_v4 CoA-binding protein 0.9937 3 120
AF-A0A7V4EKN4-F1-model_v4 CoA-binding protein 0.9934 2 120
AF-A0A7X4I2S9-F1-model_v4 CoA-binding protein 0.9921 4 120
AF-A0A5E4HRV0-F1-model_v4 Acetate--CoA ligase [ADP-forming] II subunit alpha (EC 6.2.1.13) 0.9886 4 120 GO:0043758

Map