F442464

General Info

Members Datasets Scaffolds Average Seq Length
431 382 127 375

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0043344|Ga0496111_0043344_1767_2957
Length 396
Sequence LSGYRTDLSHSNVLKTMQALDATVLTNARIVLADQVFEGAVEITDGVITDIGTTAKRGTDLNGDYLIPGLVELHTDHLETHYAPRPKVRWHPVAAVQAHDAQIAASGITTVFDAIRVGIDEHADMGMDELRILADAITAGVNAGRLRADHLIHLRCEVSAPDCLDSFEKIMGHPLVRLASLMDHAPGQRQFASPDAYKVYYQGKLKMSDAALADFIARRSFESDTYSDRHRKALAALSAERGIALASHDDATAAHVDEAVELGIRIAEFPTTLEAAKASRDAGMAILMGGPNVVRGGSHSGNVSARDLAAAGLLDILSSDYIPFSMLQSAFCLVDEVPGISLPEAISFVTKRPADAAGLDDRGEIAVGKRADLVHLRIEEGIPIVQTVWREGRRVI

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
12 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
13 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
14 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
15 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
16 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
17 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
18 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
19 2643221580 Devosia sp. Root635 Isolate Unclassified
20 2643221591 Devosia sp. Root685 Isolate Unclassified
21 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
22 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
23 2643221674 Devosia sp. Root436 Isolate Unclassified
24 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
25 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
26 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
27 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
28 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
29 2738543024 Aminobacter sp. AP02 Isolate Unclassified
30 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
31 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
32 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
33 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
34 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
35 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
36 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
37 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
38 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
39 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
40 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
41 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
42 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
43 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
44 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
45 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
46 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
47 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
48 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
49 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
50 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
51 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
52 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
53 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
54 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
55 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
56 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
57 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
58 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
59 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
60 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
61 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
62 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
63 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
64 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
65 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
66 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
67 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
68 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
69 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
70 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
71 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
72 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
73 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
74 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
75 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
76 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
77 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
78 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
79 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
80 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
81 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
82 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
83 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
84 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
85 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
86 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
87 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
88 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
89 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
90 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
91 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
92 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
93 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
94 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
95 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
96 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
97 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
98 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
99 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
100 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
101 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
102 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
103 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
104 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
105 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
106 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
107 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
108 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
109 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
110 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
111 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
112 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
113 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
114 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
115 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
116 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
117 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
118 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
119 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
120 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
121 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
122 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
123 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
124 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
125 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
126 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
127 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
128 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
129 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
130 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
131 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
132 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
133 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
134 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
135 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
136 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
137 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
138 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
139 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
140 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
141 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
142 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
143 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
144 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
145 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
146 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
147 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
148 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
149 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
150 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
151 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
152 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
153 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
154 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
155 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
156 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
157 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
158 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
159 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
160 2932401849 Devosia sp. 2618 Isolate Rhizosphere
161 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
162 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
163 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
164 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
165 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
166 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
167 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
168 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
169 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
170 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
171 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
172 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
173 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
174 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
175 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
176 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
177 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
178 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
179 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
180 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
181 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
182 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
183 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
184 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
185 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
186 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
187 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
188 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
189 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
190 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
191 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
192 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
193 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
194 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
195 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
196 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
197 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
198 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
199 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
200 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
201 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
202 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
203 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
204 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
205 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
206 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
207 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
208 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
209 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
210 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
211 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
212 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
213 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
214 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
215 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
216 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
217 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
218 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
219 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
220 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
221 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
222 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
223 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
224 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
225 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
226 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
227 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
228 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
229 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
230 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
231 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
232 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
233 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
234 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
235 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
236 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
237 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
238 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
239 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
240 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
241 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
242 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
243 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
244 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
245 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
246 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
247 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
248 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
249 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
250 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
251 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
252 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
253 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
254 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
255 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
256 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
257 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
258 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
259 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
260 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
261 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
262 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
263 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
264 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
265 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
266 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
267 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
268 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
269 3004167301 Mesorhizobium loti 582 Isolate Unclassified
270 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
271 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
272 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
273 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
274 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
275 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
276 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
277 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
278 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
279 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
280 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
281 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
282 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
283 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
284 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
285 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
286 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
287 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
288 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
289 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
290 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
291 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
292 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
293 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
294 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
295 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
296 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
297 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
298 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
299 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
300 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
301 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
302 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
303 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
304 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
305 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
306 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
308 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
309 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
311 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
322 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
323 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
324 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
326 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
327 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
329 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
330 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
331 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
332 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
361 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
362 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
363 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
364 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
365 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
366 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
367 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
368 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
369 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
370 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
371 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
372 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
373 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
374 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
375 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
376 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
377 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
378 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
379 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
380 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
381 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
382 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 29.47
Metatranscriptomes 0
Isolates 70.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 56.38
Rhizoplane 1.86
Rhizosphere 20.42
Stem 0
Stem Tuber 0
Unclassified 14.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000470 3300002741 Bacteria 25329
2 JGI25165J46597_1000078 3300003214 Bacteria 179320
3 JGI25153J46596_10035066 3300003215 Bacteria 1630
4 rootH2_10014801 3300003320 Bacteria 13269
5 Ga0055542_1000814 3300003762 Bacteria 22783
6 Ga0070658_10061084 3300005327 Bacteria 3070
7 Ga0070660_100007853 3300005339 Bacteria 7440
8 Ga0068853_100016822 3300005539 Bacteria 6026
9 Ga0068853_100033455 3300005539 Bacteria 4362
10 Ga0070665_100007908 3300005548 Bacteria 10785
11 Ga0075365_10006939 3300006038 Bacteria 6291
12 Ga0075365_10077646 3300006038 Bacteria 2244
13 Ga0075368_10026060 3300006042 Bacteria 2247
14 Ga0075363_100084947 3300006048 Bacteria 1736
15 Ga0075364_10000250 3300006051 Bacteria 25876
16 Ga0075362_10021777 3300006177 Bacteria 2695
17 Ga0075367_10005833 3300006178 Bacteria 6169
18 Ga0075369_10025308 3300006186 Bacteria 2466
19 Ga0075366_10090592 3300006195 Bacteria 1832
20 Ga0105240_10183042 3300009093 Bacteria 2471
21 Ga0105245_10158155 3300009098 Bacteria 2148
22 Ga0105237_10000659 3300009545 Bacteria 47952
23 Ga0105237_10071506 3300009545 Bacteria 3464
24 Ga0105237_10079424 3300009545 Bacteria 3271
25 Ga0105239_10005061 3300010375 Bacteria 15575
26 Ga0105239_10036429 3300010375 Bacteria 5402
27 Ga0105239_10047486 3300010375 Bacteria 4705
28 Ga0157369_10110646 3300013105 Bacteria 2920
29 Ga0182008_10046599 3300014497 Bacteria 2155
30 Ga0207427_102561 3300025231 Bacteria 4744
31 Ga0209026_1000151 3300025250 Bacteria 110338
32 Ga0209148_1000032 3300025254 Bacteria 557660
33 Ga0209759_1001606 3300025256 Bacteria 12128
34 Ga0209233_1000150 3300025261 Bacteria 179401
35 Ga0209455_1000085 3300025272 Bacteria 247601
36 Ga0209758_1007647 3300025297 Bacteria 7286
37 Ga0207647_10014851 3300025904 Bacteria 5356
38 Ga0207705_10020839 3300025909 Bacteria 4679
39 Ga0207705_10027861 3300025909 Bacteria 4029
40 Ga0207671_10000249 3300025914 Bacteria 80726
41 Ga0207671_10001797 3300025914 Bacteria 23996
42 Ga0207671_10180301 3300025914 Bacteria 1643
43 Ga0207657_10011666 3300025919 Bacteria 8710
44 Ga0207694_10010439 3300025924 Bacteria 7003
45 Ga0207694_10075414 3300025924 Bacteria 2640
46 Ga0207668_10030711 3300025972 Bacteria 3533
47 Ga0207658_10367018 3300025986 Bacteria 1258
48 Ga0207639_10080509 3300026041 Bacteria 2577
49 Ga0207702_10066262 3300026078 Bacteria 3095
50 Ga0207702_10087823 3300026078 Bacteria 2715
51 Ga0268266_10001081 3300028379 Bacteria 34140
52 Ga0268266_10002646 3300028379 Bacteria 18866
53 Ga0268266_10068636 3300028379 Bacteria 3070
54 Ga0265319_1025295 3300028563 Bacteria 2127
55 Ga0265314_10026898 3300031711 Bacteria 4316
56 Ga0307516_10028492 3300031730 Bacteria 5651
57 Ga0373925_0213157 3300037068 Bacteria 1539
58 Ga0395900_0019989 3300037418 Bacteria 6827
59 Ga0395900_0020211 3300037418 Bacteria 6795
60 Ga0395900_0076492 3300037418 Bacteria 3440
61 Ga0395898_0122152 3300037466 Bacteria 2495
62 Ga0395905_0050087 3300037471 Bacteria 3914
63 Ga0395905_0277953 3300037471 Bacteria 1560
64 Ga0395901_0129028 3300038443 Bacteria 2657
65 Ga0395901_0230145 3300038443 Bacteria 1935
66 Ga0451837_0657232 3300041494 Bacteria 1291
67 Ga0451837_1070693 3300041494 Bacteria 1174
68 Ga0466968_0022641 3300044735 Bacteria 2555
69 Ga0466960_0074425 3300044901 Bacteria 1697
70 Ga0495625_0017912 3300046660 Bacteria 5536
71 Ga0495681_0108246 3300047470 Bacteria 1207
72 Ga0496111_0043344 3300048914 Bacteria 3234
73 Ga0496111_0127233 3300048914 Bacteria 1884
74 Ga0496112_0028198 3300048915 Bacteria 5417
75 Ga0496112_0101170 3300048915 Bacteria 2852
76 Ga0496119_0039781 3300048922 Bacteria 3019
77 Ga0496120_0000724 3300048923 Bacteria 48314
78 Ga0496121_0000426 3300048924 Bacteria 82870
79 Ga0496121_0001611 3300048924 Bacteria 37466
80 Ga0496121_0096744 3300048924 Bacteria 2290
81 Ga0496121_0171526 3300048924 Bacteria 1575
82 Ga0496124_0026099 3300048927 Bacteria 5274
83 Ga0496124_0112838 3300048927 Bacteria 2185
84 Ga0496124_0154537 3300048927 Bacteria 1796
85 Ga0496125_0000306 3300048928 Bacteria 96360
86 Ga0496125_0005934 3300048928 Bacteria 13383
87 Ga0496125_0030574 3300048928 Bacteria 4815
88 Ga0496125_0039092 3300048928 Bacteria 4093
89 Ga0501031_0006762 3300049568 Bacteria 7480
90 Ga0501032_0000520 3300049569 Bacteria 31263
91 Ga0501033_0000192 3300049570 Bacteria 58682
92 Ga0501033_0020580 3300049570 Bacteria 4986
93 Ga0501034_0002321 3300049571 Bacteria 23230
94 Ga0501034_0013160 3300049571 Bacteria 8523
95 Ga0501034_0024120 3300049571 Bacteria 6187
96 Ga0501034_0073993 3300049571 Bacteria 3415
97 Ga0501036_0000152 3300049572 Bacteria 45346
98 Ga0501037_0000029 3300049573 Bacteria 139680
99 Ga0501037_0048152 3300049573 Bacteria 3124
100 Ga0501038_0000263 3300049574 Bacteria 44382
101 Ga0501038_0026484 3300049574 Bacteria 5164
102 Ga0501039_0000043 3300049575 Bacteria 109462
103 Ga0501042_0384256 3300049578 Bacteria 1017
104 Ga0501043_0000260 3300049579 Bacteria 48057
105 Ga0501046_0013346 3300049580 Bacteria 6960
106 Ga0501047_0056827 3300049581 Bacteria 3785
107 Ga0501047_0179273 3300049581 Bacteria 1985
108 Ga0501035_0000057 3300049822 Bacteria 135297
109 Ga0501035_0006585 3300049822 Bacteria 10880
110 Ga0501035_0009258 3300049822 Bacteria 9156
111 Ga0501035_0011233 3300049822 Bacteria 8295
112 Ga0501044_0009678 3300049823 Bacteria 10484
113 Ga0501044_0020839 3300049823 Bacteria 6998
114 Ga0501044_0084416 3300049823 Bacteria 3210
115 Ga0501044_0348400 3300049823 Bacteria 1401
116 nmdc:mga00v17_12836_c1 3300050491 Bacteria 4633
117 nmdc:mga00v17_402_c1 3300050491 Bacteria 23341
118 nmdc:mga0yw44_82148_c1 3300050492 Bacteria 2021
119 nmdc:mga06z11_26612_c1 3300050494 Bacteria 2754
120 Ga0495655_0006073 3300053083 Bacteria 2173
121 Ga0500643_012971 3300053087 Bacteria 2965
122 Ga0500604_0000139 3300053151 Bacteria 21618
123 Ga0500604_0000735 3300053151 Bacteria 8985
124 Ga0500620_000073 3300053155 Bacteria 19157
125 Ga0500627_0010821 3300053158 Bacteria 3341
126 Ga0500627_0047753 3300053158 Bacteria 1858
127 Ga0500634_0000009 3300053161 Bacteria 144333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_1070693 Ga0451837_1070693_14_961 311
2 3300049578 Ga0501042_0384256 Ga0501042_0384256_54_995 312
3 iso_pu_bacteria 8004395343 8004402127 320
4 3300048927 Ga0496124_0154537 Ga0496124_0154537_14_994 326
5 3300037068 Ga0373925_0213157 Ga0373925_0213157_17_1009 330
6 3300013105 Ga0157369_10110646 Ga0157369_101106462 332
7 3300037418 Ga0395900_0019989 Ga0395900_0019989_2695_3834 332
8 3300037466 Ga0395898_0122152 Ga0395898_0122152_176_1315 332
9 3300038443 Ga0395901_0129028 Ga0395901_0129028_303_1442 332
10 3300041494 Ga0451837_0657232 Ga0451837_0657232_11_1021 336
11 iso_pu_bacteria 2878730984 2878731846 338
12 iso_pu_bacteria 2968138860 2968143977 343
13 3300049571 Ga0501034_0013160 Ga0501034_0013160_5529_6668 352
14 3300049581 Ga0501047_0179273 Ga0501047_0179273_783_1922 352
15 3300009098 Ga0105245_10158155 Ga0105245_101581551 354
16 3300048928 Ga0496125_0030574 Ga0496125_0030574_553_1683 355
17 3300037418 Ga0395900_0076492 Ga0395900_0076492_736_1887 360
18 3300053151 Ga0500604_0000735 Ga0500604_0000735_1709_2857 361
19 3300006186 Ga0075369_10025308 Ga0075369_100253082 364
20 3300005539 Ga0068853_100033455 Ga0068853_1000334553 365
21 3300026041 Ga0207639_10080509 Ga0207639_100805092 365
22 iso_pu_bacteria 2837678835 2837680515 373
23 iso_pu_bacteria 2939669807 2939670145 373
24 3300003762 Ga0055542_1000814 Ga0055542_10008145 374
25 3300025254 Ga0209148_1000032 Ga0209148_1000032505 374
26 3300025272 Ga0209455_1000085 Ga0209455_1000085167 374
27 iso_pu_bacteria 2599185156 2599332586 374
28 iso_pu_bacteria 2643221580 2643912056 374
29 iso_pu_bacteria 2643221591 2643966087 374
30 iso_pu_bacteria 2643221674 2644412770 374
31 iso_pu_bacteria 2671180139 2671694637 374
32 iso_pu_bacteria 2738543024 2739307386 374
33 iso_pu_bacteria 2837678835 2837681509 374
34 iso_pu_bacteria 2842922631 2842922859 374
35 iso_pu_bacteria 2894232714 2894234796 374
36 iso_pu_bacteria 2996336353 2996341527 374
37 iso_pu_bacteria 3002141150 3002144548 374
38 iso_pu_bacteria 8002285264 8002289478 374
39 iso_pu_bacteria 8045864390 8045867574 374
40 iso_pu_bacteria 8054460903 8054464689 374
41 3300048928 Ga0496125_0039092 Ga0496125_0039092_483_1613 375
42 3300053151 Ga0500604_0000139 Ga0500604_0000139_5968_7098 375
43 iso_pu_bacteria 2503198000 2503198494 375
44 iso_pu_bacteria 2508501123 2509114015 375
45 iso_pu_bacteria 2508501127 2509140764 375
46 iso_pu_bacteria 2509276018 2509368561 375
47 iso_pu_bacteria 2509276022 2509393516 375
48 iso_pu_bacteria 2510065059 2510314841 375
49 iso_pu_bacteria 2511231027 2511389648 375
50 iso_pu_bacteria 2512875016 2512934041 375
51 iso_pu_bacteria 2512875024 2512962331 375
52 iso_pu_bacteria 2513237090 2513610678 375
53 iso_pu_bacteria 2513237164 2514038709 375
54 iso_pu_bacteria 2513237305 2514418252 375
55 iso_pu_bacteria 2513237351 2514586361 375
56 iso_pu_bacteria 2588253730 2588520182 375
57 iso_pu_bacteria 2597489875 2597810376 375
58 iso_pu_bacteria 2599185301 2599935279 375
59 iso_pu_bacteria 2643221591 2643964823 375
60 iso_pu_bacteria 2643221595 2643983760 375
61 iso_pu_bacteria 2643221627 2644155893 375
62 iso_pu_bacteria 2687453392 2688595815 375
63 iso_pu_bacteria 2693429783 2694627995 375
64 iso_pu_bacteria 2693429784 2694641148 375
65 iso_pu_bacteria 2721755686 2723573039 375
66 iso_pu_bacteria 2756170246 2756674889 375
67 iso_pu_bacteria 2765235802 2765464839 375
68 iso_pu_bacteria 2767802442 2770195236 375
69 iso_pu_bacteria 2791355123 2792747004 375
70 iso_pu_bacteria 2839993093 2839994760 375
71 iso_pu_bacteria 2840764183 2840767620 375
72 iso_pu_bacteria 2841734538 2841736236 375
73 iso_pu_bacteria 2842871566 2842871743 375
74 iso_pu_bacteria 2844002411 2844003634 375
75 iso_pu_bacteria 2844009547 2844010623 375
76 iso_pu_bacteria 2847670302 2847673343 375
77 iso_pu_bacteria 2847686936 2847689854 375
78 iso_pu_bacteria 2856314179 2856319188 375
79 iso_pu_bacteria 2856320880 2856322242 375
80 iso_pu_bacteria 2856328259 2856332699 375
81 iso_pu_bacteria 2856334872 2856340686 375
82 iso_pu_bacteria 2856342000 2856342928 375
83 iso_pu_bacteria 2856349417 2856353130 375
84 iso_pu_bacteria 2856356410 2856359443 375
85 iso_pu_bacteria 2856364286 2856369995 375
86 iso_pu_bacteria 2857349434 2857352811 375
87 iso_pu_bacteria 2857367948 2857370201 375
88 iso_pu_bacteria 2869162929 2869165357 375
89 iso_pu_bacteria 2869169390 2869172477 375
90 iso_pu_bacteria 2869234852 2869239574 375
91 iso_pu_bacteria 2869242130 2869245176 375
92 iso_pu_bacteria 2869249662 2869255870 375
93 iso_pu_bacteria 2869256925 2869257105 375
94 iso_pu_bacteria 2869264136 2869264905 375
95 iso_pu_bacteria 2869271264 2869271388 375
96 iso_pu_bacteria 2869278585 2869284662 375
97 iso_pu_bacteria 2869285874 2869290802 375
98 iso_pu_bacteria 2871429161 2871433084 375
99 iso_pu_bacteria 2871435913 2871439123 375
100 iso_pu_bacteria 2871451962 2871452171 375
101 iso_pu_bacteria 2871459585 2871466006 375
102 iso_pu_bacteria 2871466892 2871469375 375
103 iso_pu_bacteria 2871474448 2871481265 375
104 iso_pu_bacteria 2871481445 2871484029 375
105 iso_pu_bacteria 2871488783 2871489635 375
106 iso_pu_bacteria 2871495908 2871502282 375
107 iso_pu_bacteria 2874102143 2874108430 375
108 iso_pu_bacteria 2874109183 2874116096 375
109 iso_pu_bacteria 2874116593 2874122118 375
110 iso_pu_bacteria 2874123672 2874124222 375
111 iso_pu_bacteria 2874131515 2874138675 375
112 iso_pu_bacteria 2874139085 2874143018 375
113 iso_pu_bacteria 2874146452 2874153755 375
114 iso_pu_bacteria 2874155637 2874161020 375
115 iso_pu_bacteria 2874162495 2874168321 375
116 iso_pu_bacteria 2874168670 2874172228 375
117 iso_pu_bacteria 2876363079 2876363701 375
118 iso_pu_bacteria 2876369609 2876376384 375
119 iso_pu_bacteria 2876377896 2876381961 375
120 iso_pu_bacteria 2876386047 2876386064 375
121 iso_pu_bacteria 2876392853 2876397152 375
122 iso_pu_bacteria 2876399893 2876403773 375
123 iso_pu_bacteria 2876413966 2876419060 375
124 iso_pu_bacteria 2876420981 2876426400 375
125 iso_pu_bacteria 2878035449 2878039577 375
126 iso_pu_bacteria 2878738818 2878740914 375
127 iso_pu_bacteria 2878745973 2878750697 375
128 iso_pu_bacteria 2878753008 2878754329 375
129 iso_pu_bacteria 2878760144 2878766173 375
130 iso_pu_bacteria 2878767105 2878773374 375
131 iso_pu_bacteria 2878774303 2878778230 375
132 iso_pu_bacteria 2878781027 2878784087 375
133 iso_pu_bacteria 2881147464 2881148078 375
134 iso_pu_bacteria 2881155292 2881159173 375
135 iso_pu_bacteria 2881161766 2881164870 375
136 iso_pu_bacteria 2881845957 2881851378 375
137 iso_pu_bacteria 2881853255 2881859628 375
138 iso_pu_bacteria 2881861095 2881862321 375
139 iso_pu_bacteria 2882632389 2882634597 375
140 iso_pu_bacteria 2882912400 2882913245 375
141 iso_pu_bacteria 2885305155 2885306744 375
142 iso_pu_bacteria 2885312484 2885314299 375
143 iso_pu_bacteria 2885318864 2885323627 375
144 iso_pu_bacteria 2885342637 2885344588 375
145 iso_pu_bacteria 2885350715 2885355682 375
146 iso_pu_bacteria 2888337043 2888343287 375
147 iso_pu_bacteria 2888343758 2888344196 375
148 iso_pu_bacteria 2888350351 2888353042 375
149 iso_pu_bacteria 2889010040 2889014786 375
150 iso_pu_bacteria 2889016732 2889020128 375
151 iso_pu_bacteria 2889790730 2889795891 375
152 iso_pu_bacteria 2889914905 2889917733 375
153 iso_pu_bacteria 2894652903 2894656195 375
154 iso_pu_bacteria 2903448605 2903454214 375
155 iso_pu_bacteria 2903492973 2903496304 375
156 iso_pu_bacteria 2903492973 2903497356 375
157 iso_pu_bacteria 2903513507 2903515515 375
158 iso_pu_bacteria 2903521522 2903523238 375
159 iso_pu_bacteria 2903528002 2903529277 375
160 iso_pu_bacteria 2903540706 2903547219 375
161 iso_pu_bacteria 2904578770 2904580829 375
162 iso_pu_bacteria 2904659560 2904663906 375
163 iso_pu_bacteria 2906308376 2906313622 375
164 iso_pu_bacteria 2906321335 2906326331 375
165 iso_pu_bacteria 2906328253 2906334284 375
166 iso_pu_bacteria 2906354277 2906356839 375
167 iso_pu_bacteria 2906363423 2906369742 375
168 iso_pu_bacteria 2906370794 2906372850 375
169 iso_pu_bacteria 2906378014 2906383993 375
170 iso_pu_bacteria 2906386501 2906389541 375
171 iso_pu_bacteria 2906393657 2906397615 375
172 iso_pu_bacteria 2906401398 2906407718 375
173 iso_pu_bacteria 2906408224 2906409242 375
174 iso_pu_bacteria 2906414383 2906419260 375
175 iso_pu_bacteria 2906427513 2906432620 375
176 iso_pu_bacteria 2917554339 2917558387 375
177 iso_pu_bacteria 2919119836 2919121457 375
178 iso_pu_bacteria 2922130491 2922136545 375
179 iso_pu_bacteria 2922151315 2922155284 375
180 iso_pu_bacteria 2922172374 2922174373 375
181 iso_pu_bacteria 2922178524 2922185633 375
182 iso_pu_bacteria 2922185730 2922192854 375
183 iso_pu_bacteria 2924718760 2924721582 375
184 iso_pu_bacteria 2924726620 2924728911 375
185 iso_pu_bacteria 2924733363 2924736495 375
186 iso_pu_bacteria 2924741084 2924741486 375
187 iso_pu_bacteria 2924748358 2924748617 375
188 iso_pu_bacteria 2924754689 2924758979 375
189 iso_pu_bacteria 2924762789 2924765622 375
190 iso_pu_bacteria 2924776078 2924778515 375
191 iso_pu_bacteria 2924784321 2924788678 375
192 iso_pu_bacteria 2928521798 2928523679 375
193 iso_pu_bacteria 2937813078 2937820073 375
194 iso_pu_bacteria 2937822353 2937826485 375
195 iso_pu_bacteria 2937836603 2937840606 375
196 iso_pu_bacteria 2937848649 2937849556 375
197 iso_pu_bacteria 2937861824 2937868342 375
198 iso_pu_bacteria 2937868953 2937873456 375
199 iso_pu_bacteria 2937877337 2937878851 375
200 iso_pu_bacteria 2937891427 2937897380 375
201 iso_pu_bacteria 2937972304 2937979968 375
202 iso_pu_bacteria 2937980651 2937985366 375
203 iso_pu_bacteria 2937994558 2938001082 375
204 iso_pu_bacteria 2938014810 2938022417 375
205 iso_pu_bacteria 2954011201 2954015962 375
206 iso_pu_bacteria 2958034702 2958041482 375
207 iso_pu_bacteria 2958041894 2958042457 375
208 iso_pu_bacteria 2958064165 2958069520 375
209 iso_pu_bacteria 2958071322 2958077197 375
210 iso_pu_bacteria 2958084443 2958086002 375
211 iso_pu_bacteria 2958092219 2958100062 375
212 iso_pu_bacteria 2958100919 2958101979 375
213 iso_pu_bacteria 2958108152 2958108184 375
214 iso_pu_bacteria 2958115193 2958119265 375
215 iso_pu_bacteria 2958122699 2958123236 375
216 iso_pu_bacteria 2958130278 2958135202 375
217 iso_pu_bacteria 2958137437 2958140887 375
218 iso_pu_bacteria 2958144490 2958147421 375
219 iso_pu_bacteria 2958158011 2958159888 375
220 iso_pu_bacteria 2958165035 2958171348 375
221 iso_pu_bacteria 2958172287 2958178951 375
222 iso_pu_bacteria 2958179912 2958184231 375
223 iso_pu_bacteria 2961077736 2961082286 375
224 iso_pu_bacteria 2961114664 2961118954 375
225 iso_pu_bacteria 2961127735 2961131147 375
226 iso_pu_bacteria 2961136820 2961141953 375
227 iso_pu_bacteria 2961163497 2961169789 375
228 iso_pu_bacteria 2961170736 2961176383 375
229 iso_pu_bacteria 2961183825 2961190684 375
230 iso_pu_bacteria 2963644680 2963645161 375
231 iso_pu_bacteria 2965018300 2965024549 375
232 iso_pu_bacteria 2965025482 2965030148 375
233 iso_pu_bacteria 2965032056 2965036570 375
234 iso_pu_bacteria 2965040258 2965042351 375
235 iso_pu_bacteria 2965047637 2965049587 375
236 iso_pu_bacteria 2965062239 2965062380 375
237 iso_pu_bacteria 2965089291 2965096587 375
238 iso_pu_bacteria 2965102966 2965110842 375
239 iso_pu_bacteria 2965110997 2965113796 375
240 iso_pu_bacteria 2965119406 2965126013 375
241 iso_pu_bacteria 2967996073 2967996699 375
242 iso_pu_bacteria 2968003550 2968004761 375
243 iso_pu_bacteria 2968016561 2968023003 375
244 iso_pu_bacteria 2968083720 2968089940 375
245 iso_pu_bacteria 2968091066 2968093696 375
246 iso_pu_bacteria 2968097103 2968098526 375
247 iso_pu_bacteria 2968110612 2968115045 375
248 iso_pu_bacteria 2968117919 2968122782 375
249 iso_pu_bacteria 2968128360 2968133871 375
250 iso_pu_bacteria 2968171901 2968178181 375
251 iso_pu_bacteria 2970469710 2970475587 375
252 iso_pu_bacteria 2970489779 2970492409 375
253 iso_pu_bacteria 2970503327 2970509054 375
254 iso_pu_bacteria 2970510686 2970511274 375
255 iso_pu_bacteria 2970524798 2970525905 375
256 iso_pu_bacteria 2970532167 2970536058 375
257 iso_pu_bacteria 2970540015 2970545645 375
258 iso_pu_bacteria 2970547951 2970550150 375
259 iso_pu_bacteria 2970554993 2970561027 375
260 iso_pu_bacteria 2970593180 2970599274 375
261 iso_pu_bacteria 2970619444 2970622071 375
262 iso_pu_bacteria 2970627176 2970633260 375
263 iso_pu_bacteria 2977821940 2977823543 375
264 iso_pu_bacteria 2977828996 2977835391 375
265 iso_pu_bacteria 2977843712 2977850383 375
266 iso_pu_bacteria 2977851361 2977855226 375
267 iso_pu_bacteria 2977858184 2977863409 375
268 iso_pu_bacteria 2977864932 2977871681 375
269 iso_pu_bacteria 2977872689 2977873624 375
270 iso_pu_bacteria 2977898635 2977907248 375
271 iso_pu_bacteria 2977907340 2977909262 375
272 iso_pu_bacteria 2977915119 2977917035 375
273 iso_pu_bacteria 2977922695 2977925710 375
274 iso_pu_bacteria 2977935797 2977938214 375
275 iso_pu_bacteria 2977942078 2977943467 375
276 iso_pu_bacteria 2977950692 2977954501 375
277 iso_pu_bacteria 2977957713 2977957968 375
278 iso_pu_bacteria 2977971508 2977975324 375
279 iso_pu_bacteria 2977986579 2977993274 375
280 iso_pu_bacteria 2979710463 2979711057 375
281 iso_pu_bacteria 2979742915 2979750189 375
282 iso_pu_bacteria 2979764755 2979765826 375
283 iso_pu_bacteria 2979772303 2979773206 375
284 iso_pu_bacteria 2979779861 2979781782 375
285 iso_pu_bacteria 2979793036 2979795399 375
286 iso_pu_bacteria 2979808191 2979813733 375
287 iso_pu_bacteria 2987636660 2987641403 375
288 iso_pu_bacteria 2987645492 2987648151 375
289 iso_pu_bacteria 2987652177 2987658763 375
290 iso_pu_bacteria 2987659509 2987666013 375
291 iso_pu_bacteria 2987666974 2987669367 375
292 iso_pu_bacteria 2987673487 2987678408 375
293 iso_pu_bacteria 2996341866 2996342447 375
294 iso_pu_bacteria 2996348954 2996355803 375
295 iso_pu_bacteria 2996386984 2996390529 375
296 iso_pu_bacteria 3000135777 3000137185 375
297 iso_pu_bacteria 3004167301 3004173056 375
298 iso_pu_bacteria 3004188549 3004195036 375
299 iso_pu_bacteria 3004195979 3004200379 375
300 iso_pu_bacteria 3004211236 3004217248 375
301 iso_pu_bacteria 3004218560 3004220486 375
302 iso_pu_bacteria 3004232784 3004234567 375
303 iso_pu_bacteria 3004239961 3004243192 375
304 iso_pu_bacteria 3004248173 3004251160 375
305 iso_pu_bacteria 3004268573 3004274181 375
306 iso_pu_bacteria 3004275668 3004282229 375
307 iso_pu_bacteria 3004289098 3004296923 375
308 iso_pu_bacteria 3004334049 3004337575 375
309 iso_pu_bacteria 637000159 637077192 375
310 iso_pu_bacteria 649633066 649870382 375
311 iso_pu_bacteria 8004300914 8004302686 375
312 iso_pu_bacteria 8004312739 8004315460 375
313 iso_pu_bacteria 8004361976 8004363443 375
314 iso_pu_bacteria 8004374579 8004375905 375
315 iso_pu_bacteria 8004387939 8004393091 375
316 iso_pu_bacteria 8004445564 8004452185 375
317 iso_pu_bacteria 8004633249 8004638415 375
318 iso_pu_bacteria 8004640170 8004641587 375
319 iso_pu_bacteria 8004695233 8004701630 375
320 iso_pu_bacteria 8004703790 8004706849 375
321 iso_pu_bacteria 8004714634 8004719878 375
322 iso_pu_bacteria 8004727605 8004731276 375
323 iso_pu_bacteria 8055617313 8055617719 375
324 3300031730 Ga0307516_10028492 Ga0307516_100284922 376
325 3300048924 Ga0496121_0000426 Ga0496121_0000426_13496_14629 376
326 iso_pu_bacteria 2643221580 2643909565 376
327 iso_pu_bacteria 2643221674 2644413753 376
328 iso_pu_bacteria 2932401849 2932404294 376
329 3300003320 rootH2_10014801 rootH2_1001480111 377
330 3300005339 Ga0070660_100007853 Ga0070660_1000078534 377
331 3300006051 Ga0075364_10000250 Ga0075364_1000025020 377
332 3300006195 Ga0075366_10090592 Ga0075366_100905922 377
333 3300025909 Ga0207705_10020839 Ga0207705_100208393 377
334 3300025919 Ga0207657_10011666 Ga0207657_100116665 377
335 3300025972 Ga0207668_10030711 Ga0207668_100307113 377
336 3300028563 Ga0265319_1025295 Ga0265319_10252952 377
337 3300031711 Ga0265314_10026898 Ga0265314_100268984 377
338 3300044735 Ga0466968_0022641 Ga0466968_0022641_282_1460 377
339 3300048924 Ga0496121_0001611 Ga0496121_0001611_26406_27545 377
340 3300048924 Ga0496121_0171526 Ga0496121_0171526_29_1165 377
341 3300048928 Ga0496125_0005934 Ga0496125_0005934_5762_6898 377
342 3300049568 Ga0501031_0006762 Ga0501031_0006762_5250_6395 377
343 3300049569 Ga0501032_0000520 Ga0501032_0000520_8796_9941 377
344 3300049570 Ga0501033_0000192 Ga0501033_0000192_11701_12846 377
345 3300049571 Ga0501034_0002321 Ga0501034_0002321_763_1908 377
346 3300049571 Ga0501034_0024120 Ga0501034_0024120_1991_3124 377
347 3300049571 Ga0501034_0073993 Ga0501034_0073993_1413_2549 377
348 3300049572 Ga0501036_0000152 Ga0501036_0000152_22032_23177 377
349 3300049573 Ga0501037_0000029 Ga0501037_0000029_80312_81457 377
350 3300049573 Ga0501037_0048152 Ga0501037_0048152_1681_2817 377
351 3300049574 Ga0501038_0000263 Ga0501038_0000263_8668_9813 377
352 3300049575 Ga0501039_0000043 Ga0501039_0000043_80300_81445 377
353 3300049579 Ga0501043_0000260 Ga0501043_0000260_27606_28751 377
354 3300049580 Ga0501046_0013346 Ga0501046_0013346_3562_4707 377
355 3300049581 Ga0501047_0056827 Ga0501047_0056827_584_1729 377
356 3300049822 Ga0501035_0000057 Ga0501035_0000057_80292_81437 377
357 3300049822 Ga0501035_0006585 Ga0501035_0006585_8724_9860 377
358 3300049822 Ga0501035_0011233 Ga0501035_0011233_2103_3260 377
359 3300049823 Ga0501044_0009678 Ga0501044_0009678_604_1749 377
360 3300049823 Ga0501044_0084416 Ga0501044_0084416_1303_2460 377
361 3300050491 nmdc:mga00v17_402_c1 nmdc:mga00v17_402_c1_13783_14922 377
362 3300050494 nmdc:mga06z11_26612_c1 nmdc:mga06z11_26612_c1_1287_2420 377
363 3300053161 Ga0500634_0000009 Ga0500634_0000009_132703_133839 377
364 iso_pu_bacteria 2508501114 2509076949 377
365 3300005548 Ga0070665_100007908 Ga0070665_1000079086 378
366 3300009545 Ga0105237_10000659 Ga0105237_1000065941 378
367 3300010375 Ga0105239_10005061 Ga0105239_1000506110 378
368 3300010375 Ga0105239_10047486 Ga0105239_100474863 378
369 3300025231 Ga0207427_102561 Ga0207427_1025616 378
370 3300025914 Ga0207671_10000249 Ga0207671_1000024958 378
371 3300025914 Ga0207671_10001797 Ga0207671_100017976 378
372 3300025986 Ga0207658_10367018 Ga0207658_103670181 378
373 3300028379 Ga0268266_10001081 Ga0268266_100010817 378
374 3300028379 Ga0268266_10002646 Ga0268266_1000264614 378
375 3300048914 Ga0496111_0043344 Ga0496111_0043344_1767_2957 378
376 3300048924 Ga0496121_0096744 Ga0496121_0096744_1093_2235 378
377 3300048927 Ga0496124_0026099 Ga0496124_0026099_1867_3009 378
378 3300048928 Ga0496125_0000306 Ga0496125_0000306_60179_61369 378
379 3300049570 Ga0501033_0020580 Ga0501033_0020580_3202_4344 378
380 3300049574 Ga0501038_0026484 Ga0501038_0026484_3713_4855 378
381 3300049822 Ga0501035_0009258 Ga0501035_0009258_3961_5103 378
382 3300049823 Ga0501044_0020839 Ga0501044_0020839_3705_4844 378
383 3300049823 Ga0501044_0348400 Ga0501044_0348400_130_1269 378
384 3300053087 Ga0500643_012971 Ga0500643_012971_851_1999 378
385 3300002741 JGI25157J39369_1000470 JGI25157J39369_100047021 379
386 3300003214 JGI25165J46597_1000078 JGI25165J46597_1000078111 379
387 3300003215 JGI25153J46596_10035066 JGI25153J46596_100350662 379
388 3300005327 Ga0070658_10061084 Ga0070658_100610842 379
389 3300005539 Ga0068853_100016822 Ga0068853_1000168225 379
390 3300006038 Ga0075365_10006939 Ga0075365_100069396 379
391 3300006038 Ga0075365_10077646 Ga0075365_100776462 379
392 3300006042 Ga0075368_10026060 Ga0075368_100260602 379
393 3300006048 Ga0075363_100084947 Ga0075363_1000849472 379
394 3300006177 Ga0075362_10021777 Ga0075362_100217773 379
395 3300006178 Ga0075367_10005833 Ga0075367_100058336 379
396 3300009093 Ga0105240_10183042 Ga0105240_101830422 379
397 3300009545 Ga0105237_10071506 Ga0105237_100715063 379
398 3300009545 Ga0105237_10079424 Ga0105237_100794244 379
399 3300010375 Ga0105239_10036429 Ga0105239_100364294 379
400 3300014497 Ga0182008_10046599 Ga0182008_100465992 379
401 3300025250 Ga0209026_1000151 Ga0209026_100015164 379
402 3300025256 Ga0209759_1001606 Ga0209759_10016068 379
403 3300025261 Ga0209233_1000150 Ga0209233_100015071 379
404 3300025297 Ga0209758_1007647 Ga0209758_10076476 379
405 3300025904 Ga0207647_10014851 Ga0207647_100148516 379
406 3300025909 Ga0207705_10027861 Ga0207705_100278615 379
407 3300025914 Ga0207671_10180301 Ga0207671_101803012 379
408 3300025924 Ga0207694_10010439 Ga0207694_100104391 379
409 3300025924 Ga0207694_10075414 Ga0207694_100754143 379
410 3300026078 Ga0207702_10066262 Ga0207702_100662624 379
411 3300026078 Ga0207702_10087823 Ga0207702_100878233 379
412 3300028379 Ga0268266_10068636 Ga0268266_100686362 379
413 3300037418 Ga0395900_0020211 Ga0395900_0020211_3536_4675 379
414 3300037471 Ga0395905_0050087 Ga0395905_0050087_1642_2781 379
415 3300037471 Ga0395905_0277953 Ga0395905_0277953_408_1547 379
416 3300038443 Ga0395901_0230145 Ga0395901_0230145_81_1220 379
417 3300044901 Ga0466960_0074425 Ga0466960_0074425_13_1152 379
418 3300046660 Ga0495625_0017912 Ga0495625_0017912_1699_2838 379
419 3300047470 Ga0495681_0108246 Ga0495681_0108246_29_1168 379
420 3300048914 Ga0496111_0127233 Ga0496111_0127233_660_1799 379
421 3300048915 Ga0496112_0028198 Ga0496112_0028198_883_2022 379
422 3300048915 Ga0496112_0101170 Ga0496112_0101170_474_1613 379
423 3300048922 Ga0496119_0039781 Ga0496119_0039781_1119_2258 379
424 3300048923 Ga0496120_0000724 Ga0496120_0000724_36089_37228 379
425 3300048927 Ga0496124_0112838 Ga0496124_0112838_809_1948 379
426 3300050491 nmdc:mga00v17_12836_c1 nmdc:mga00v17_12836_c1_1968_3107 379
427 3300050492 nmdc:mga0yw44_82148_c1 nmdc:mga0yw44_82148_c1_258_1400 379
428 3300053083 Ga0495655_0006073 Ga0495655_0006073_512_1651 379
429 3300053155 Ga0500620_000073 Ga0500620_000073_14747_15901 379
430 3300053158 Ga0500627_0010821 Ga0500627_0010821_1728_2867 379
431 3300053158 Ga0500627_0047753 Ga0500627_0047753_312_1451 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

101

396

0.89

PF01979

Amidohydro_1

Amidohydrolase family

65

395

0.47

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w2w-assembly2.cif.gz_J crystal structure of yeast ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eif2b subunits 0.7641 213 237
1ymy-assembly1.cif.gz_B crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 0.7483 5 379
1ymy-assembly1.cif.gz_B crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 0.7402 5 379
1yrr-assembly1.cif.gz_B-2 crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution 0.734 6 378
1yrr-assembly1.cif.gz_B-2 crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution 0.7241 6 378
ID Description Score Start End Superfamily
af_P16689_1_268_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9749 5 269 3.20.20.70
af_P16689_1_268_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9606 5 269 3.20.20.70
2ftyB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8413 5 51 2.30.40.10
1j6pA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8174 6 50 2.30.40.10
5xgwB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8146 2 52 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A3S1KLI8-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (EC 3.6.1.63) 0.992 56 379 GO:0016810
GO:0019700
AF-A0A833G043-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (EC 3.6.1.63) 0.9916 1 269 GO:0016810
AF-A0A529XZW8-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (EC 3.6.1.63) 0.9896 62 332 GO:0016787
AF-A0A8A8BMH9-F1-model_v4 deleted 0.989 1 379
AF-A0A3S1KLI8-F1-model_v4 Alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (EC 3.6.1.63) 0.989 56 379 GO:0016810
GO:0019700

Feature Viewer

pLDDT pTM Quality
93.37 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map