F442303

General Info

Members Datasets Scaffolds Average Seq Length
431 229 862 287

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100035323|Ga0070668_1000353234
Length 319
Sequence LSTATTDTRKDPRTGTPPRSPLGLKWAEWLDVFKRTGKRFLADDCMGLSQQVAFSALLAFLPTVILLIGXXXXFGAGAFNSLEHFVGSVAPHGVISMIDFAKKGAAQNKSASAIAFALGVIVALWAASGAMGAIVKAVNRAYDRLETRPFWKVRLISLVLVVATGLVLAGTFLLIIFGGSLGDAIARRTPLGGGFKVFWNVARWPVAFVAVLLFFALVYYLAPNKEQRSWKWLTPGSLVGSLLWLVLSGLFALYTSFSGSYDRTYGSLAGGIVLLLWLNYSAWAILFGAELNAELDRQADIHAAGGPQAGLTEPAKRVR

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 9.98
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 13.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100035323 3300005347 Bacteria 3811
2 Ga0070658_10005491 3300005327 Bacteria 10287
3 Ga0070683_100007334 3300005329 Bacteria 9314
4 Ga0070683_100051534 3300005329 Bacteria 3811
5 Ga0070683_100077259 3300005329 Unclassified 3113
6 Ga0070683_100245827 3300005329 Bacteria 1702
7 Ga0070683_100393636 3300005329 Bacteria 1321
8 Ga0070680_100041490 3300005336 Bacteria 3731
9 Ga0070680_100103536 3300005336 Bacteria 2365
10 Ga0070682_100026308 3300005337 Bacteria 3481
11 Ga0070682_100078147 3300005337 Bacteria 2134
12 Ga0070660_100002902 3300005339 Bacteria 11796
13 Ga0070660_100154038 3300005339 Bacteria 1849
14 Ga0070691_10035496 3300005341 Bacteria 2348
15 Ga0070661_100006815 3300005344 Bacteria 7875
16 Ga0070661_100030571 3300005344 Bacteria 3891
17 Ga0070661_100033845 3300005344 Unclassified 3704
18 Ga0070671_100337372 3300005355 Bacteria 1285
19 Ga0070671_100395566 3300005355 Bacteria 1182
20 Ga0070673_100127004 3300005364 Bacteria 2135
21 Ga0070673_100219734 3300005364 Unclassified 1644
22 Ga0070703_10063710 3300005406 Bacteria 1213
23 Ga0070701_10005662 3300005438 Bacteria 5186
24 Ga0070711_100096977 3300005439 Bacteria 2137
25 Ga0070711_100138536 3300005439 Bacteria 1821
26 Ga0070711_100236385 3300005439 Unclassified 1427
27 Ga0070705_100124134 3300005440 Bacteria 1672
28 Ga0070694_100060591 3300005444 Bacteria 2581
29 Ga0070694_100082769 3300005444 Bacteria 2235
30 Ga0070708_100374152 3300005445 Bacteria 1343
31 Ga0070678_100034148 3300005456 Bacteria 3540
32 Ga0070662_100035355 3300005457 Bacteria 3527
33 Ga0070662_100037218 3300005457 Bacteria 3449
34 Ga0070681_10005995 3300005458 Bacteria 11779
35 Ga0070681_10062262 3300005458 Unclassified 3705
36 Ga0070706_100070194 3300005467 Bacteria 3240
37 Ga0070706_100277291 3300005467 Bacteria 1565
38 Ga0070707_100220041 3300005468 Bacteria 1849
39 Ga0070707_100402525 3300005468 Bacteria 1329
40 Ga0070698_100038433 3300005471 Bacteria 4931
41 Ga0070698_100039460 3300005471 Bacteria 4859
42 Ga0070698_100062483 3300005471 Unclassified 3757
43 Ga0070699_100190386 3300005518 Bacteria 1822
44 Ga0070699_100213968 3300005518 Bacteria 1717
45 Ga0070699_100592446 3300005518 Bacteria 1011
46 Ga0070679_100012530 3300005530 Bacteria 8109
47 Ga0070679_100079838 3300005530 Bacteria 3261
48 Ga0070684_100025665 3300005535 Bacteria 4956
49 Ga0070684_100113527 3300005535 Bacteria 2431
50 Ga0070684_100150752 3300005535 Bacteria 2106
51 Ga0070684_100228924 3300005535 Bacteria 1697
52 Ga0070684_100238940 3300005535 Bacteria 1659
53 Ga0070684_100331762 3300005535 Bacteria 1398
54 Ga0070697_100204100 3300005536 Bacteria 1680
55 Ga0068853_100051592 3300005539 Bacteria 3541
56 Ga0068853_100288223 3300005539 Bacteria 1515
57 Ga0070686_100059436 3300005544 Bacteria 2462
58 Ga0070695_100054436 3300005545 Bacteria 2575
59 Ga0070695_100056879 3300005545 Bacteria 2526
60 Ga0070695_100124815 3300005545 Bacteria 1766
61 Ga0070695_100168978 3300005545 Bacteria 1541
62 Ga0070696_100035459 3300005546 Bacteria 3435
63 Ga0070696_100243090 3300005546 Bacteria 1358
64 Ga0070693_100119910 3300005547 Bacteria 1630
65 Ga0070693_100232864 3300005547 Bacteria 1213
66 Ga0070704_100064069 3300005549 Bacteria 2640
67 Ga0070704_100080082 3300005549 Unclassified 2401
68 Ga0070704_100102090 3300005549 Bacteria 2163
69 Ga0068855_100039458 3300005563 Bacteria 5605
70 Ga0068855_100147358 3300005563 Unclassified 2678
71 Ga0068855_100154942 3300005563 Bacteria 2603
72 Ga0068855_100156883 3300005563 Bacteria 2585
73 Ga0068855_100190707 3300005563 Bacteria 2312
74 Ga0070664_100007141 3300005564 Bacteria 9007
75 Ga0068857_100057810 3300005577 Bacteria 3443
76 Ga0068857_100102716 3300005577 Bacteria 2566
77 Ga0068857_100213303 3300005577 Unclassified 1762
78 Ga0068854_100241807 3300005578 Bacteria 1438
79 Ga0068856_100079886 3300005614 Unclassified 3244
80 Ga0070702_100007318 3300005615 Bacteria 5280
81 Ga0068852_100267083 3300005616 Bacteria 1645
82 Ga0068861_100030498 3300005719 Bacteria 3952
83 Ga0068861_100161887 3300005719 Bacteria 1847
84 Ga0068858_100408041 3300005842 Bacteria 1306
85 Ga0068860_100054376 3300005843 Bacteria 3805
86 Ga0068862_100146510 3300005844 Bacteria 2099
87 Ga0081455_10010505 3300005937 Bacteria 9384
88 Ga0081455_10056894 3300005937 Bacteria 3318
89 Ga0081540_1001698 3300005983 Bacteria 18681
90 Ga0081540_1001835 3300005983 Bacteria 17805
91 Ga0081539_10002150 3300005985 Bacteria 29119
92 Ga0075365_10129174 3300006038 Bacteria 1748
93 Ga0075432_10063403 3300006058 Bacteria 1319
94 Ga0070715_10029419 3300006163 Bacteria 2212
95 Ga0070716_100013910 3300006173 Bacteria 4112
96 Ga0070712_100036620 3300006175 Bacteria 3340
97 Ga0070712_100129705 3300006175 Bacteria 1909
98 Ga0070712_100176750 3300006175 Unclassified 1660
99 Ga0097621_100221224 3300006237 Bacteria 1650
100 Ga0075428_100021247 3300006844 Bacteria 7188
101 Ga0075428_100152877 3300006844 Bacteria 2507
102 Ga0075431_100122432 3300006847 Bacteria 2684
103 Ga0075434_100503594 3300006871 Bacteria 1232
104 Ga0075429_100038625 3300006880 Bacteria 4156
105 Ga0075429_100249003 3300006880 Bacteria 1556
106 Ga0075436_100011339 3300006914 Bacteria 6115
107 Ga0105240_10142419 3300009093 Bacteria 2865
108 Ga0105240_10243091 3300009093 Unclassified 2086
109 Ga0105240_10406181 3300009093 Unclassified 1533
110 Ga0111539_10027134 3300009094 Bacteria 6994
111 Ga0111539_10030854 3300009094 Bacteria 6515
112 Ga0105245_10461561 3300009098 Bacteria 1280
113 Ga0114129_10018027 3300009147 Bacteria 10055
114 Ga0114129_10067742 3300009147 Bacteria 4977
115 Ga0114129_10077484 3300009147 Bacteria 4623
116 Ga0114129_10163820 3300009147 Bacteria 3036
117 Ga0114129_10341374 3300009147 Unclassified 1986
118 Ga0105243_10075814 3300009148 Bacteria 2731
119 Ga0105243_10184224 3300009148 Bacteria 1818
120 Ga0105241_10048732 3300009174 Bacteria 3224
121 Ga0105241_10347030 3300009174 Bacteria 1288
122 Ga0105242_10047762 3300009176 Bacteria 3476
123 Ga0105242_10053954 3300009176 Bacteria 3284
124 Ga0105242_10079633 3300009176 Bacteria 2736
125 Ga0105242_10086805 3300009176 Bacteria 2626
126 Ga0105242_10486891 3300009176 Bacteria 1170
127 Ga0105237_10037565 3300009545 Bacteria 4893
128 Ga0105238_10115560 3300009551 Bacteria 2663
129 Ga0105249_10026870 3300009553 Bacteria 5189
130 Ga0105249_10027124 3300009553 Bacteria 5167
131 Ga0105249_10237115 3300009553 Unclassified 1802
132 Ga0105239_10078023 3300010375 Unclassified 3645
133 Ga0105239_10161847 3300010375 Bacteria 2501
134 Ga0105239_10177352 3300010375 Bacteria 2383
135 Ga0105239_10278131 3300010375 Bacteria 1884
136 Ga0105239_10769012 3300010375 Bacteria 1103
137 Ga0157371_10057655 3300013102 Bacteria 2754
138 Ga0157370_10048385 3300013104 Bacteria 4074
139 Ga0157370_10068400 3300013104 Bacteria 3356
140 Ga0157369_10118897 3300013105 Bacteria 2805
141 Ga0157369_10119077 3300013105 Bacteria 2802
142 Ga0157374_10381980 3300013296 Bacteria 1403
143 Ga0157378_10042102 3300013297 Bacteria 4052
144 Ga0157378_10390002 3300013297 Unclassified 1369
145 Ga0157372_10007666 3300013307 Bacteria 11479
146 Ga0157372_10135606 3300013307 Bacteria 2834
147 Ga0157372_10138693 3300013307 Bacteria 2801
148 Ga0157372_10237346 3300013307 Unclassified 2115
149 Ga0157375_10200098 3300013308 Unclassified 2153
150 Ga0157375_10459970 3300013308 Unclassified 1438
151 Ga0182008_10074296 3300014497 Bacteria 1673
152 Ga0197907_10478301 3300020069 Bacteria 3698
153 Ga0206356_10839456 3300020070 Bacteria 2175
154 Ga0206356_11622897 3300020070 Bacteria 3487
155 Ga0213874_10057164 3300021377 Bacteria 1213
156 Ga0207653_10017360 3300025885 Bacteria 2265
157 Ga0207692_10029525 3300025898 Unclassified 2607
158 Ga0207688_10041364 3300025901 Unclassified 2563
159 Ga0207685_10045136 3300025905 Bacteria 1670
160 Ga0207699_10202311 3300025906 Bacteria 1346
161 Ga0207705_10041523 3300025909 Bacteria 3300
162 Ga0207707_10032973 3300025912 Bacteria 4534
163 Ga0207707_10088574 3300025912 Unclassified 2704
164 Ga0207707_10218354 3300025912 Bacteria 1660
165 Ga0207695_10165714 3300025913 Unclassified 2138
166 Ga0207695_10221949 3300025913 Bacteria 1797
167 Ga0207671_10172004 3300025914 Unclassified 1683
168 Ga0207693_10001413 3300025915 Bacteria 21296
169 Ga0207693_10003121 3300025915 Bacteria 14264
170 Ga0207693_10048575 3300025915 Bacteria 3332
171 Ga0207663_10172084 3300025916 Bacteria 1539
172 Ga0207663_10176310 3300025916 Bacteria 1523
173 Ga0207660_10046158 3300025917 Bacteria 3073
174 Ga0207660_10198983 3300025917 Bacteria 1564
175 Ga0207657_10001894 3300025919 Bacteria 22600
176 Ga0207657_10025046 3300025919 Bacteria 5511
177 Ga0207657_10043131 3300025919 Bacteria 3976
178 Ga0207649_10015688 3300025920 Bacteria 4256
179 Ga0207652_10014109 3300025921 Bacteria 6469
180 Ga0207652_10239599 3300025921 Bacteria 1635
181 Ga0207646_10140529 3300025922 Unclassified 2175
182 Ga0207644_10069602 3300025931 Unclassified 2570
183 Ga0207690_10179940 3300025932 Bacteria 1591
184 Ga0207706_10048468 3300025933 Bacteria 3757
185 Ga0207706_10062874 3300025933 Bacteria 3269
186 Ga0207686_10044075 3300025934 Bacteria 2737
187 Ga0207686_10054856 3300025934 Bacteria 2498
188 Ga0207669_10006217 3300025937 Bacteria 5438
189 Ga0207704_10254545 3300025938 Bacteria 1320
190 Ga0207665_10006833 3300025939 Bacteria 7556
191 Ga0207665_10009142 3300025939 Bacteria 6504
192 Ga0207691_10102429 3300025940 Bacteria 2554
193 Ga0207711_10522250 3300025941 Bacteria 1107
194 Ga0207661_10103709 3300025944 Unclassified 2394
195 Ga0207661_10471361 3300025944 Unclassified 1145
196 Ga0207667_10066120 3300025949 Bacteria 3769
197 Ga0207667_10092984 3300025949 Bacteria 3115
198 Ga0207667_10094539 3300025949 Bacteria 3086
199 Ga0207667_10376631 3300025949 Bacteria 1446
200 Ga0207651_10099400 3300025960 Unclassified 2155
201 Ga0207712_10065024 3300025961 Bacteria 2602
202 Ga0207668_10050159 3300025972 Bacteria 2874
203 Ga0207640_10157163 3300025981 Bacteria 1677
204 Ga0207640_10283666 3300025981 Unclassified 1302
205 Ga0207639_10036904 3300026041 Bacteria 3626
206 Ga0207648_10016020 3300026089 Bacteria 6868
207 Ga0207648_10303112 3300026089 Unclassified 1433
208 Ga0207674_10004276 3300026116 Bacteria 17218
209 Ga0207674_10018724 3300026116 Bacteria 7515
210 Ga0207674_10413029 3300026116 Unclassified 1304
211 Ga0207675_100001841 3300026118 Bacteria 21286
212 Ga0207675_100015145 3300026118 Bacteria 7192
213 Ga0207675_100069648 3300026118 Bacteria 3288
214 Ga0207683_10079198 3300026121 Bacteria 2913
215 Ga0207698_10047281 3300026142 Bacteria 3258
216 Ga0207698_10231527 3300026142 Bacteria 1678
217 Ga0207428_10147400 3300027907 Bacteria 1793
218 Ga0268264_10172851 3300028381 Bacteria 1955
219 Ga0373948_0010051 3300034817 Bacteria 1644
220 Ga0373938_0006743 3300034957 Bacteria 1996
221 Ga0373928_0004365 3300035084 Bacteria 2698
222 Ga0373929_0006849 3300035085 Bacteria 2069
223 Ga0373940_0004625 3300035088 Bacteria 2921
224 Ga0373949_0010226 3300035090 Bacteria 2055
225 Ga0373952_0008047 3300035092 Bacteria 1991
226 Ga0373932_0032353 3300035112 Bacteria 1463
227 Ga0373941_0005826 3300035115 Bacteria 2926
228 Ga0373946_0003073 3300035171 Bacteria 5911
229 Ga0373961_0010429 3300035241 Bacteria 2290
230 Ga0373962_0006671 3300035242 Bacteria 2800
231 Ga0373924_0199275 3300035410 Bacteria 883
232 Ga0373931_0107997 3300035691 Bacteria 1574
233 Ga0373935_0033902 3300035692 Bacteria 3180
234 Ga0373927_0074556 3300035695 Bacteria 2197
235 Ga0373947_0000522 3300035725 Bacteria 22384
236 Ga0373925_0065584 3300037068 Bacteria 2735
237 Ga0395899_0007896 3300037312 Bacteria 8197
238 Ga0395899_0040641 3300037312 Bacteria 3478
239 Ga0395899_0084254 3300037312 Bacteria 2311
240 Ga0395899_0085164 3300037312 Bacteria 2297
241 Ga0395899_0102839 3300037312 Bacteria 2061
242 Ga0395899_0261662 3300037312 Bacteria 1183
243 Ga0395900_0004816 3300037418 Bacteria 14214
244 Ga0395900_0009640 3300037418 Bacteria 9904
245 Ga0395900_0022216 3300037418 Bacteria 6490
246 Ga0395900_0025686 3300037418 Bacteria 6030
247 Ga0395900_0027042 3300037418 Bacteria 5873
248 Ga0395900_0029112 3300037418 Bacteria 5665
249 Ga0395900_0136982 3300037418 Unclassified 2508
250 Ga0395900_0398948 3300037418 Bacteria 1340
251 Ga0395898_0018905 3300037466 Bacteria 7020
252 Ga0395898_0029157 3300037466 Bacteria 5529
253 Ga0395898_0057735 3300037466 Bacteria 3781
254 Ga0395898_0058163 3300037466 Bacteria 3764
255 Ga0395898_0146808 3300037466 Bacteria 2257
256 Ga0395898_0154049 3300037466 Bacteria 2199
257 Ga0395898_0207788 3300037466 Unclassified 1868
258 Ga0395905_0010656 3300037471 Bacteria 8916
259 Ga0395905_0039294 3300037471 Bacteria 4439
260 Ga0395905_0096547 3300037471 Bacteria 2775
261 Ga0395905_0178104 3300037471 Unclassified 1996
262 Ga0395901_0008779 3300038443 Bacteria 10223
263 Ga0395901_0010180 3300038443 Bacteria 9527
264 Ga0395901_0011451 3300038443 Bacteria 8988
265 Ga0395901_0015586 3300038443 Bacteria 7742
266 Ga0395901_0017818 3300038443 Bacteria 7248
267 Ga0395901_0029695 3300038443 Bacteria 5630
268 Ga0395901_0032806 3300038443 Bacteria 5357
269 Ga0395901_0048815 3300038443 Bacteria 4396
270 Ga0395901_0236286 3300038443 Unclassified 1907
271 Ga0395901_0271478 3300038443 Bacteria 1764
272 Ga0395901_0364463 3300038443 Bacteria 1489
273 Ga0395901_0454175 3300038443 Bacteria 1310
274 Ga0436365_1892594 3300039437 Bacteria 1512
275 Ga0436363_1327805 3300039450 Bacteria 2973
276 Ga0451804_0795924 3300041463 Unclassified 1886
277 Ga0451849_0610169 3300041505 Unclassified 1781
278 Ga0466963_0049359 3300044694 Bacteria 2783
279 Ga0466963_0074937 3300044694 Bacteria 2283
280 Ga0466963_0214379 3300044694 Bacteria 1348
281 Ga0466964_0003574 3300044706 Bacteria 5681
282 Ga0466968_0028714 3300044735 Bacteria 2296
283 Ga0466960_0078189 3300044901 Bacteria 1660
284 Ga0466959_0018265 3300045049 Bacteria 5149
285 Ga0466959_0056524 3300045049 Bacteria 2863
286 Ga0466959_0244723 3300045049 Bacteria 1238
287 Ga0466958_0054871 3300045836 Bacteria 2417
288 Ga0466967_0003788 3300045976 Bacteria 9990
289 Ga0466967_0005694 3300045976 Bacteria 8687
290 Ga0466967_0020446 3300045976 Bacteria 5351
291 Ga0466967_0023984 3300045976 Bacteria 5008
292 Ga0466967_0047145 3300045976 Bacteria 3755
293 Ga0466967_0147536 3300045976 Bacteria 2195
294 Ga0495592_0231443 3300046454 Bacteria 1230
295 Ga0495592_0238980 3300046454 Bacteria 1206
296 Ga0495603_0055861 3300046455 Bacteria 2339
297 Ga0495629_0002065 3300046459 Bacteria 15574
298 Ga0495641_0002247 3300046461 Bacteria 15386
299 Ga0495651_0037015 3300046462 Bacteria 3799
300 Ga0495653_0017539 3300046463 Bacteria 5822
301 Ga0495653_0140367 3300046463 Bacteria 1700
302 Ga0495582_0000815 3300046473 Bacteria 17293
303 Ga0495582_0087372 3300046473 Unclassified 1736
304 Ga0495582_0197504 3300046473 Bacteria 1148
305 Ga0495605_0085354 3300046474 Bacteria 1471
306 Ga0495639_0002829 3300046475 Bacteria 7549
307 Ga0495639_0165096 3300046475 Bacteria 1073
308 Ga0495662_0007985 3300046476 Bacteria 5211
309 Ga0495662_0019681 3300046476 Bacteria 3266
310 Ga0495662_0078472 3300046476 Bacteria 1604
311 Ga0495584_0086696 3300046491 Bacteria 1578
312 Ga0495584_0214985 3300046491 Unclassified 977
313 Ga0495594_0217826 3300046499 Bacteria 1089
314 Ga0495608_0004926 3300046511 Bacteria 9565
315 Ga0495618_0165960 3300046514 Bacteria 1406
316 Ga0495628_0046175 3300046516 Bacteria 3460
317 Ga0495630_0002966 3300046517 Bacteria 11782
318 Ga0495630_0006731 3300046517 Bacteria 8191
319 Ga0495644_0053032 3300046523 Bacteria 1524
320 Ga0495652_0008150 3300046529 Bacteria 9580
321 Ga0495652_0095541 3300046529 Unclassified 2422
322 Ga0495665_0010214 3300046531 Bacteria 5085
323 Ga0495640_0012779 3300046533 Bacteria 6408
324 Ga0495640_0056109 3300046533 Bacteria 2692
325 Ga0495640_0067543 3300046533 Unclassified 2407
326 Ga0495587_0196773 3300046536 Bacteria 1140
327 Ga0495609_0088723 3300046538 Unclassified 1346
328 Ga0495633_0199522 3300046558 Unclassified 919
329 Ga0495667_0138542 3300046559 Bacteria 1568
330 Ga0495656_0013315 3300046615 Bacteria 3058
331 Ga0495634_0042269 3300046642 Bacteria 3092
332 Ga0495634_0050262 3300046642 Bacteria 2801
333 Ga0495634_0212200 3300046642 Bacteria 1198
334 Ga0495635_0007758 3300046663 Bacteria 7492
335 Ga0495659_0026052 3300046664 Bacteria 2006
336 Ga0495659_0030593 3300046664 Bacteria 1875
337 Ga0495588_0124275 3300046674 Bacteria 1360
338 Ga0495657_0218440 3300046675 Unclassified 1156
339 Ga0495623_0019010 3300046679 Bacteria 4437
340 Ga0495647_0014822 3300046681 Unclassified 2721
341 Ga0495613_0008261 3300046689 Bacteria 7727
342 Ga0495613_0010229 3300046689 Bacteria 6969
343 Ga0495613_0132082 3300046689 Bacteria 1787
344 Ga0495624_0006272 3300046690 Bacteria 8458
345 Ga0495624_0155405 3300046690 Unclassified 1398
346 Ga0495671_0073615 3300046692 Unclassified 1677
347 Ga0495589_0047315 3300046794 Bacteria 2132
348 Ga0495600_0026998 3300046809 Bacteria 3709
349 Ga0495600_0051728 3300046809 Bacteria 2681
350 Ga0495581_0012709 3300047315 Bacteria 4875
351 Ga0495581_0056735 3300047315 Bacteria 2260
352 Ga0495604_0022830 3300047317 Bacteria 4994
353 Ga0495604_0138802 3300047317 Bacteria 1739
354 Ga0495636_0043449 3300047318 Bacteria 1870
355 Ga0495674_0018680 3300047319 Bacteria 6452
356 Ga0495674_0034944 3300047319 Bacteria 4539
357 Ga0495674_0168558 3300047319 Bacteria 1828
358 Ga0495676_0002688 3300047321 Bacteria 15928
359 Ga0495676_0020953 3300047321 Bacteria 5722
360 Ga0495676_0099675 3300047321 Bacteria 2153
361 Ga0495680_0002078 3300047322 Bacteria 20832
362 Ga0495680_0041551 3300047322 Bacteria 3656
363 Ga0495680_0084819 3300047322 Bacteria 2386
364 Ga0495684_0003518 3300047471 Bacteria 12252
365 Ga0495684_0033511 3300047471 Bacteria 3939
366 Ga0495593_0001056 3300047673 Bacteria 16146
367 Ga0495602_0026560 3300048088 Bacteria 5582
368 Ga0495602_0259784 3300048088 Bacteria 1289
369 Ga0496100_0101720 3300048903 Bacteria 1981
370 Ga0496100_0143744 3300048903 Unclassified 1694
371 Ga0496100_0153576 3300048903 Bacteria 1644
372 Ga0496101_0048066 3300048904 Bacteria 3065
373 Ga0496101_0086047 3300048904 Unclassified 2330
374 Ga0496102_0014752 3300048905 Bacteria 6796
375 Ga0496103_0045729 3300048906 Unclassified 2701
376 Ga0496104_0080392 3300048907 Bacteria 3108
377 Ga0496105_0006296 3300048908 Bacteria 9114
378 Ga0496105_0035533 3300048908 Bacteria 4101
379 Ga0496105_0192479 3300048908 Unclassified 1667
380 Ga0496106_0006102 3300048909 Bacteria 8915
381 Ga0496106_0139296 3300048909 Bacteria 1907
382 Ga0496107_0274821 3300048910 Bacteria 1254
383 Ga0496107_0337898 3300048910 Bacteria 1120
384 Ga0496108_0001225 3300048911 Bacteria 20129
385 Ga0496108_0020564 3300048911 Bacteria 5424
386 Ga0496108_0073301 3300048911 Bacteria 2891
387 Ga0496109_0000921 3300048912 Bacteria 24461
388 Ga0496109_0165842 3300048912 Bacteria 2070
389 Ga0496109_0525640 3300048912 Bacteria 1116
390 Ga0496110_0017214 3300048913 Bacteria 6043
391 Ga0496110_0506091 3300048913 Bacteria 1099
392 Ga0496111_0033692 3300048914 Bacteria 3655
393 Ga0496111_0073089 3300048914 Bacteria 2497
394 Ga0496111_0104181 3300048914 Unclassified 2087
395 Ga0496111_0324326 3300048914 Bacteria 1140
396 Ga0496111_0331293 3300048914 Bacteria 1127
397 Ga0496112_0010011 3300048915 Bacteria 8582
398 Ga0496112_0010103 3300048915 Bacteria 8546
399 Ga0496112_0036990 3300048915 Bacteria 4764
400 Ga0496112_0042135 3300048915 Bacteria 4467
401 Ga0496112_0135647 3300048915 Unclassified 2432
402 Ga0496112_0181006 3300048915 Bacteria 2072
403 Ga0496112_0191887 3300048915 Bacteria 2004
404 Ga0496112_0511649 3300048915 Bacteria 1136
405 Ga0496113_0000863 3300048916 Bacteria 15857
406 Ga0496113_0055512 3300048916 Bacteria 2969
407 Ga0496114_0063745 3300048917 Bacteria 3086
408 Ga0496114_0129191 3300048917 Unclassified 2180
409 Ga0496115_0163435 3300048918 Bacteria 1841
410 Ga0496115_0330933 3300048918 Bacteria 1244
411 Ga0501047_0074819 3300049581 Bacteria 3260
412 Ga0501067_0000626 3300049583 Bacteria 19059
413 Ga0501069_0008295 3300049585 Bacteria 5455
414 Ga0501069_0023758 3300049585 Bacteria 3342
415 Ga0501069_0098455 3300049585 Bacteria 1659
416 Ga0501070_0001263 3300049586 Bacteria 22706
417 Ga0501070_0055851 3300049586 Bacteria 3273
418 Ga0501076_0157302 3300049592 Bacteria 1851
419 Ga0501079_0059646 3300049741 Unclassified 2943
420 Ga0501080_0052786 3300049742 Bacteria 3784
421 Ga0501044_0166423 3300049823 Bacteria 2179
422 nmdc:mga05p37_230107_c1 3300050507 Bacteria 2234
423 nmdc:mga05p37_67656_c2 3300050507 Bacteria 3565
424 nmdc:mga05p37_7612_c1 3300050507 Bacteria 12781
425 nmdc:mga06r32_413772_c1 3300050510 Bacteria 1330
426 nmdc:mga08y16_13168_c1 3300050511 Bacteria 8699
427 nmdc:mga0rr50_191427_c1 3300050513 Unclassified 1677
428 Ga0495612_0048336 3300053078 Bacteria 1744
429 Ga0495595_0005107 3300053084 Bacteria 5305
430 Ga0495619_0005836 3300053085 Bacteria 7802
431 Ga0495619_0116037 3300053085 Bacteria 1833
432 Ga0070668_100035323
433 Ga0070658_10005491
434 Ga0070683_100007334
435 Ga0070683_100051534
436 Ga0070683_100077259
437 Ga0070683_100245827
438 Ga0070683_100393636
439 Ga0070680_100041490
440 Ga0070680_100103536
441 Ga0070682_100026308
442 Ga0070682_100078147
443 Ga0070660_100002902
444 Ga0070660_100154038
445 Ga0070691_10035496
446 Ga0070661_100006815
447 Ga0070661_100030571
448 Ga0070661_100033845
449 Ga0070671_100337372
450 Ga0070671_100395566
451 Ga0070673_100127004
452 Ga0070673_100219734
453 Ga0070703_10063710
454 Ga0070701_10005662
455 Ga0070711_100096977
456 Ga0070711_100138536
457 Ga0070711_100236385
458 Ga0070705_100124134
459 Ga0070694_100060591
460 Ga0070694_100082769
461 Ga0070708_100374152
462 Ga0070678_100034148
463 Ga0070662_100035355
464 Ga0070662_100037218
465 Ga0070681_10005995
466 Ga0070681_10062262
467 Ga0070706_100070194
468 Ga0070706_100277291
469 Ga0070707_100220041
470 Ga0070707_100402525
471 Ga0070698_100038433
472 Ga0070698_100039460
473 Ga0070698_100062483
474 Ga0070699_100190386
475 Ga0070699_100213968
476 Ga0070699_100592446
477 Ga0070679_100012530
478 Ga0070679_100079838
479 Ga0070684_100025665
480 Ga0070684_100113527
481 Ga0070684_100150752
482 Ga0070684_100228924
483 Ga0070684_100238940
484 Ga0070684_100331762
485 Ga0070697_100204100
486 Ga0068853_100051592
487 Ga0068853_100288223
488 Ga0070686_100059436
489 Ga0070695_100054436
490 Ga0070695_100056879
491 Ga0070695_100124815
492 Ga0070695_100168978
493 Ga0070696_100035459
494 Ga0070696_100243090
495 Ga0070693_100119910
496 Ga0070693_100232864
497 Ga0070704_100064069
498 Ga0070704_100080082
499 Ga0070704_100102090
500 Ga0068855_100039458
501 Ga0068855_100147358
502 Ga0068855_100154942
503 Ga0068855_100156883
504 Ga0068855_100190707
505 Ga0070664_100007141
506 Ga0068857_100057810
507 Ga0068857_100102716
508 Ga0068857_100213303
509 Ga0068854_100241807
510 Ga0068856_100079886
511 Ga0070702_100007318
512 Ga0068852_100267083
513 Ga0068861_100030498
514 Ga0068861_100161887
515 Ga0068858_100408041
516 Ga0068860_100054376
517 Ga0068862_100146510
518 Ga0081455_10010505
519 Ga0081455_10056894
520 Ga0081540_1001698
521 Ga0081540_1001835
522 Ga0081539_10002150
523 Ga0075365_10129174
524 Ga0075432_10063403
525 Ga0070715_10029419
526 Ga0070716_100013910
527 Ga0070712_100036620
528 Ga0070712_100129705
529 Ga0070712_100176750
530 Ga0097621_100221224
531 Ga0075428_100021247
532 Ga0075428_100152877
533 Ga0075431_100122432
534 Ga0075434_100503594
535 Ga0075429_100038625
536 Ga0075429_100249003
537 Ga0075436_100011339
538 Ga0105240_10142419
539 Ga0105240_10243091
540 Ga0105240_10406181
541 Ga0111539_10027134
542 Ga0111539_10030854
543 Ga0105245_10461561
544 Ga0114129_10018027
545 Ga0114129_10067742
546 Ga0114129_10077484
547 Ga0114129_10163820
548 Ga0114129_10341374
549 Ga0105243_10075814
550 Ga0105243_10184224
551 Ga0105241_10048732
552 Ga0105241_10347030
553 Ga0105242_10047762
554 Ga0105242_10053954
555 Ga0105242_10079633
556 Ga0105242_10086805
557 Ga0105242_10486891
558 Ga0105237_10037565
559 Ga0105238_10115560
560 Ga0105249_10026870
561 Ga0105249_10027124
562 Ga0105249_10237115
563 Ga0105239_10078023
564 Ga0105239_10161847
565 Ga0105239_10177352
566 Ga0105239_10278131
567 Ga0105239_10769012
568 Ga0157371_10057655
569 Ga0157370_10048385
570 Ga0157370_10068400
571 Ga0157369_10118897
572 Ga0157369_10119077
573 Ga0157374_10381980
574 Ga0157378_10042102
575 Ga0157378_10390002
576 Ga0157372_10007666
577 Ga0157372_10135606
578 Ga0157372_10138693
579 Ga0157372_10237346
580 Ga0157375_10200098
581 Ga0157375_10459970
582 Ga0182008_10074296
583 Ga0197907_10478301
584 Ga0206356_10839456
585 Ga0206356_11622897
586 Ga0213874_10057164
587 Ga0207653_10017360
588 Ga0207692_10029525
589 Ga0207688_10041364
590 Ga0207685_10045136
591 Ga0207699_10202311
592 Ga0207705_10041523
593 Ga0207707_10032973
594 Ga0207707_10088574
595 Ga0207707_10218354
596 Ga0207695_10165714
597 Ga0207695_10221949
598 Ga0207671_10172004
599 Ga0207693_10001413
600 Ga0207693_10003121
601 Ga0207693_10048575
602 Ga0207663_10172084
603 Ga0207663_10176310
604 Ga0207660_10046158
605 Ga0207660_10198983
606 Ga0207657_10001894
607 Ga0207657_10025046
608 Ga0207657_10043131
609 Ga0207649_10015688
610 Ga0207652_10014109
611 Ga0207652_10239599
612 Ga0207646_10140529
613 Ga0207644_10069602
614 Ga0207690_10179940
615 Ga0207706_10048468
616 Ga0207706_10062874
617 Ga0207686_10044075
618 Ga0207686_10054856
619 Ga0207669_10006217
620 Ga0207704_10254545
621 Ga0207665_10006833
622 Ga0207665_10009142
623 Ga0207691_10102429
624 Ga0207711_10522250
625 Ga0207661_10103709
626 Ga0207661_10471361
627 Ga0207667_10066120
628 Ga0207667_10092984
629 Ga0207667_10094539
630 Ga0207667_10376631
631 Ga0207651_10099400
632 Ga0207712_10065024
633 Ga0207668_10050159
634 Ga0207640_10157163
635 Ga0207640_10283666
636 Ga0207639_10036904
637 Ga0207648_10016020
638 Ga0207648_10303112
639 Ga0207674_10004276
640 Ga0207674_10018724
641 Ga0207674_10413029
642 Ga0207675_100001841
643 Ga0207675_100015145
644 Ga0207675_100069648
645 Ga0207683_10079198
646 Ga0207698_10047281
647 Ga0207698_10231527
648 Ga0207428_10147400
649 Ga0268264_10172851
650 Ga0373948_0010051
651 Ga0373938_0006743
652 Ga0373928_0004365
653 Ga0373929_0006849
654 Ga0373940_0004625
655 Ga0373949_0010226
656 Ga0373952_0008047
657 Ga0373932_0032353
658 Ga0373941_0005826
659 Ga0373946_0003073
660 Ga0373961_0010429
661 Ga0373962_0006671
662 Ga0373924_0199275
663 Ga0373931_0107997
664 Ga0373935_0033902
665 Ga0373927_0074556
666 Ga0373947_0000522
667 Ga0373925_0065584
668 Ga0395899_0007896
669 Ga0395899_0040641
670 Ga0395899_0084254
671 Ga0395899_0085164
672 Ga0395899_0102839
673 Ga0395899_0261662
674 Ga0395900_0004816
675 Ga0395900_0009640
676 Ga0395900_0022216
677 Ga0395900_0025686
678 Ga0395900_0027042
679 Ga0395900_0029112
680 Ga0395900_0136982
681 Ga0395900_0398948
682 Ga0395898_0018905
683 Ga0395898_0029157
684 Ga0395898_0057735
685 Ga0395898_0058163
686 Ga0395898_0146808
687 Ga0395898_0154049
688 Ga0395898_0207788
689 Ga0395905_0010656
690 Ga0395905_0039294
691 Ga0395905_0096547
692 Ga0395905_0178104
693 Ga0395901_0008779
694 Ga0395901_0010180
695 Ga0395901_0011451
696 Ga0395901_0015586
697 Ga0395901_0017818
698 Ga0395901_0029695
699 Ga0395901_0032806
700 Ga0395901_0048815
701 Ga0395901_0236286
702 Ga0395901_0271478
703 Ga0395901_0364463
704 Ga0395901_0454175
705 Ga0436365_1892594
706 Ga0436363_1327805
707 Ga0451804_0795924
708 Ga0451849_0610169
709 Ga0466963_0049359
710 Ga0466963_0074937
711 Ga0466963_0214379
712 Ga0466964_0003574
713 Ga0466968_0028714
714 Ga0466960_0078189
715 Ga0466959_0018265
716 Ga0466959_0056524
717 Ga0466959_0244723
718 Ga0466958_0054871
719 Ga0466967_0003788
720 Ga0466967_0005694
721 Ga0466967_0020446
722 Ga0466967_0023984
723 Ga0466967_0047145
724 Ga0466967_0147536
725 Ga0495592_0231443
726 Ga0495592_0238980
727 Ga0495603_0055861
728 Ga0495629_0002065
729 Ga0495641_0002247
730 Ga0495651_0037015
731 Ga0495653_0017539
732 Ga0495653_0140367
733 Ga0495582_0000815
734 Ga0495582_0087372
735 Ga0495582_0197504
736 Ga0495605_0085354
737 Ga0495639_0002829
738 Ga0495639_0165096
739 Ga0495662_0007985
740 Ga0495662_0019681
741 Ga0495662_0078472
742 Ga0495584_0086696
743 Ga0495584_0214985
744 Ga0495594_0217826
745 Ga0495608_0004926
746 Ga0495618_0165960
747 Ga0495628_0046175
748 Ga0495630_0002966
749 Ga0495630_0006731
750 Ga0495644_0053032
751 Ga0495652_0008150
752 Ga0495652_0095541
753 Ga0495665_0010214
754 Ga0495640_0012779
755 Ga0495640_0056109
756 Ga0495640_0067543
757 Ga0495587_0196773
758 Ga0495609_0088723
759 Ga0495633_0199522
760 Ga0495667_0138542
761 Ga0495656_0013315
762 Ga0495634_0042269
763 Ga0495634_0050262
764 Ga0495634_0212200
765 Ga0495635_0007758
766 Ga0495659_0026052
767 Ga0495659_0030593
768 Ga0495588_0124275
769 Ga0495657_0218440
770 Ga0495623_0019010
771 Ga0495647_0014822
772 Ga0495613_0008261
773 Ga0495613_0010229
774 Ga0495613_0132082
775 Ga0495624_0006272
776 Ga0495624_0155405
777 Ga0495671_0073615
778 Ga0495589_0047315
779 Ga0495600_0026998
780 Ga0495600_0051728
781 Ga0495581_0012709
782 Ga0495581_0056735
783 Ga0495604_0022830
784 Ga0495604_0138802
785 Ga0495636_0043449
786 Ga0495674_0018680
787 Ga0495674_0034944
788 Ga0495674_0168558
789 Ga0495676_0002688
790 Ga0495676_0020953
791 Ga0495676_0099675
792 Ga0495680_0002078
793 Ga0495680_0041551
794 Ga0495680_0084819
795 Ga0495684_0003518
796 Ga0495684_0033511
797 Ga0495593_0001056
798 Ga0495602_0026560
799 Ga0495602_0259784
800 Ga0496100_0101720
801 Ga0496100_0143744
802 Ga0496100_0153576
803 Ga0496101_0048066
804 Ga0496101_0086047
805 Ga0496102_0014752
806 Ga0496103_0045729
807 Ga0496104_0080392
808 Ga0496105_0006296
809 Ga0496105_0035533
810 Ga0496105_0192479
811 Ga0496106_0006102
812 Ga0496106_0139296
813 Ga0496107_0274821
814 Ga0496107_0337898
815 Ga0496108_0001225
816 Ga0496108_0020564
817 Ga0496108_0073301
818 Ga0496109_0000921
819 Ga0496109_0165842
820 Ga0496109_0525640
821 Ga0496110_0017214
822 Ga0496110_0506091
823 Ga0496111_0033692
824 Ga0496111_0073089
825 Ga0496111_0104181
826 Ga0496111_0324326
827 Ga0496111_0331293
828 Ga0496112_0010011
829 Ga0496112_0010103
830 Ga0496112_0036990
831 Ga0496112_0042135
832 Ga0496112_0135647
833 Ga0496112_0181006
834 Ga0496112_0191887
835 Ga0496112_0511649
836 Ga0496113_0000863
837 Ga0496113_0055512
838 Ga0496114_0063745
839 Ga0496114_0129191
840 Ga0496115_0163435
841 Ga0496115_0330933
842 Ga0501047_0074819
843 Ga0501067_0000626
844 Ga0501069_0008295
845 Ga0501069_0023758
846 Ga0501069_0098455
847 Ga0501070_0001263
848 Ga0501070_0055851
849 Ga0501076_0157302
850 Ga0501079_0059646
851 Ga0501080_0052786
852 Ga0501044_0166423
853 nmdc:mga05p37_230107_c1
854 nmdc:mga05p37_67656_c2
855 nmdc:mga05p37_7612_c1
856 nmdc:mga06r32_413772_c1
857 nmdc:mga08y16_13168_c1
858 nmdc:mga0rr50_191427_c1
859 Ga0495612_0048336
860 Ga0495595_0005107
861 Ga0495619_0005836
862 Ga0495619_0116037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03631

Virul_fac_BrkB

Virulence factor BrkB

41

299

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tx3-assembly1.cif.gz_A cysz, a putative sulfate permease 0.3935 11 236
3tx3-assembly1.cif.gz_A cysz, a putative sulfate permease 0.3792 11 236
6is6-assembly1.cif.gz_A crystal structure of thermoplasmatales archaeon heliorhodopsin 0.3534 71 229
8gi8-assembly1.cif.gz_A kalium channelrhodopsin 1 from hyphochytrium catenoides (hckcr1) embedded in peptidisc 0.3232 19 240
3god-assembly1.cif.gz_A structural basis for dnase activity of a conserved protein implicated in crispr-mediated antiviral defense 0.3157 1 241
ID Description Score Start End Superfamily
af_Q6UJY2_749_891_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.448 20 164 3.10.20.90
af_Q6UJY2_749_891_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.4235 20 164 3.10.20.90
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4143 76 231 1.10.357.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3703 76 231 1.10.357.20
af_Q55E99_21_286_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3602 22 224 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A537QZE7-F1-model_v4 YihY/virulence factor BrkB family protein 0.9071 73 237 GO:0005886
AF-A0A537QZE7-F1-model_v4 YihY/virulence factor BrkB family protein 0.8492 73 237 GO:0005886
AF-A0A379MNV0-F1-model_v4 Putative ribonuclease BN 0.84 84 250 GO:0005886
AF-A0A3N5ERK3-F1-model_v4 YihY/virulence factor BrkB family protein 0.8368 79 235 GO:0005886
AF-A0A7J9VFB2-F1-model_v4 YihY family inner membrane protein 0.8083 5 235 GO:0005886

Map