F442541

General Info

Members Datasets Scaffolds Average Seq Length
432 234 864 264

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100156439|Ga0070713_1001564393
Length 282
Sequence MPAARDAFFAFRRAPLLSALSITTIAFSLFAVGLFGLVVLNIRQALEKIEERVEIRAFIAEKTPVEQIALAASDVAKYPEVQSVDLVTQEQALERARRELGEFKDVFEAEFLPASIDIHLKPGYRDPESVHHVADRLKALTFVDDVRFGEEWITQLYRLRNIAGVAGVALGLAFAAVAVIIIGATIRMAVLARSREISIMRLVGATDGYVRRPFLIEGFIKGVLGGALALCLTWLAIHLVGAYLNFQTIFFDQTIALIGIASGALMGFLGSAFSVGRHLRRV

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100156439 3300005436 Bacteria 2032
2 JGI25406J46586_10046731 3300003203 Bacteria 1480
3 Ga0070658_10159902 3300005327 Bacteria 1889
4 Ga0070683_100000494 3300005329 Bacteria 27838
5 Ga0070683_100020735 3300005329 Bacteria 5853
6 Ga0070683_100031400 3300005329 Bacteria 4829
7 Ga0070683_100052009 3300005329 Bacteria 3794
8 Ga0070683_100082075 3300005329 Bacteria 3019
9 Ga0070683_100093036 3300005329 Bacteria 2832
10 Ga0070683_100096422 3300005329 Bacteria 2781
11 Ga0070683_100109426 3300005329 Bacteria 2606
12 Ga0070683_100128313 3300005329 Bacteria 2399
13 Ga0070683_100129154 3300005329 Bacteria 2390
14 Ga0070690_100167678 3300005330 Bacteria 1509
15 Ga0070670_100060073 3300005331 Bacteria 3263
16 Ga0070670_100225617 3300005331 Bacteria 1630
17 Ga0068869_100001711 3300005334 Bacteria 13105
18 Ga0070666_10053928 3300005335 Bacteria 2713
19 Ga0070680_100002895 3300005336 Bacteria 12752
20 Ga0070680_100030951 3300005336 Bacteria 4300
21 Ga0070680_100039797 3300005336 Bacteria 3804
22 Ga0070680_100069424 3300005336 Bacteria 2893
23 Ga0070682_100013412 3300005337 Bacteria 4714
24 Ga0068868_100571444 3300005338 Bacteria 999
25 Ga0070660_100012945 3300005339 Bacteria 5968
26 Ga0070660_100048324 3300005339 Bacteria 3268
27 Ga0070689_100005945 3300005340 Bacteria 8397
28 Ga0070689_100128969 3300005340 Bacteria 2027
29 Ga0070691_10002300 3300005341 Bacteria 8465
30 Ga0070687_100088161 3300005343 Bacteria 1710
31 Ga0070661_100021854 3300005344 Bacteria 4576
32 Ga0070692_10061261 3300005345 Bacteria 1983
33 Ga0070675_100008403 3300005354 Bacteria 8010
34 Ga0070673_100041299 3300005364 Bacteria 3546
35 Ga0070673_100520541 3300005364 Bacteria 1078
36 Ga0070688_100024717 3300005365 Bacteria 3549
37 Ga0070688_100349536 3300005365 Bacteria 1082
38 Ga0070659_100026591 3300005366 Bacteria 4454
39 Ga0070659_100050938 3300005366 Bacteria 3255
40 Ga0070667_100036075 3300005367 Bacteria 4145
41 Ga0070709_10195292 3300005434 Bacteria 1430
42 Ga0070709_10259459 3300005434 Unclassified 1255
43 Ga0070714_100065624 3300005435 Bacteria 3127
44 Ga0070714_100493889 3300005435 Bacteria 1166
45 Ga0070713_100001297 3300005436 Bacteria 16001
46 Ga0070713_100004668 3300005436 Bacteria 9248
47 Ga0070713_100015260 3300005436 Bacteria 5734
48 Ga0070711_100028672 3300005439 Bacteria 3666
49 Ga0070711_100106386 3300005439 Bacteria 2051
50 Ga0070711_100390245 3300005439 Bacteria 1128
51 Ga0070711_100601831 3300005439 Bacteria 917
52 Ga0070708_100000916 3300005445 Bacteria 22331
53 Ga0070678_100086125 3300005456 Bacteria 2396
54 Ga0070662_100033334 3300005457 Bacteria 3626
55 Ga0070662_100537687 3300005457 Unclassified 978
56 Ga0070681_10000332 3300005458 Bacteria 38421
57 Ga0070681_10002358 3300005458 Bacteria 17245
58 Ga0070681_10016204 3300005458 Bacteria 7432
59 Ga0070681_10055630 3300005458 Bacteria 3939
60 Ga0070681_10117902 3300005458 Bacteria 2591
61 Ga0070685_10019927 3300005466 Bacteria 3626
62 Ga0070685_10252441 3300005466 Bacteria 1169
63 Ga0070698_100044776 3300005471 Bacteria 4529
64 Ga0070679_100001487 3300005530 Bacteria 20803
65 Ga0070679_100012580 3300005530 Bacteria 8091
66 Ga0070679_100056390 3300005530 Bacteria 3915
67 Ga0070679_100065877 3300005530 Bacteria 3611
68 Ga0070679_100068825 3300005530 Bacteria 3531
69 Ga0070679_100276294 3300005530 Bacteria 1633
70 Ga0070684_100000833 3300005535 Bacteria 21650
71 Ga0070684_100016271 3300005535 Bacteria 6076
72 Ga0070684_100022210 3300005535 Bacteria 5288
73 Ga0070684_100040656 3300005535 Bacteria 4005
74 Ga0070684_100091180 3300005535 Bacteria 2711
75 Ga0070684_100294009 3300005535 Bacteria 1490
76 Ga0070684_100322099 3300005535 Bacteria 1420
77 Ga0068853_100134424 3300005539 Bacteria 2216
78 Ga0070672_100149797 3300005543 Unclassified 1929
79 Ga0070672_100213958 3300005543 Bacteria 1615
80 Ga0070686_100171653 3300005544 Bacteria 1534
81 Ga0070695_100054858 3300005545 Bacteria 2567
82 Ga0070696_100003509 3300005546 Bacteria 10425
83 Ga0070693_100072750 3300005547 Bacteria 2028
84 Ga0070665_100334504 3300005548 Bacteria 1519
85 Ga0068855_100209857 3300005563 Bacteria 2189
86 Ga0068855_100333844 3300005563 Bacteria 1673
87 Ga0070664_100192996 3300005564 Bacteria 1815
88 Ga0068857_100006677 3300005577 Bacteria 9917
89 Ga0068856_100016568 3300005614 Bacteria 7133
90 Ga0070702_100000983 3300005615 Bacteria 11242
91 Ga0068852_100043168 3300005616 Bacteria 3823
92 Ga0068859_100018750 3300005617 Bacteria 6952
93 Ga0068864_100011327 3300005618 Bacteria 7370
94 Ga0068870_10008628 3300005840 Bacteria 4594
95 Ga0068863_100034383 3300005841 Bacteria 4828
96 Ga0068863_100244366 3300005841 Bacteria 1733
97 Ga0068863_100585751 3300005841 Bacteria 1103
98 Ga0068858_100086514 3300005842 Bacteria 2916
99 Ga0068860_100003352 3300005843 Bacteria 16495
100 Ga0081539_10001227 3300005985 Bacteria 45841
101 Ga0081539_10063404 3300005985 Bacteria 2017
102 Ga0070717_10012732 3300006028 Bacteria 6420
103 Ga0070717_10322651 3300006028 Bacteria 1376
104 Ga0070717_10335493 3300006028 Bacteria 1349
105 Ga0070716_100254137 3300006173 Bacteria 1199
106 Ga0070712_100013594 3300006175 Bacteria 5205
107 Ga0070712_100046019 3300006175 Bacteria 3015
108 Ga0097621_100205914 3300006237 Unclassified 1709
109 Ga0068871_100026394 3300006358 Bacteria 4532
110 Ga0068871_100096789 3300006358 Bacteria 2466
111 Ga0075431_100000803 3300006847 Bacteria 27433
112 Ga0075431_100090738 3300006847 Bacteria 3154
113 Ga0075431_100118676 3300006847 Bacteria 2729
114 Ga0075429_100033448 3300006880 Bacteria 4468
115 Ga0075429_100037162 3300006880 Bacteria 4239
116 Ga0068865_100121367 3300006881 Bacteria 1944
117 Ga0068865_100466193 3300006881 Unclassified 1047
118 Ga0097620_100018753 3300006931 Bacteria 6952
119 Ga0105245_10004293 3300009098 Bacteria 12626
120 Ga0105242_10077829 3300009176 Bacteria 2767
121 Ga0105242_10098743 3300009176 Bacteria 2470
122 Ga0105242_10528876 3300009176 Bacteria 1126
123 Ga0105248_10030561 3300009177 Bacteria 6015
124 Ga0105248_10088813 3300009177 Bacteria 3479
125 Ga0105238_10189461 3300009551 Bacteria 2033
126 Ga0105238_10203455 3300009551 Unclassified 1956
127 Ga0105239_10209656 3300010375 Bacteria 2184
128 Ga0105246_10007328 3300011119 Bacteria 6757
129 Ga0105246_10449153 3300011119 Bacteria 1083
130 Ga0157373_10013463 3300013100 Bacteria 6001
131 Ga0157370_10004719 3300013104 Bacteria 15534
132 Ga0157370_10122163 3300013104 Bacteria 2432
133 Ga0157370_10279764 3300013104 Bacteria 1542
134 Ga0157369_10007620 3300013105 Bacteria 12454
135 Ga0157369_10319295 3300013105 Bacteria 1615
136 Ga0157369_10533671 3300013105 Bacteria 1213
137 Ga0163162_10102678 3300013306 Bacteria 2953
138 Ga0157372_10002402 3300013307 Bacteria 20286
139 Ga0157372_10019468 3300013307 Bacteria 7316
140 Ga0157372_10026042 3300013307 Bacteria 6362
141 Ga0157372_10039998 3300013307 Bacteria 5178
142 Ga0157372_10048590 3300013307 Bacteria 4716
143 Ga0157372_10087217 3300013307 Bacteria 3540
144 Ga0157372_10686383 3300013307 Bacteria 1192
145 Ga0157375_10019481 3300013308 Bacteria 6172
146 Ga0157375_10127926 3300013308 Bacteria 2657
147 Ga0157375_10165446 3300013308 Bacteria 2356
148 Ga0157375_10238548 3300013308 Bacteria 1978
149 Ga0163163_10026841 3300014325 Bacteria 5509
150 Ga0163163_10143232 3300014325 Bacteria 2433
151 Ga0157377_10004903 3300014745 Bacteria 6229
152 Ga0157377_10242342 3300014745 Bacteria 1164
153 Ga0157376_10143838 3300014969 Bacteria 2143
154 Ga0213876_10076393 3300021384 Bacteria 1769
155 Ga0207692_10061216 3300025898 Bacteria 1950
156 Ga0207699_10148360 3300025906 Bacteria 1549
157 Ga0207645_10103366 3300025907 Bacteria 1839
158 Ga0207643_10228452 3300025908 Unclassified 1141
159 Ga0207705_10000356 3300025909 Bacteria 41455
160 Ga0207705_10007643 3300025909 Bacteria 7950
161 Ga0207705_10033601 3300025909 Bacteria 3665
162 Ga0207707_10003436 3300025912 Bacteria 14046
163 Ga0207707_10031952 3300025912 Bacteria 4608
164 Ga0207707_10036768 3300025912 Bacteria 4280
165 Ga0207707_10038779 3300025912 Bacteria 4164
166 Ga0207707_10046720 3300025912 Bacteria 3771
167 Ga0207707_10435617 3300025912 Unclassified 1122
168 Ga0207695_10054330 3300025913 Bacteria 4184
169 Ga0207693_10009384 3300025915 Bacteria 7980
170 Ga0207693_10029328 3300025915 Bacteria 4347
171 Ga0207693_10030502 3300025915 Bacteria 4259
172 Ga0207663_10064292 3300025916 Bacteria 2341
173 Ga0207660_10010698 3300025917 Bacteria 5963
174 Ga0207660_10202754 3300025917 Bacteria 1550
175 Ga0207662_10065373 3300025918 Bacteria 2190
176 Ga0207657_10002211 3300025919 Bacteria 21108
177 Ga0207657_10045906 3300025919 Bacteria 3830
178 Ga0207652_10000813 3300025921 Bacteria 29795
179 Ga0207652_10036669 3300025921 Bacteria 4146
180 Ga0207652_10077260 3300025921 Bacteria 2905
181 Ga0207652_10217888 3300025921 Bacteria 1720
182 Ga0207652_10248030 3300025921 Bacteria 1606
183 Ga0207646_10539400 3300025922 Bacteria 1049
184 Ga0207681_10093687 3300025923 Bacteria 2151
185 Ga0207650_10333213 3300025925 Bacteria 1245
186 Ga0207659_10239386 3300025926 Bacteria 1467
187 Ga0207687_10019763 3300025927 Bacteria 4465
188 Ga0207700_10001403 3300025928 Bacteria 13667
189 Ga0207700_10073082 3300025928 Bacteria 2647
190 Ga0207700_10081904 3300025928 Unclassified 2522
191 Ga0207700_10149089 3300025928 Bacteria 1931
192 Ga0207664_10018435 3300025929 Bacteria 5139
193 Ga0207664_10049604 3300025929 Bacteria 3306
194 Ga0207690_10023881 3300025932 Bacteria 3822
195 Ga0207690_10062533 3300025932 Bacteria 2535
196 Ga0207706_10032747 3300025933 Bacteria 4627
197 Ga0207706_10538488 3300025933 Unclassified 1006
198 Ga0207686_10107757 3300025934 Bacteria 1873
199 Ga0207670_10175882 3300025936 Bacteria 1609
200 Ga0207665_10092626 3300025939 Bacteria 2097
201 Ga0207691_10134530 3300025940 Bacteria 2182
202 Ga0207711_10076649 3300025941 Bacteria 2912
203 Ga0207711_10300135 3300025941 Bacteria 1481
204 Ga0207689_10001895 3300025942 Bacteria 19779
205 Ga0207689_10025999 3300025942 Bacteria 4902
206 Ga0207661_10002553 3300025944 Bacteria 12527
207 Ga0207661_10006292 3300025944 Bacteria 8397
208 Ga0207661_10068243 3300025944 Bacteria 2895
209 Ga0207661_10233164 3300025944 Bacteria 1631
210 Ga0207661_10326889 3300025944 Bacteria 1379
211 Ga0207661_10543579 3300025944 Bacteria 1064
212 Ga0207679_10008608 3300025945 Bacteria 6505
213 Ga0207679_10161143 3300025945 Bacteria 1837
214 Ga0207679_10267103 3300025945 Bacteria 1462
215 Ga0207667_10123552 3300025949 Bacteria 2667
216 Ga0207667_10146982 3300025949 Bacteria 2426
217 Ga0207667_10190308 3300025949 Bacteria 2105
218 Ga0207667_10457580 3300025949 Unclassified 1296
219 Ga0207668_10153505 3300025972 Bacteria 1786
220 Ga0207658_10036126 3300025986 Bacteria 3542
221 Ga0207658_10057841 3300025986 Bacteria 2883
222 Ga0207677_10203904 3300026023 Bacteria 1574
223 Ga0207703_10324214 3300026035 Bacteria 1411
224 Ga0207641_10008032 3300026088 Bacteria 8747
225 Ga0207648_10090144 3300026089 Bacteria 2679
226 Ga0207676_10083976 3300026095 Bacteria 2595
227 Ga0207674_10000595 3300026116 Bacteria 47608
228 Ga0207675_100207880 3300026118 Bacteria 1881
229 Ga0207683_10155723 3300026121 Bacteria 2064
230 Ga0207698_10035850 3300026142 Bacteria 3633
231 Ga0207698_10069749 3300026142 Bacteria 2781
232 Ga0307408_100003480 3300031548 Bacteria 10754
233 Ga0307408_100234267 3300031548 Bacteria 1505
234 Ga0265314_10008272 3300031711 Bacteria 8932
235 Ga0307405_10001080 3300031731 Bacteria 11106
236 Ga0307405_10017503 3300031731 Bacteria 3933
237 Ga0307405_10290303 3300031731 Bacteria 1236
238 Ga0307413_10002182 3300031824 Bacteria 7864
239 Ga0307413_10014274 3300031824 Bacteria 4027
240 Ga0307413_10040634 3300031824 Bacteria 2716
241 Ga0307413_10293741 3300031824 Bacteria 1229
242 Ga0307410_10002227 3300031852 Bacteria 9254
243 Ga0307410_10019285 3300031852 Bacteria 4144
244 Ga0307406_10003939 3300031901 Bacteria 8063
245 Ga0307406_10175963 3300031901 Bacteria 1553
246 Ga0307406_10199673 3300031901 Bacteria 1471
247 Ga0307406_10488704 3300031901 Unclassified 996
248 Ga0307407_10011255 3300031903 Bacteria 4250
249 Ga0307407_10013592 3300031903 Bacteria 3956
250 Ga0307407_10242545 3300031903 Unclassified 1230
251 Ga0307412_10074440 3300031911 Bacteria 2327
252 Ga0307412_10117705 3300031911 Bacteria 1908
253 Ga0307409_100001544 3300031995 Bacteria 11433
254 Ga0307409_100023846 3300031995 Bacteria 4250
255 Ga0307416_100001894 3300032002 Bacteria 11681
256 Ga0307416_100074663 3300032002 Bacteria 2834
257 Ga0307414_10012460 3300032004 Bacteria 5027
258 Ga0307411_10018370 3300032005 Bacteria 4008
259 Ga0307411_10023701 3300032005 Bacteria 3641
260 Ga0307415_100001531 3300032126 Bacteria 11097
261 Ga0307415_100062475 3300032126 Bacteria 2583
262 Ga0373926_0033330 3300035083 Bacteria 1820
263 Ga0373934_0000279 3300035086 Bacteria 18433
264 Ga0373934_0010922 3300035086 Bacteria 3414
265 Ga0373934_0016430 3300035086 Bacteria 2813
266 Ga0373944_0010465 3300035089 Bacteria 2530
267 Ga0373923_0002211 3300035111 Bacteria 5919
268 Ga0373936_0056309 3300035113 Bacteria 1598
269 Ga0373945_0004455 3300035116 Bacteria 4452
270 Ga0373953_0012366 3300035117 Bacteria 3021
271 Ga0373953_0032735 3300035117 Bacteria 2030
272 Ga0373953_0069857 3300035117 Unclassified 1447
273 Ga0373954_0036755 3300035118 Bacteria 2274
274 Ga0373954_0044025 3300035118 Bacteria 2082
275 Ga0373956_0001846 3300035119 Bacteria 8733
276 Ga0373956_0023779 3300035119 Bacteria 2633
277 Ga0373957_0010740 3300035120 Bacteria 3036
278 Ga0373957_0032194 3300035120 Bacteria 1930
279 Ga0373943_0002440 3300035170 Bacteria 8447
280 Ga0373946_0030738 3300035171 Bacteria 2146
281 Ga0373955_0011438 3300035172 Bacteria 4229
282 Ga0373955_0082989 3300035172 Bacteria 1814
283 Ga0373924_0009696 3300035410 Bacteria 3538
284 Ga0373931_0002895 3300035691 Bacteria 7655
285 Ga0373935_0035306 3300035692 Bacteria 3120
286 Ga0373927_0109935 3300035695 Bacteria 1795
287 Ga0373927_0187433 3300035695 Bacteria 1357
288 Ga0373933_0000620 3300035724 Bacteria 22190
289 Ga0373933_0036969 3300035724 Bacteria 2862
290 Ga0373947_0003856 3300035725 Bacteria 8826
291 Ga0373947_0046572 3300035725 Unclassified 2597
292 Ga0373937_0008615 3300036401 Bacteria 8858
293 Ga0373937_0038263 3300036401 Bacteria 4372
294 Ga0373925_0003502 3300037068 Bacteria 12130
295 Ga0373925_0057938 3300037068 Bacteria 2904
296 Ga0373925_0110229 3300037068 Unclassified 2125
297 Ga0436365_1076596 3300039437 Bacteria 2720
298 Ga0436365_1117812 3300039437 Bacteria 1058
299 Ga0436365_1936031 3300039437 Bacteria 4084
300 Ga0451577_0246495 3300042876 Bacteria 1617
301 Ga0466966_0051559 3300044684 Bacteria 2616
302 Ga0451576_0194875 3300045051 Bacteria 2116
303 Ga0466958_0013939 3300045836 Bacteria 4583
304 Ga0466967_0164841 3300045976 Bacteria 2082
305 Ga0495592_0058217 3300046454 Bacteria 2850
306 Ga0495603_0007665 3300046455 Bacteria 6501
307 Ga0495629_0031805 3300046459 Bacteria 3736
308 Ga0495629_0072927 3300046459 Bacteria 2397
309 Ga0495629_0109090 3300046459 Bacteria 1930
310 Ga0495651_0014378 3300046462 Bacteria 6119
311 Ga0495651_0093141 3300046462 Bacteria 2256
312 Ga0495653_0010362 3300046463 Bacteria 7624
313 Ga0495653_0085313 3300046463 Bacteria 2323
314 Ga0495580_0018511 3300046472 Bacteria 5184
315 Ga0495580_0050212 3300046472 Bacteria 2949
316 Ga0495582_0014510 3300046473 Bacteria 4329
317 Ga0495582_0137029 3300046473 Bacteria 1386
318 Ga0495639_0004002 3300046475 Bacteria 6317
319 Ga0495664_0014324 3300046477 Bacteria 4493
320 Ga0495594_0017176 3300046499 Bacteria 3820
321 Ga0495594_0071582 3300046499 Bacteria 1928
322 Ga0495608_0002844 3300046511 Bacteria 12397
323 Ga0495608_0110626 3300046511 Bacteria 1766
324 Ga0495618_0007316 3300046514 Bacteria 6681
325 Ga0495618_0101052 3300046514 Bacteria 1846
326 Ga0495628_0023539 3300046516 Bacteria 5054
327 Ga0495628_0024334 3300046516 Bacteria 4957
328 Ga0495628_0122416 3300046516 Bacteria 1994
329 Ga0495630_0012975 3300046517 Bacteria 6053
330 Ga0495630_0045454 3300046517 Bacteria 3281
331 Ga0495630_0289649 3300046517 Bacteria 1251
332 Ga0495666_0018769 3300046526 Bacteria 3436
333 Ga0495666_0127046 3300046526 Bacteria 1192
334 Ga0495652_0002803 3300046529 Bacteria 17565
335 Ga0495652_0011890 3300046529 Bacteria 7868
336 Ga0495665_0048667 3300046531 Unclassified 2247
337 Ga0495665_0058625 3300046531 Bacteria 2033
338 Ga0495665_0153422 3300046531 Bacteria 1202
339 Ga0495586_0037529 3300046535 Bacteria 2601
340 Ga0495587_0003900 3300046536 Bacteria 9896
341 Ga0495587_0005112 3300046536 Bacteria 8576
342 Ga0495587_0025324 3300046536 Bacteria 3625
343 Ga0495645_0000528 3300046543 Bacteria 26299
344 Ga0495645_0003508 3300046543 Bacteria 10615
345 Ga0495645_0059030 3300046543 Bacteria 2782
346 Ga0495667_0000621 3300046559 Bacteria 22620
347 Ga0495667_0001598 3300046559 Bacteria 15016
348 Ga0495667_0016608 3300046559 Bacteria 4971
349 Ga0495667_0346024 3300046559 Unclassified 939
350 Ga0495635_0060376 3300046663 Bacteria 2606
351 Ga0495635_0241447 3300046663 Bacteria 1219
352 Ga0495588_0019557 3300046674 Bacteria 3318
353 Ga0495657_0002079 3300046675 Bacteria 17005
354 Ga0495599_0003896 3300046678 Bacteria 8779
355 Ga0495623_0001550 3300046679 Bacteria 15511
356 Ga0495623_0032664 3300046679 Bacteria 3344
357 Ga0495646_0002768 3300046680 Bacteria 10845
358 Ga0495647_0142719 3300046681 Bacteria 1022
359 Ga0495647_0148550 3300046681 Bacteria 1003
360 Ga0495658_0015670 3300046683 Bacteria 3891
361 Ga0495658_0031263 3300046683 Bacteria 2898
362 Ga0495658_0129260 3300046683 Bacteria 1536
363 Ga0495613_0012509 3300046689 Bacteria 6307
364 Ga0495613_0030760 3300046689 Bacteria 3988
365 Ga0495600_0001713 3300046809 Bacteria 12251
366 Ga0495600_0032694 3300046809 Bacteria 3376
367 Ga0495581_0006725 3300047315 Bacteria 6667
368 Ga0495581_0027317 3300047315 Bacteria 3309
369 Ga0495581_0038858 3300047315 Bacteria 2755
370 Ga0495581_0066551 3300047315 Bacteria 2083
371 Ga0495604_0000849 3300047317 Bacteria 25522
372 Ga0495674_0020356 3300047319 Bacteria 6143
373 Ga0495674_0139528 3300047319 Unclassified 2038
374 Ga0495672_0004570 3300047320 Bacteria 11253
375 Ga0495680_0046815 3300047322 Bacteria 3407
376 Ga0495680_0152276 3300047322 Bacteria 1685
377 Ga0495675_0005533 3300047444 Bacteria 7705
378 Ga0495675_0006109 3300047444 Bacteria 7370
379 Ga0495684_0004529 3300047471 Bacteria 10856
380 Ga0495684_0005287 3300047471 Bacteria 10057
381 Ga0495684_0009200 3300047471 Bacteria 7625
382 Ga0495684_0023737 3300047471 Bacteria 4716
383 Ga0495593_0000917 3300047673 Bacteria 17127
384 Ga0495593_0137950 3300047673 Bacteria 1236
385 Ga0495602_0011287 3300048088 Bacteria 9239
386 Ga0495614_0002032 3300048089 Bacteria 8899
387 Ga0496110_0177830 3300048913 Bacteria 1932
388 Ga0496112_0000208 3300048915 Bacteria 38031
389 Ga0496113_0032592 3300048916 Bacteria 3787
390 Ga0501031_0066061 3300049568 Bacteria 2357
391 Ga0501032_0075491 3300049569 Bacteria 2245
392 Ga0501033_0032999 3300049570 Bacteria 3887
393 Ga0501034_0126307 3300049571 Bacteria 2543
394 Ga0501036_0036577 3300049572 Bacteria 4155
395 Ga0501036_0105852 3300049572 Unclassified 2379
396 Ga0501036_0331801 3300049572 Bacteria 1271
397 Ga0501038_0095663 3300049574 Bacteria 2481
398 Ga0501038_0112387 3300049574 Bacteria 2255
399 Ga0501040_0020200 3300049576 Bacteria 4438
400 Ga0501040_0050540 3300049576 Bacteria 2844
401 Ga0501043_0039724 3300049579 Bacteria 3699
402 Ga0501043_0171765 3300049579 Bacteria 1691
403 Ga0501046_0213222 3300049580 Bacteria 1432
404 Ga0501047_0040307 3300049581 Bacteria 4517
405 Ga0501047_0145796 3300049581 Bacteria 2245
406 Ga0501047_0170054 3300049581 Bacteria 2048
407 Ga0501048_0112972 3300049582 Bacteria 1918
408 Ga0501070_0059165 3300049586 Bacteria 3177
409 Ga0501070_0237320 3300049586 Bacteria 1493
410 Ga0501073_0174692 3300049589 Bacteria 1487
411 Ga0501075_0327916 3300049591 Unclassified 1166
412 Ga0501076_0059020 3300049592 Bacteria 3051
413 Ga0501079_0119854 3300049741 Unclassified 2046
414 Ga0501079_0364437 3300049741 Unclassified 1133
415 Ga0501080_0103588 3300049742 Bacteria 2639
416 Ga0501083_0267482 3300049744 Bacteria 1112
417 Ga0501035_0024856 3300049822 Bacteria 5493
418 Ga0501035_0185424 3300049822 Bacteria 1791
419 Ga0501044_0011197 3300049823 Bacteria 9727
420 Ga0501044_0428503 3300049823 Bacteria 1232
421 Ga0501045_0034587 3300049824 Bacteria 3668
422 nmdc:mga09592_37818_c1 3300050508 Bacteria 4049
423 nmdc:mga09592_56995_c1 3300050508 Bacteria 3301
424 nmdc:mga06r32_280505_c1 3300050510 Unclassified 1653
425 nmdc:mga06r32_42047_c1 3300050510 Bacteria 4344
426 nmdc:mga0rr50_244469_c1 3300050513 Bacteria 1488
427 Ga0495601_0013315 3300053077 Bacteria 4944
428 Ga0495612_0006270 3300053078 Bacteria 4900
429 Ga0495595_0084507 3300053084 Bacteria 1516
430 Ga0495619_0005136 3300053085 Bacteria 8311
431 Ga0501084_0172502 3300054114 Bacteria 1825
432 Ga0530510_0137345 3300061734 Bacteria 1800
433 Ga0070713_100156439
434 JGI25406J46586_10046731
435 Ga0070658_10159902
436 Ga0070683_100000494
437 Ga0070683_100020735
438 Ga0070683_100031400
439 Ga0070683_100052009
440 Ga0070683_100082075
441 Ga0070683_100093036
442 Ga0070683_100096422
443 Ga0070683_100109426
444 Ga0070683_100128313
445 Ga0070683_100129154
446 Ga0070690_100167678
447 Ga0070670_100060073
448 Ga0070670_100225617
449 Ga0068869_100001711
450 Ga0070666_10053928
451 Ga0070680_100002895
452 Ga0070680_100030951
453 Ga0070680_100039797
454 Ga0070680_100069424
455 Ga0070682_100013412
456 Ga0068868_100571444
457 Ga0070660_100012945
458 Ga0070660_100048324
459 Ga0070689_100005945
460 Ga0070689_100128969
461 Ga0070691_10002300
462 Ga0070687_100088161
463 Ga0070661_100021854
464 Ga0070692_10061261
465 Ga0070675_100008403
466 Ga0070673_100041299
467 Ga0070673_100520541
468 Ga0070688_100024717
469 Ga0070688_100349536
470 Ga0070659_100026591
471 Ga0070659_100050938
472 Ga0070667_100036075
473 Ga0070709_10195292
474 Ga0070709_10259459
475 Ga0070714_100065624
476 Ga0070714_100493889
477 Ga0070713_100001297
478 Ga0070713_100004668
479 Ga0070713_100015260
480 Ga0070711_100028672
481 Ga0070711_100106386
482 Ga0070711_100390245
483 Ga0070711_100601831
484 Ga0070708_100000916
485 Ga0070678_100086125
486 Ga0070662_100033334
487 Ga0070662_100537687
488 Ga0070681_10000332
489 Ga0070681_10002358
490 Ga0070681_10016204
491 Ga0070681_10055630
492 Ga0070681_10117902
493 Ga0070685_10019927
494 Ga0070685_10252441
495 Ga0070698_100044776
496 Ga0070679_100001487
497 Ga0070679_100012580
498 Ga0070679_100056390
499 Ga0070679_100065877
500 Ga0070679_100068825
501 Ga0070679_100276294
502 Ga0070684_100000833
503 Ga0070684_100016271
504 Ga0070684_100022210
505 Ga0070684_100040656
506 Ga0070684_100091180
507 Ga0070684_100294009
508 Ga0070684_100322099
509 Ga0068853_100134424
510 Ga0070672_100149797
511 Ga0070672_100213958
512 Ga0070686_100171653
513 Ga0070695_100054858
514 Ga0070696_100003509
515 Ga0070693_100072750
516 Ga0070665_100334504
517 Ga0068855_100209857
518 Ga0068855_100333844
519 Ga0070664_100192996
520 Ga0068857_100006677
521 Ga0068856_100016568
522 Ga0070702_100000983
523 Ga0068852_100043168
524 Ga0068859_100018750
525 Ga0068864_100011327
526 Ga0068870_10008628
527 Ga0068863_100034383
528 Ga0068863_100244366
529 Ga0068863_100585751
530 Ga0068858_100086514
531 Ga0068860_100003352
532 Ga0081539_10001227
533 Ga0081539_10063404
534 Ga0070717_10012732
535 Ga0070717_10322651
536 Ga0070717_10335493
537 Ga0070716_100254137
538 Ga0070712_100013594
539 Ga0070712_100046019
540 Ga0097621_100205914
541 Ga0068871_100026394
542 Ga0068871_100096789
543 Ga0075431_100000803
544 Ga0075431_100090738
545 Ga0075431_100118676
546 Ga0075429_100033448
547 Ga0075429_100037162
548 Ga0068865_100121367
549 Ga0068865_100466193
550 Ga0097620_100018753
551 Ga0105245_10004293
552 Ga0105242_10077829
553 Ga0105242_10098743
554 Ga0105242_10528876
555 Ga0105248_10030561
556 Ga0105248_10088813
557 Ga0105238_10189461
558 Ga0105238_10203455
559 Ga0105239_10209656
560 Ga0105246_10007328
561 Ga0105246_10449153
562 Ga0157373_10013463
563 Ga0157370_10004719
564 Ga0157370_10122163
565 Ga0157370_10279764
566 Ga0157369_10007620
567 Ga0157369_10319295
568 Ga0157369_10533671
569 Ga0163162_10102678
570 Ga0157372_10002402
571 Ga0157372_10019468
572 Ga0157372_10026042
573 Ga0157372_10039998
574 Ga0157372_10048590
575 Ga0157372_10087217
576 Ga0157372_10686383
577 Ga0157375_10019481
578 Ga0157375_10127926
579 Ga0157375_10165446
580 Ga0157375_10238548
581 Ga0163163_10026841
582 Ga0163163_10143232
583 Ga0157377_10004903
584 Ga0157377_10242342
585 Ga0157376_10143838
586 Ga0213876_10076393
587 Ga0207692_10061216
588 Ga0207699_10148360
589 Ga0207645_10103366
590 Ga0207643_10228452
591 Ga0207705_10000356
592 Ga0207705_10007643
593 Ga0207705_10033601
594 Ga0207707_10003436
595 Ga0207707_10031952
596 Ga0207707_10036768
597 Ga0207707_10038779
598 Ga0207707_10046720
599 Ga0207707_10435617
600 Ga0207695_10054330
601 Ga0207693_10009384
602 Ga0207693_10029328
603 Ga0207693_10030502
604 Ga0207663_10064292
605 Ga0207660_10010698
606 Ga0207660_10202754
607 Ga0207662_10065373
608 Ga0207657_10002211
609 Ga0207657_10045906
610 Ga0207652_10000813
611 Ga0207652_10036669
612 Ga0207652_10077260
613 Ga0207652_10217888
614 Ga0207652_10248030
615 Ga0207646_10539400
616 Ga0207681_10093687
617 Ga0207650_10333213
618 Ga0207659_10239386
619 Ga0207687_10019763
620 Ga0207700_10001403
621 Ga0207700_10073082
622 Ga0207700_10081904
623 Ga0207700_10149089
624 Ga0207664_10018435
625 Ga0207664_10049604
626 Ga0207690_10023881
627 Ga0207690_10062533
628 Ga0207706_10032747
629 Ga0207706_10538488
630 Ga0207686_10107757
631 Ga0207670_10175882
632 Ga0207665_10092626
633 Ga0207691_10134530
634 Ga0207711_10076649
635 Ga0207711_10300135
636 Ga0207689_10001895
637 Ga0207689_10025999
638 Ga0207661_10002553
639 Ga0207661_10006292
640 Ga0207661_10068243
641 Ga0207661_10233164
642 Ga0207661_10326889
643 Ga0207661_10543579
644 Ga0207679_10008608
645 Ga0207679_10161143
646 Ga0207679_10267103
647 Ga0207667_10123552
648 Ga0207667_10146982
649 Ga0207667_10190308
650 Ga0207667_10457580
651 Ga0207668_10153505
652 Ga0207658_10036126
653 Ga0207658_10057841
654 Ga0207677_10203904
655 Ga0207703_10324214
656 Ga0207641_10008032
657 Ga0207648_10090144
658 Ga0207676_10083976
659 Ga0207674_10000595
660 Ga0207675_100207880
661 Ga0207683_10155723
662 Ga0207698_10035850
663 Ga0207698_10069749
664 Ga0307408_100003480
665 Ga0307408_100234267
666 Ga0265314_10008272
667 Ga0307405_10001080
668 Ga0307405_10017503
669 Ga0307405_10290303
670 Ga0307413_10002182
671 Ga0307413_10014274
672 Ga0307413_10040634
673 Ga0307413_10293741
674 Ga0307410_10002227
675 Ga0307410_10019285
676 Ga0307406_10003939
677 Ga0307406_10175963
678 Ga0307406_10199673
679 Ga0307406_10488704
680 Ga0307407_10011255
681 Ga0307407_10013592
682 Ga0307407_10242545
683 Ga0307412_10074440
684 Ga0307412_10117705
685 Ga0307409_100001544
686 Ga0307409_100023846
687 Ga0307416_100001894
688 Ga0307416_100074663
689 Ga0307414_10012460
690 Ga0307411_10018370
691 Ga0307411_10023701
692 Ga0307415_100001531
693 Ga0307415_100062475
694 Ga0373926_0033330
695 Ga0373934_0000279
696 Ga0373934_0010922
697 Ga0373934_0016430
698 Ga0373944_0010465
699 Ga0373923_0002211
700 Ga0373936_0056309
701 Ga0373945_0004455
702 Ga0373953_0012366
703 Ga0373953_0032735
704 Ga0373953_0069857
705 Ga0373954_0036755
706 Ga0373954_0044025
707 Ga0373956_0001846
708 Ga0373956_0023779
709 Ga0373957_0010740
710 Ga0373957_0032194
711 Ga0373943_0002440
712 Ga0373946_0030738
713 Ga0373955_0011438
714 Ga0373955_0082989
715 Ga0373924_0009696
716 Ga0373931_0002895
717 Ga0373935_0035306
718 Ga0373927_0109935
719 Ga0373927_0187433
720 Ga0373933_0000620
721 Ga0373933_0036969
722 Ga0373947_0003856
723 Ga0373947_0046572
724 Ga0373937_0008615
725 Ga0373937_0038263
726 Ga0373925_0003502
727 Ga0373925_0057938
728 Ga0373925_0110229
729 Ga0436365_1076596
730 Ga0436365_1117812
731 Ga0436365_1936031
732 Ga0451577_0246495
733 Ga0466966_0051559
734 Ga0451576_0194875
735 Ga0466958_0013939
736 Ga0466967_0164841
737 Ga0495592_0058217
738 Ga0495603_0007665
739 Ga0495629_0031805
740 Ga0495629_0072927
741 Ga0495629_0109090
742 Ga0495651_0014378
743 Ga0495651_0093141
744 Ga0495653_0010362
745 Ga0495653_0085313
746 Ga0495580_0018511
747 Ga0495580_0050212
748 Ga0495582_0014510
749 Ga0495582_0137029
750 Ga0495639_0004002
751 Ga0495664_0014324
752 Ga0495594_0017176
753 Ga0495594_0071582
754 Ga0495608_0002844
755 Ga0495608_0110626
756 Ga0495618_0007316
757 Ga0495618_0101052
758 Ga0495628_0023539
759 Ga0495628_0024334
760 Ga0495628_0122416
761 Ga0495630_0012975
762 Ga0495630_0045454
763 Ga0495630_0289649
764 Ga0495666_0018769
765 Ga0495666_0127046
766 Ga0495652_0002803
767 Ga0495652_0011890
768 Ga0495665_0048667
769 Ga0495665_0058625
770 Ga0495665_0153422
771 Ga0495586_0037529
772 Ga0495587_0003900
773 Ga0495587_0005112
774 Ga0495587_0025324
775 Ga0495645_0000528
776 Ga0495645_0003508
777 Ga0495645_0059030
778 Ga0495667_0000621
779 Ga0495667_0001598
780 Ga0495667_0016608
781 Ga0495667_0346024
782 Ga0495635_0060376
783 Ga0495635_0241447
784 Ga0495588_0019557
785 Ga0495657_0002079
786 Ga0495599_0003896
787 Ga0495623_0001550
788 Ga0495623_0032664
789 Ga0495646_0002768
790 Ga0495647_0142719
791 Ga0495647_0148550
792 Ga0495658_0015670
793 Ga0495658_0031263
794 Ga0495658_0129260
795 Ga0495613_0012509
796 Ga0495613_0030760
797 Ga0495600_0001713
798 Ga0495600_0032694
799 Ga0495581_0006725
800 Ga0495581_0027317
801 Ga0495581_0038858
802 Ga0495581_0066551
803 Ga0495604_0000849
804 Ga0495674_0020356
805 Ga0495674_0139528
806 Ga0495672_0004570
807 Ga0495680_0046815
808 Ga0495680_0152276
809 Ga0495675_0005533
810 Ga0495675_0006109
811 Ga0495684_0004529
812 Ga0495684_0005287
813 Ga0495684_0009200
814 Ga0495684_0023737
815 Ga0495593_0000917
816 Ga0495593_0137950
817 Ga0495602_0011287
818 Ga0495614_0002032
819 Ga0496110_0177830
820 Ga0496112_0000208
821 Ga0496113_0032592
822 Ga0501031_0066061
823 Ga0501032_0075491
824 Ga0501033_0032999
825 Ga0501034_0126307
826 Ga0501036_0036577
827 Ga0501036_0105852
828 Ga0501036_0331801
829 Ga0501038_0095663
830 Ga0501038_0112387
831 Ga0501040_0020200
832 Ga0501040_0050540
833 Ga0501043_0039724
834 Ga0501043_0171765
835 Ga0501046_0213222
836 Ga0501047_0040307
837 Ga0501047_0145796
838 Ga0501047_0170054
839 Ga0501048_0112972
840 Ga0501070_0059165
841 Ga0501070_0237320
842 Ga0501073_0174692
843 Ga0501075_0327916
844 Ga0501076_0059020
845 Ga0501079_0119854
846 Ga0501079_0364437
847 Ga0501080_0103588
848 Ga0501083_0267482
849 Ga0501035_0024856
850 Ga0501035_0185424
851 Ga0501044_0011197
852 Ga0501044_0428503
853 Ga0501045_0034587
854 nmdc:mga09592_37818_c1
855 nmdc:mga09592_56995_c1
856 nmdc:mga06r32_280505_c1
857 nmdc:mga06r32_42047_c1
858 nmdc:mga0rr50_244469_c1
859 Ga0495601_0013315
860 Ga0495612_0006270
861 Ga0495595_0084507
862 Ga0495619_0005136
863 Ga0501084_0172502
864 Ga0530510_0137345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18075

FtsX_ECD

FtsX extracellular domain

53

146

0.95

PF02687

FtsX

FtsX-like permease family

168

282

0.81

Map