F442189

General Info

Members Datasets Scaffolds Average Seq Length
430 335 248 187

Family's Representative Sequence

Representative Sequence 3300039145|Ga0237816_05099|Ga0237816_05099_69_644
Length 191
Sequence MTDGAGRRGPLSAHFRKMAHNNAWANWRLLTACLKLDGEAFKATRTSFFPSLHETLNHNLMVDLYYIDALERGGLGQQVFERFQAFEAPALLQAQSAADRRLIAVCDGLSDAALDATVTTDRRSGPIEERIDDLLAHLFQHQTHHRGQAHAMLAGTDMPPPQLDEYFLLYDSQQTRVELRRLDLQPPEELL

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
7 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
8 2519899620 Rhizobium sp. Pop5 Isolate Nodule
9 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
10 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
11 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
12 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
13 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
14 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
15 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
16 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
17 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
18 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
19 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
20 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
21 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
22 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
23 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
24 2643221568 Rhizobium sp. Root564 Isolate Unclassified
25 2643221582 Rhizobium sp. Root651 Isolate Unclassified
26 2643221599 Rhizobium sp. Root708 Isolate Unclassified
27 2643221693 Rhizobium sp. Root491 Isolate Unclassified
28 2718217882 Rhizobium sp. N741 Isolate Nodule
29 2718217927 Rhizobium sp. N324 Isolate Nodule
30 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
31 2718218009 Rhizobium sp. N561 Isolate Nodule
32 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
33 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
34 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
35 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
36 2718218363 Rhizobium sp. N113 Isolate Nodule
37 2718218366 Rhizobium sp. N621 Isolate Nodule
38 2718218423 Rhizobium sp. N941 Isolate Nodule
39 2721755514 Rhizobium sp. N6212 Isolate Nodule
40 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
41 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
42 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
43 2721755809 Rhizobium sp. N541 Isolate Nodule
44 2721755810 Rhizobium sp. N871 Isolate Nodule
45 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
46 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
47 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
48 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
49 2728369365 Rhizobium sp. N1341 Isolate Nodule
50 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
51 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
52 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
53 2791355256 Rhizobium sp. M10 Isolate Nodule
54 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
55 2791355261 Rhizobium sp. J15 Isolate Nodule
56 2791355262 Rhizobium sp. M1 Isolate Nodule
57 2791355263 Rhizobium chutanense C5 Isolate Nodule
58 2791355264 Rhizobium sp. S9 Isolate Nodule
59 2791355265 Rhizobium sp. H4 Isolate Nodule
60 2791355266 Rhizobium sp. L43 Isolate Nodule
61 2791355267 Rhizobium sp. L18 Isolate Nodule
62 2802429633 Rhizobium anhuiense J3 Isolate Nodule
63 2802429634 Rhizobium anhuiense S10 Isolate Nodule
64 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
65 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
66 2802429637 Rhizobium anhuiense C15 Isolate Nodule
67 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
68 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
69 2818991467 Bosea vestrisii 3192 Isolate Unclassified
70 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
71 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
72 2838048938 Rhizobium pisi 27/80 Isolate Nodule
73 2838061910 Rhizobium phaseoli L15 Isolate Nodule
74 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
75 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
76 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
77 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
78 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
79 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
80 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
81 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
82 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
83 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
84 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
85 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
86 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
87 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
88 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
89 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
90 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
91 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
92 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
93 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
94 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
95 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
96 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
97 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
98 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
99 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
100 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
101 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
102 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
103 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
104 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
105 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
106 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
107 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
108 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
109 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
110 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
111 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
112 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
113 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
114 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
115 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
116 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
117 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
118 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
119 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
120 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
121 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
122 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
123 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
124 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
125 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
126 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
127 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
128 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
129 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
130 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
131 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
132 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
133 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
134 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
135 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
136 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
137 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
138 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
139 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
140 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
141 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
142 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
143 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
144 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
145 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
146 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
147 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
148 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
149 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
150 2936381700 Rhizobium chutanense C16 Isolate Unclassified
151 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
152 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
153 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
154 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
155 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
156 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
157 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
158 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
159 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
160 2996893221 Rhizobium sp. R635 Isolate Nodule
161 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
162 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
163 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
164 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
165 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
166 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
167 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
168 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
171 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
172 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
173 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
174 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
175 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
176 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
177 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
178 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
179 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
180 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
181 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
182 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
183 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
184 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
185 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
186 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
187 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
188 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
189 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
190 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
191 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
192 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
193 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
196 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
197 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
198 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
199 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
202 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
203 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
204 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
205 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
207 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
211 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
214 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
220 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
221 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
222 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
227 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
228 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
296 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
297 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
298 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
299 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
300 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
301 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
311 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
315 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
316 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
317 8005275841 Rhizobium sp. N4311 Isolate Nodule
318 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
319 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
320 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
321 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
322 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
323 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
324 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
325 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
326 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
327 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
328 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
329 8018176218 Rhizobium sp. N122 Isolate Nodule
330 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
331 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
332 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
333 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
334 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
335 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.67
Metatranscriptomes 0
Isolates 42.33

Biome Distribution

Category Percentage (%)
Aerial Root 1.16
Bulb 0
Endosphere 29.3
Nodule 30.7
Rhizoplane 0.93
Rhizosphere 21.86
Stem 0
Stem Tuber 0
Unclassified 16.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1002218 3300002737 Bacteria 7985
2 JGI25152J39213_1000691 3300002773 Bacteria 17569
3 JGI25150J39212_1000144 3300002774 Bacteria 40186
4 JGI25159J45721_1000463 3300002987 Bacteria 18770
5 JGI25151J46595_10000031 3300003187 Bacteria 197865
6 JGI25151J46595_10001277 3300003187 Bacteria 17761
7 JGI25165J46597_1001184 3300003214 Bacteria 15921
8 JGI25153J46596_10000359 3300003215 Bacteria 31449
9 JGI25153J46596_10023690 3300003215 Bacteria 2231
10 JGI25160J50197_1000100 3300003354 Bacteria 86646
11 JGI25160J50197_1000571 3300003354 Bacteria 20796
12 JGI25161J50226_1000072 3300003374 Bacteria 86646
13 JGI25161J50226_1002855 3300003374 Bacteria 4221
14 Ga0055526_1001101 3300003771 Bacteria 19634
15 Ga0055526_1001414 3300003771 Bacteria 17081
16 Ga0055526_1001710 3300003771 Bacteria 15299
17 Ga0055524_1012760 3300003775 Bacteria 3208
18 Ga0055524_1026876 3300003775 Bacteria 1764
19 Ga0055528_1004911 3300003790 Bacteria 6316
20 Ga0055528_1013098 3300003790 Bacteria 3169
21 Ga0055528_1036692 3300003790 Bacteria 1166
22 Ga0055540_1000752 3300003792 Bacteria 21989
23 Ga0055540_1012755 3300003792 Bacteria 2615
24 Ga0058692_1003553 3300003856 Bacteria 4790
25 Ga0055543_1000078 3300004625 Bacteria 85340
26 Ga0055543_1000757 3300004625 Bacteria 16170
27 Ga0065165_1000623 3300005262 Bacteria 51455
28 Ga0065704_10197681 3300005289 Bacteria 1160
29 Ga0075365_10004947 3300006038 Bacteria 7130
30 Ga0075365_10284397 3300006038 Bacteria 1164
31 Ga0075363_100019290 3300006048 Bacteria 3408
32 Ga0075363_100137557 3300006048 Bacteria 1373
33 Ga0075363_100163720 3300006048 Bacteria 1260
34 Ga0075364_10070467 3300006051 Bacteria 2302
35 Ga0075364_10255926 3300006051 Bacteria 1190
36 Ga0075362_10001071 3300006177 Bacteria 8461
37 Ga0075362_10001896 3300006177 Bacteria 6862
38 Ga0075367_10000817 3300006178 Bacteria 12303
39 Ga0075367_10123016 3300006178 Bacteria 1600
40 Ga0075367_10167306 3300006178 Bacteria 1368
41 Ga0075369_10002318 3300006186 Bacteria 6770
42 Ga0075369_10067745 3300006186 Bacteria 1568
43 Ga0075369_10176948 3300006186 Bacteria 981
44 Ga0075369_10392234 3300006186 Bacteria 654
45 Ga0075366_10021380 3300006195 Bacteria 3760
46 Ga0075366_10315202 3300006195 Bacteria 958
47 Ga0075370_10009138 3300006353 Bacteria 5131
48 Ga0075370_10030815 3300006353 Bacteria 2994
49 Ga0099826_10001733 3300006948 Bacteria 13457
50 Ga0099826_10009637 3300006948 Bacteria 7212
51 Ga0105243_10038802 3300009148 Bacteria 3710
52 Ga0123341_1000014 3300009765 Bacteria 91980
53 Ga0123342_1016716 3300009766 Bacteria 6303
54 Ga0105246_10008513 3300011119 Bacteria 6307
55 Ga0157373_10015960 3300013100 Bacteria 5484
56 Ga0157371_10000002 3300013102 Bacteria 665040
57 Ga0157371_10097243 3300013102 Bacteria 2087
58 Ga0157369_10173296 3300013105 Bacteria 2272
59 Ga0171462_1038 3300013250 Bacteria 77485
60 Ga0163162_10969743 3300013306 Bacteria 961
61 Ga0157372_10381510 3300013307 Bacteria 1642
62 Ga0157372_10418395 3300013307 Bacteria 1562
63 Ga0209436_103716 3300025208 Bacteria 3964
64 Ga0207427_108308 3300025231 Bacteria 1163
65 Ga0209437_100058 3300025233 Bacteria 357279
66 Ga0209437_100313 3300025233 Bacteria 64057
67 Ga0207425_1000058 3300025245 Bacteria 149214
68 Ga0207425_1040035 3300025245 Bacteria 896
69 Ga0209646_1004652 3300025246 Bacteria 2476
70 Ga0209129_1000107 3300025258 Bacteria 154705
71 Ga0209129_1000605 3300025258 Bacteria 24282
72 Ga0209233_1000157 3300025261 Bacteria 164269
73 Ga0209233_1000354 3300025261 Bacteria 42911
74 Ga0209673_1000233 3300025273 Bacteria 108504
75 Ga0209673_1002817 3300025273 Bacteria 11231
76 Ga0209673_1016322 3300025273 Bacteria 2782
77 Ga0209130_1000083 3300025284 Bacteria 162582
78 Ga0209130_1013765 3300025284 Bacteria 2060
79 Ga0209676_1012841 3300025292 Bacteria 3256
80 Ga0209025_1000083 3300025294 Bacteria 265556
81 Ga0209025_1000350 3300025294 Bacteria 99649
82 Ga0209025_1010805 3300025294 Bacteria 6129
83 Ga0209025_1048109 3300025294 Bacteria 1732
84 Ga0209564_1000023 3300025295 Bacteria 555102
85 Ga0209564_1000125 3300025295 Bacteria 201709
86 Ga0209564_1012865 3300025295 Bacteria 3606
87 Ga0209758_1000090 3300025297 Bacteria 246564
88 Ga0209758_1001034 3300025297 Bacteria 36440
89 Ga0209758_1001490 3300025297 Bacteria 27333
90 Ga0209050_1010028 3300025298 Bacteria 4735
91 Ga0209256_1000608 3300025299 Bacteria 49615
92 Ga0209256_1001684 3300025299 Bacteria 21424
93 Ga0209256_1006009 3300025299 Bacteria 6648
94 Ga0207426_1000173 3300025302 Bacteria 162697
95 Ga0207426_1000276 3300025302 Bacteria 106148
96 Ga0209051_1000217 3300025303 Bacteria 97218
97 Ga0209051_1020121 3300025303 Bacteria 2887
98 Ga0209051_1020638 3300025303 Bacteria 2829
99 Ga0209257_1003258 3300025304 Bacteria 14215
100 Ga0207709_10210639 3300025935 Bacteria 1395
101 Ga0207640_10928013 3300025981 Bacteria 762
102 Ga0209371_1000003 3300027312 Bacteria 1122971
103 Ga0209371_1001970 3300027312 Bacteria 12422
104 Ga0209371_1003973 3300027312 Bacteria 6754
105 Ga0209371_1024435 3300027312 Bacteria 1406
106 Ga0209282_1006950 3300027666 Bacteria 7059
107 Ga0209282_1007748 3300027666 Bacteria 6740
108 Ga0209813_10013376 3300027866 Bacteria 2190
109 Ga0268256_1000004 3300030500 Bacteria 1122967
110 Ga0268256_1001045 3300030500 Bacteria 18558
111 Ga0268256_1024655 3300030500 Bacteria 1539
112 Ga0316181_1104051 3300030744 Bacteria 2966
113 Ga0307513_10393969 3300031456 Bacteria 1121
114 Ga0307405_10001214 3300031731 Bacteria 10697
115 Ga0307409_100326481 3300031995 Bacteria 1438
116 Ga0237816_05099 3300039145 Bacteria 893
117 Ga0451839_1141850 3300041496 Bacteria 1408
118 Ga0451851_0996587 3300041507 Bacteria 1743
119 Ga0439449_0079386 3300042007 Bacteria 1210
120 Ga0466963_0006012 3300044694 Bacteria 7153
121 Ga0466964_0119789 3300044706 Bacteria 1185
122 Ga0466971_0353596 3300044719 Bacteria 711
123 Ga0466970_0002423 3300044765 Bacteria 9013
124 Ga0466959_0083086 3300045049 Bacteria 2307
125 Ga0466958_0028939 3300045836 Bacteria 3287
126 Ga0495638_0000309 3300046460 Bacteria 62979
127 Ga0495605_0044645 3300046474 Bacteria 2190
128 Ga0495585_0007664 3300046492 Bacteria 6585
129 Ga0495585_0295888 3300046492 Bacteria 797
130 Ga0495607_0036346 3300046501 Bacteria 2968
131 Ga0495607_0045858 3300046501 Bacteria 2569
132 Ga0495583_0010874 3300046506 Bacteria 5264
133 Ga0495583_0221428 3300046506 Bacteria 765
134 Ga0495606_0032048 3300046507 Bacteria 3646
135 Ga0495610_0026318 3300046512 Bacteria 3107
136 Ga0495616_0138675 3300046513 Bacteria 1109
137 Ga0495620_0027884 3300046515 Bacteria 2635
138 Ga0495631_0000183 3300046518 Bacteria 42831
139 Ga0495632_0026003 3300046519 Bacteria 3088
140 Ga0495643_0117557 3300046522 Bacteria 1346
141 Ga0495648_0328647 3300046524 Bacteria 706
142 Ga0495654_0056302 3300046530 Bacteria 1901
143 Ga0495654_0150289 3300046530 Bacteria 1031
144 Ga0495609_0020012 3300046538 Bacteria 3094
145 Ga0495597_0011754 3300046542 Bacteria 4239
146 Ga0495633_0022585 3300046558 Bacteria 3128
147 Ga0495656_0038794 3300046615 Bacteria 1975
148 Ga0495668_0003690 3300046616 Bacteria 11301
149 Ga0495668_0021414 3300046616 Bacteria 3707
150 Ga0495625_0000737 3300046660 Bacteria 45851
151 Ga0495625_0090226 3300046660 Bacteria 2120
152 Ga0495588_0001583 3300046674 Bacteria 9717
153 Ga0495670_0017047 3300046691 Bacteria 3572
154 Ga0495671_0231196 3300046692 Bacteria 894
155 Ga0495649_0033548 3300046694 Bacteria 2825
156 Ga0495589_0054692 3300046794 Bacteria 1968
157 Ga0495660_0032311 3300046810 Bacteria 2939
158 Ga0495636_0454111 3300047318 Bacteria 616
159 Ga0495672_0037878 3300047320 Bacteria 2947
160 Ga0495672_0270160 3300047320 Bacteria 817
161 Ga0495687_085084 3300047443 Bacteria 1227
162 Ga0495681_0003433 3300047470 Bacteria 11025
163 Ga0495681_0148472 3300047470 Bacteria 985
164 Ga0495686_0030092 3300047472 Bacteria 3528
165 Ga0495686_0038657 3300047472 Bacteria 3051
166 Ga0495686_0253194 3300047472 Bacteria 989
167 Ga0495615_0092559 3300048090 Bacteria 844
168 Ga0496113_0027055 3300048916 Bacteria 4108
169 Ga0496114_0733607 3300048917 Bacteria 865
170 Ga0496116_0000471 3300048919 Bacteria 55687
171 Ga0496116_0022864 3300048919 Bacteria 4669
172 Ga0496116_0082089 3300048919 Bacteria 1995
173 Ga0496116_0176226 3300048919 Bacteria 1151
174 Ga0496117_0259778 3300048920 Bacteria 942
175 Ga0496118_0000792 3300048921 Bacteria 50632
176 Ga0496118_0109796 3300048921 Bacteria 1834
177 Ga0496118_0211435 3300048921 Bacteria 1138
178 Ga0496119_0027714 3300048922 Bacteria 3885
179 Ga0496119_0095144 3300048922 Bacteria 1683
180 Ga0496119_0098946 3300048922 Bacteria 1641
181 Ga0496119_0288831 3300048922 Bacteria 813
182 Ga0496120_0000019 3300048923 Bacteria 260115
183 Ga0496120_0070634 3300048923 Bacteria 1920
184 Ga0496121_0000003 3300048924 Bacteria 1191431
185 Ga0496121_0016496 3300048924 Bacteria 7622
186 Ga0496121_0050369 3300048924 Bacteria 3519
187 Ga0496122_0000053 3300048925 Bacteria 260120
188 Ga0496122_0016018 3300048925 Bacteria 7125
189 Ga0496122_0062944 3300048925 Bacteria 2712
190 Ga0496122_0175536 3300048925 Bacteria 1285
191 Ga0496122_0204055 3300048925 Bacteria 1152
192 Ga0496122_0277662 3300048925 Bacteria 918
193 Ga0496123_0000038 3300048926 Bacteria 260120
194 Ga0496123_0012214 3300048926 Bacteria 7347
195 Ga0496123_0023449 3300048926 Bacteria 4722
196 Ga0496123_0089795 3300048926 Bacteria 1829
197 Ga0496124_0000139 3300048927 Bacteria 149873
198 Ga0496125_0000170 3300048928 Bacteria 145369
199 Ga0496125_0013504 3300048928 Bacteria 8023
200 Ga0496125_0065776 3300048928 Bacteria 2869
201 Ga0496126_0002372 3300048929 Bacteria 25676
202 Ga0496126_0251787 3300048929 Bacteria 1471
203 Ga0501033_0090710 3300049570 Bacteria 2236
204 Ga0501037_0124800 3300049573 Bacteria 1849
205 nmdc:mga03683_3040_c1 3300050489 Bacteria 5319
206 nmdc:mga03683_999_c1 3300050489 Bacteria 8263
207 nmdc:mga03n38_21459_c1 3300050490 Bacteria 2599
208 nmdc:mga03n38_7057_c1 3300050490 Bacteria 3949
209 nmdc:mga03n38_94363_c1 3300050490 Bacteria 1431
210 nmdc:mga00v17_55_c1 3300050491 Bacteria 72029
211 nmdc:mga00v17_74130_c1 3300050491 Bacteria 2114
212 nmdc:mga0yw44_19283_c1 3300050492 Bacteria 3758
213 nmdc:mga0yw44_206207_c1 3300050492 Bacteria 1299
214 nmdc:mga0k408_10742_c1 3300050493 Bacteria 4961
215 nmdc:mga0k408_6389_c1 3300050493 Bacteria 6292
216 nmdc:mga06z11_124079_c1 3300050494 Bacteria 1444
217 nmdc:mga06z11_158899_c1 3300050494 Bacteria 1290
218 nmdc:mga04h51_158404_c1 3300050495 Bacteria 870
219 nmdc:mga07m45_131204_c1 3300050496 Bacteria 1450
220 nmdc:mga0sz30_163003_c1 3300050516 Bacteria 988
221 nmdc:mga0sz30_32_c1 3300050516 Bacteria 54057
222 nmdc:mga0sz30_96186_c1 3300050516 Bacteria 1291
223 Ga0500610_0019161 3300053079 Bacteria 3322
224 Ga0495655_0166595 3300053083 Bacteria 703
225 Ga0500578_0122182 3300053086 Bacteria 1636
226 Ga0500643_028054 3300053087 Bacteria 1744
227 Ga0500557_003696 3300053105 Bacteria 3086
228 Ga0500560_001860 3300053107 Bacteria 3833
229 Ga0500560_018739 3300053107 Bacteria 1935
230 Ga0500569_000359 3300053109 Bacteria 7363
231 Ga0500572_009958 3300053111 Bacteria 2260
232 Ga0500594_0013414 3300053118 Bacteria 1947
233 Ga0500628_160308 3300053129 Bacteria 634
234 Ga0500642_0171437 3300053130 Bacteria 1016
235 Ga0500652_182225 3300053131 Bacteria 860
236 Ga0500658_0090477 3300053134 Bacteria 1322
237 Ga0500561_0000550 3300053137 Bacteria 6036
238 Ga0500568_0001296 3300053139 Bacteria 16418
239 Ga0500577_0117783 3300053142 Bacteria 1103
240 Ga0500588_0121951 3300053146 Bacteria 920
241 Ga0500616_0000980 3300053153 Bacteria 30834
242 Ga0500624_000559 3300053157 Bacteria 10401
243 Ga0500627_0019145 3300053158 Bacteria 2723
244 Ga0500634_0050221 3300053161 Bacteria 2247
245 Ga0500634_0056384 3300053161 Bacteria 2099
246 Ga0500636_0000245 3300053177 Bacteria 29922
247 Ga0500636_0007000 3300053177 Bacteria 6501
248 Ga0500611_053942 3300053727 Bacteria 930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2841911363 2841916961 178
2 iso_pu_bacteria 2841917233 2841922582 178
3 iso_pu_bacteria 2899803654 2899806540 181
4 iso_pu_bacteria 2537561587 2537876448 182
5 iso_pu_bacteria 2554235003 2554245237 182
6 iso_pu_bacteria 2558860242 2559296933 182
7 iso_pu_bacteria 2600255279 2601611220 182
8 iso_pu_bacteria 2600255308 2601747993 182
9 iso_pu_bacteria 2643221568 2643858264 182
10 iso_pu_bacteria 2643221582 2643916961 182
11 iso_pu_bacteria 2643221693 2644521175 182
12 iso_pu_bacteria 2808606387 2808987449 182
13 iso_pu_bacteria 2818991439 2819557232 182
14 iso_pu_bacteria 2838675328 2838678226 182
15 iso_pu_bacteria 2838714209 2838716868 182
16 iso_pu_bacteria 2838719591 2838722522 182
17 iso_pu_bacteria 2838724970 2838727617 182
18 iso_pu_bacteria 2841846520 2841849223 182
19 iso_pu_bacteria 2842124991 2842128028 182
20 iso_pu_bacteria 2842130223 2842133119 182
21 iso_pu_bacteria 2842152218 2842155113 182
22 iso_pu_bacteria 2842170452 2842173612 182
23 iso_pu_bacteria 2842175837 2842178734 182
24 iso_pu_bacteria 2842187318 2842189975 182
25 iso_pu_bacteria 2842211629 2842214289 182
26 iso_pu_bacteria 2842224351 2842227008 182
27 iso_pu_bacteria 2842515876 2842518028 182
28 iso_pu_bacteria 2899845264 2899845469 182
29 iso_pu_bacteria 2919114240 2919117059 182
30 iso_pu_bacteria 2919166419 2919169769 182
31 iso_pu_bacteria 2926754445 2926758572 182
32 iso_pu_bacteria 2926760298 2926763896 182
33 iso_pu_bacteria 2933006813 2933009508 182
34 iso_pu_bacteria 2933594066 2933598101 182
35 iso_pu_bacteria 2978969890 2978972188 182
36 iso_pu_bacteria 2979089926 2979091006 182
37 iso_pu_bacteria 2979095461 2979096532 182
38 iso_pu_bacteria 2979100975 2979102264 182
39 iso_pu_bacteria 2984509177 2984509788 182
40 iso_pu_bacteria 2984518228 2984519515 182
41 iso_pu_bacteria 2984537506 2984538126 182
42 iso_pu_bacteria 2984587000 2984590414 182
43 iso_pu_bacteria 2984601300 2984604878 182
44 iso_pu_bacteria 650716007 650843354 182
45 iso_pu_bacteria 8003570095 8003572950 182
46 iso_pu_bacteria 8054460903 8054463353 182
47 iso_pu_bacteria 2509276021 2509389969 183
48 iso_pu_bacteria 2509276033 2509447796 183
49 iso_pu_bacteria 2510917022 2511136695 183
50 iso_pu_bacteria 2513237084 2513573238 183
51 iso_pu_bacteria 2513237085 2513578509 183
52 iso_pu_bacteria 2515154134 2515743521 183
53 iso_pu_bacteria 2516653085 2517077710 183
54 iso_pu_bacteria 2519899620 2520381209 183
55 iso_pu_bacteria 2529292951 2530646826 183
56 iso_pu_bacteria 2582581307 2585274148 183
57 iso_pu_bacteria 2585427526 2585529620 183
58 iso_pu_bacteria 2585427528 2585541146 183
59 iso_pu_bacteria 2585427531 2585560597 183
60 iso_pu_bacteria 2585427593 2585839909 183
61 iso_pu_bacteria 2585427594 2585845199 183
62 iso_pu_bacteria 2585427609 2585903605 183
63 iso_pu_bacteria 2585428125 2587981275 183
64 iso_pu_bacteria 2615840624 2616295430 183
65 iso_pu_bacteria 2643221599 2644006272 183
66 iso_pu_bacteria 2718217882 2719182478 183
67 iso_pu_bacteria 2718217927 2719387137 183
68 iso_pu_bacteria 2718217997 2719666781 183
69 iso_pu_bacteria 2718218009 2719733197 183
70 iso_pu_bacteria 2718218199 2720493201 183
71 iso_pu_bacteria 2718218232 2720614678 183
72 iso_pu_bacteria 2718218235 2720632779 183
73 iso_pu_bacteria 2718218269 2720776503 183
74 iso_pu_bacteria 2718218363 2721148591 183
75 iso_pu_bacteria 2718218366 2721165405 183
76 iso_pu_bacteria 2718218423 2721400772 183
77 iso_pu_bacteria 2721755514 2722841575 183
78 iso_pu_bacteria 2721755556 2723028091 183
79 iso_pu_bacteria 2721755684 2723561722 183
80 iso_pu_bacteria 2721755685 2723568351 183
81 iso_pu_bacteria 2721755809 2724039585 183
82 iso_pu_bacteria 2721755810 2724045953 183
83 iso_pu_bacteria 2721755819 2724091110 183
84 iso_pu_bacteria 2721755822 2724105616 183
85 iso_pu_bacteria 2721755823 2724111443 183
86 iso_pu_bacteria 2728369352 2730109027 183
87 iso_pu_bacteria 2728369365 2730165713 183
88 iso_pu_bacteria 2738541333 2739035698 183
89 iso_pu_bacteria 2775507266 2778175874 183
90 iso_pu_bacteria 2791355256 2793293768 183
91 iso_pu_bacteria 2791355259 2793313186 183
92 iso_pu_bacteria 2791355261 2793328149 183
93 iso_pu_bacteria 2791355262 2793333247 183
94 iso_pu_bacteria 2791355263 2793343808 183
95 iso_pu_bacteria 2791355264 2793347249 183
96 iso_pu_bacteria 2791355265 2793356613 183
97 iso_pu_bacteria 2791355266 2793362926 183
98 iso_pu_bacteria 2791355267 2793370048 183
99 iso_pu_bacteria 2802429633 2806044685 183
100 iso_pu_bacteria 2802429634 2806052885 183
101 iso_pu_bacteria 2802429635 2806059185 183
102 iso_pu_bacteria 2802429636 2806068152 183
103 iso_pu_bacteria 2802429637 2806074272 183
104 iso_pu_bacteria 2838016132 2838018978 183
105 iso_pu_bacteria 2838029111 2838032993 183
106 iso_pu_bacteria 2838048938 2838051306 183
107 iso_pu_bacteria 2838061910 2838063716 183
108 iso_pu_bacteria 2838680041 2838685086 183
109 iso_pu_bacteria 2838686498 2838691456 183
110 iso_pu_bacteria 2838694306 2838699077 183
111 iso_pu_bacteria 2838707686 2838712558 183
112 iso_pu_bacteria 2838729681 2838733415 183
113 iso_pu_bacteria 2838742623 2838746013 183
114 iso_pu_bacteria 2841851746 2841853725 183
115 iso_pu_bacteria 2841864319 2841868310 183
116 iso_pu_bacteria 2842077413 2842082035 183
117 iso_pu_bacteria 2842118031 2842122957 183
118 iso_pu_bacteria 2842156927 2842162268 183
119 iso_pu_bacteria 2842163707 2842169824 183
120 iso_pu_bacteria 2842180545 2842185194 183
121 iso_pu_bacteria 2842205361 2842208177 183
122 iso_pu_bacteria 2842229732 2842233681 183
123 iso_pu_bacteria 2842237096 2842242140 183
124 iso_pu_bacteria 2842243621 2842247725 183
125 iso_pu_bacteria 2842257432 2842262007 183
126 iso_pu_bacteria 2842264693 2842266484 183
127 iso_pu_bacteria 2842271015 2842275930 183
128 iso_pu_bacteria 2842278818 2842281814 183
129 iso_pu_bacteria 2842285085 2842288919 183
130 iso_pu_bacteria 2842291075 2842296035 183
131 iso_pu_bacteria 2842304105 2842308086 183
132 iso_pu_bacteria 2842311132 2842316177 183
133 iso_pu_bacteria 2842341865 2842344868 183
134 iso_pu_bacteria 2842363717 2842369353 183
135 iso_pu_bacteria 2842370503 2842377153 183
136 iso_pu_bacteria 2842377471 2842382434 183
137 iso_pu_bacteria 2842384541 2842389835 183
138 iso_pu_bacteria 2842395702 2842398657 183
139 iso_pu_bacteria 2842402390 2842406414 183
140 iso_pu_bacteria 2842409023 2842413159 183
141 iso_pu_bacteria 2842415677 2842419802 183
142 iso_pu_bacteria 2842428310 2842429803 183
143 iso_pu_bacteria 2842434925 2842436537 183
144 iso_pu_bacteria 2842441272 2842444240 183
145 iso_pu_bacteria 2842447887 2842450899 183
146 iso_pu_bacteria 2842462802 2842464224 183
147 iso_pu_bacteria 2842469257 2842470866 183
148 iso_pu_bacteria 2842475841 2842479726 183
149 iso_pu_bacteria 2842482326 2842483530 183
150 iso_pu_bacteria 2842502639 2842506902 183
151 iso_pu_bacteria 2844454524 2844457630 183
152 iso_pu_bacteria 2852387548 2852391038 183
153 iso_pu_bacteria 2919408235 2919410538 183
154 iso_pu_bacteria 2929138655 2929141287 183
155 iso_pu_bacteria 2933570622 2933574535 183
156 iso_pu_bacteria 2935894831 2935899861 183
157 iso_pu_bacteria 2935901341 2935907033 183
158 iso_pu_bacteria 2936381700 2936382137 183
159 iso_pu_bacteria 2996893221 2996895916 183
160 iso_pu_bacteria 3005452660 3005455416 183
161 iso_pu_bacteria 8005275841 8005281864 183
162 iso_pu_bacteria 8005282627 8005288858 183
163 iso_pu_bacteria 8005289223 8005294421 183
164 iso_pu_bacteria 8005307578 8005310824 183
165 iso_pu_bacteria 8005430974 8005434252 183
166 iso_pu_bacteria 8005497431 8005501529 183
167 iso_pu_bacteria 8005570704 8005575071 183
168 iso_pu_bacteria 8005619151 8005622890 183
169 iso_pu_bacteria 8005626139 8005631809 183
170 iso_pu_bacteria 8005668836 8005672950 183
171 iso_pu_bacteria 8005695170 8005700718 183
172 iso_pu_bacteria 8018127388 8018133743 183
173 iso_pu_bacteria 8018176218 8018178590 183
174 iso_pu_bacteria 8023680758 8023687687 183
175 iso_pu_bacteria 8046767195 8046772046 183
176 iso_pu_bacteria 8056375014 8056381454 183
177 iso_pu_bacteria 8056382006 8056386899 183
178 iso_pu_bacteria 2775507049 2776914447 184
179 3300003771 Ga0055526_1001101 Ga0055526_100110121 185
180 3300003771 Ga0055526_1001710 Ga0055526_10017108 185
181 3300003775 Ga0055524_1026876 Ga0055524_10268763 185
182 3300025294 Ga0209025_1048109 Ga0209025_10481092 185
183 3300025295 Ga0209564_1000023 Ga0209564_1000023514 185
184 3300025299 Ga0209256_1000608 Ga0209256_100060842 185
185 3300039145 Ga0237816_05099 Ga0237816_05099_69_644 185
186 3300046506 Ga0495583_0221428 Ga0495583_0221428_76_639 185
187 3300003856 Ga0058692_1003553 Ga0058692_10035536 186
188 3300005289 Ga0065704_10197681 Ga0065704_101976811 186
189 3300006051 Ga0075364_10070467 Ga0075364_100704673 186
190 3300006177 Ga0075362_10001896 Ga0075362_100018966 186
191 3300006186 Ga0075369_10067745 Ga0075369_100677453 186
192 3300006186 Ga0075369_10176948 Ga0075369_101769483 186
193 3300006186 Ga0075369_10392234 Ga0075369_103922341 186
194 3300006948 Ga0099826_10001733 Ga0099826_1000173313 186
195 3300006948 Ga0099826_10009637 Ga0099826_100096374 186
196 3300009148 Ga0105243_10038802 Ga0105243_100388025 186
197 3300011119 Ga0105246_10008513 Ga0105246_100085135 186
198 3300013100 Ga0157373_10015960 Ga0157373_100159603 186
199 3300013102 Ga0157371_10000002 Ga0157371_10000002114 186
200 3300013250 Ga0171462_1038 Ga0171462_103826 186
201 3300013307 Ga0157372_10381510 Ga0157372_103815102 186
202 3300013307 Ga0157372_10418395 Ga0157372_104183952 186
203 3300025935 Ga0207709_10210639 Ga0207709_102106391 186
204 3300025981 Ga0207640_10928013 Ga0207640_109280132 186
205 3300027312 Ga0209371_1000003 Ga0209371_1000003751 186
206 3300027312 Ga0209371_1001970 Ga0209371_10019702 186
207 3300027312 Ga0209371_1024435 Ga0209371_10244352 186
208 3300027666 Ga0209282_1006950 Ga0209282_10069506 186
209 3300027666 Ga0209282_1007748 Ga0209282_10077484 186
210 3300027866 Ga0209813_10013376 Ga0209813_100133763 186
211 3300030500 Ga0268256_1000004 Ga0268256_1000004299 186
212 3300030500 Ga0268256_1001045 Ga0268256_100104513 186
213 3300030500 Ga0268256_1024655 Ga0268256_10246553 186
214 3300030744 Ga0316181_1104051 Ga0316181_11040514 186
215 3300031456 Ga0307513_10393969 Ga0307513_103939692 186
216 3300031995 Ga0307409_100326481 Ga0307409_1003264812 186
217 3300048090 Ga0495615_0092559 Ga0495615_0092559_23_583 186
218 3300048916 Ga0496113_0027055 Ga0496113_0027055_3066_3644 186
219 3300048919 Ga0496116_0000471 Ga0496116_0000471_15047_15613 186
220 3300048919 Ga0496116_0022864 Ga0496116_0022864_405_983 186
221 3300048919 Ga0496116_0176226 Ga0496116_0176226_38_616 186
222 3300048920 Ga0496117_0259778 Ga0496117_0259778_194_772 186
223 3300048921 Ga0496118_0000792 Ga0496118_0000792_15432_16010 186
224 3300048921 Ga0496118_0109796 Ga0496118_0109796_648_1226 186
225 3300048921 Ga0496118_0211435 Ga0496118_0211435_334_915 186
226 3300048922 Ga0496119_0027714 Ga0496119_0027714_766_1344 186
227 3300048922 Ga0496119_0288831 Ga0496119_0288831_217_783 186
228 3300048923 Ga0496120_0000019 Ga0496120_0000019_34623_35201 186
229 3300048923 Ga0496120_0070634 Ga0496120_0070634_1256_1834 186
230 3300048925 Ga0496122_0000053 Ga0496122_0000053_34623_35201 186
231 3300048925 Ga0496122_0016018 Ga0496122_0016018_5040_5621 186
232 3300048925 Ga0496122_0175536 Ga0496122_0175536_395_961 186
233 3300048925 Ga0496122_0277662 Ga0496122_0277662_317_883 186
234 3300048926 Ga0496123_0000038 Ga0496123_0000038_34623_35201 186
235 3300048926 Ga0496123_0012214 Ga0496123_0012214_5040_5621 186
236 3300048926 Ga0496123_0089795 Ga0496123_0089795_1089_1655 186
237 3300048928 Ga0496125_0013504 Ga0496125_0013504_1410_1988 186
238 3300048929 Ga0496126_0002372 Ga0496126_0002372_14910_15476 186
239 3300048929 Ga0496126_0251787 Ga0496126_0251787_150_728 186
240 3300049570 Ga0501033_0090710 Ga0501033_0090710_108_689 186
241 3300049573 Ga0501037_0124800 Ga0501037_0124800_450_1031 186
242 3300050489 nmdc:mga03683_999_c1 nmdc:mga03683_999_c1_6316_6894 186
243 3300050490 nmdc:mga03n38_7057_c1 nmdc:mga03n38_7057_c1_253_831 186
244 3300050491 nmdc:mga00v17_55_c1 nmdc:mga00v17_55_c1_66599_67177 186
245 3300050491 nmdc:mga00v17_74130_c1 nmdc:mga00v17_74130_c1_562_1143 186
246 3300050492 nmdc:mga0yw44_19283_c1 nmdc:mga0yw44_19283_c1_2262_2840 186
247 3300050493 nmdc:mga0k408_6389_c1 nmdc:mga0k408_6389_c1_4929_5507 186
248 3300050494 nmdc:mga06z11_124079_c1 nmdc:mga06z11_124079_c1_253_831 186
249 3300050495 nmdc:mga04h51_158404_c1 nmdc:mga04h51_158404_c1_253_831 186
250 3300050516 nmdc:mga0sz30_163003_c1 nmdc:mga0sz30_163003_c1_12_593 186
251 3300050516 nmdc:mga0sz30_32_c1 nmdc:mga0sz30_32_c1_25656_26234 186
252 3300050516 nmdc:mga0sz30_96186_c1 nmdc:mga0sz30_96186_c1_628_1209 186
253 3300053111 Ga0500572_009958 Ga0500572_009958_199_774 186
254 3300053137 Ga0500561_0000550 Ga0500561_0000550_166_744 186
255 3300053177 Ga0500636_0007000 Ga0500636_0007000_4000_4575 186
256 iso_pu_bacteria 2818991467 2819717469 186
257 iso_pu_bacteria 2917699015 2917700978 186
258 iso_pu_bacteria 8055431914 8055432136 186
259 3300002737 JGI25162J39368_1002218 JGI25162J39368_10022188 187
260 3300002773 JGI25152J39213_1000691 JGI25152J39213_10006916 187
261 3300002774 JGI25150J39212_1000144 JGI25150J39212_100014426 187
262 3300002987 JGI25159J45721_1000463 JGI25159J45721_100046313 187
263 3300003187 JGI25151J46595_10000031 JGI25151J46595_1000003130 187
264 3300003187 JGI25151J46595_10001277 JGI25151J46595_1000127720 187
265 3300003214 JGI25165J46597_1001184 JGI25165J46597_100118418 187
266 3300003215 JGI25153J46596_10000359 JGI25153J46596_1000035926 187
267 3300003215 JGI25153J46596_10023690 JGI25153J46596_100236904 187
268 3300003354 JGI25160J50197_1000100 JGI25160J50197_100010034 187
269 3300003354 JGI25160J50197_1000571 JGI25160J50197_10005715 187
270 3300003374 JGI25161J50226_1000072 JGI25161J50226_100007257 187
271 3300003374 JGI25161J50226_1002855 JGI25161J50226_10028555 187
272 3300003771 Ga0055526_1001414 Ga0055526_100141414 187
273 3300003775 Ga0055524_1012760 Ga0055524_10127602 187
274 3300003790 Ga0055528_1004911 Ga0055528_10049112 187
275 3300003790 Ga0055528_1013098 Ga0055528_10130984 187
276 3300003790 Ga0055528_1036692 Ga0055528_10366922 187
277 3300003792 Ga0055540_1000752 Ga0055540_100075211 187
278 3300003792 Ga0055540_1012755 Ga0055540_10127552 187
279 3300004625 Ga0055543_1000078 Ga0055543_100007857 187
280 3300004625 Ga0055543_1000757 Ga0055543_10007579 187
281 3300005262 Ga0065165_1000623 Ga0065165_100062334 187
282 3300006038 Ga0075365_10004947 Ga0075365_100049477 187
283 3300006038 Ga0075365_10284397 Ga0075365_102843971 187
284 3300006048 Ga0075363_100019290 Ga0075363_1000192903 187
285 3300006048 Ga0075363_100137557 Ga0075363_1001375571 187
286 3300006048 Ga0075363_100163720 Ga0075363_1001637202 187
287 3300006051 Ga0075364_10255926 Ga0075364_102559261 187
288 3300006177 Ga0075362_10001071 Ga0075362_100010714 187
289 3300006178 Ga0075367_10000817 Ga0075367_1000081715 187
290 3300006178 Ga0075367_10123016 Ga0075367_101230163 187
291 3300006178 Ga0075367_10167306 Ga0075367_101673062 187
292 3300006186 Ga0075369_10002318 Ga0075369_100023181 187
293 3300006195 Ga0075366_10021380 Ga0075366_100213802 187
294 3300006195 Ga0075366_10315202 Ga0075366_103152021 187
295 3300006353 Ga0075370_10009138 Ga0075370_100091385 187
296 3300006353 Ga0075370_10030815 Ga0075370_100308154 187
297 3300009765 Ga0123341_1000014 Ga0123341_100001437 187
298 3300009766 Ga0123342_1016716 Ga0123342_10167168 187
299 3300013102 Ga0157371_10097243 Ga0157371_100972432 187
300 3300013105 Ga0157369_10173296 Ga0157369_101732964 187
301 3300013306 Ga0163162_10969743 Ga0163162_109697432 187
302 3300025208 Ga0209436_103716 Ga0209436_1037164 187
303 3300025231 Ga0207427_108308 Ga0207427_1083082 187
304 3300025233 Ga0209437_100058 Ga0209437_100058284 187
305 3300025233 Ga0209437_100313 Ga0209437_10031349 187
306 3300025245 Ga0207425_1000058 Ga0207425_100005875 187
307 3300025245 Ga0207425_1040035 Ga0207425_10400351 187
308 3300025246 Ga0209646_1004652 Ga0209646_10046523 187
309 3300025258 Ga0209129_1000107 Ga0209129_100010775 187
310 3300025258 Ga0209129_1000605 Ga0209129_100060513 187
311 3300025261 Ga0209233_1000157 Ga0209233_1000157141 187
312 3300025261 Ga0209233_1000354 Ga0209233_100035440 187
313 3300025273 Ga0209673_1000233 Ga0209673_100023331 187
314 3300025273 Ga0209673_1002817 Ga0209673_10028173 187
315 3300025273 Ga0209673_1016322 Ga0209673_10163224 187
316 3300025284 Ga0209130_1000083 Ga0209130_100008332 187
317 3300025284 Ga0209130_1013765 Ga0209130_10137653 187
318 3300025292 Ga0209676_1012841 Ga0209676_10128411 187
319 3300025294 Ga0209025_1000083 Ga0209025_100008375 187
320 3300025294 Ga0209025_1000350 Ga0209025_100035062 187
321 3300025294 Ga0209025_1010805 Ga0209025_10108053 187
322 3300025295 Ga0209564_1000125 Ga0209564_1000125117 187
323 3300025295 Ga0209564_1012865 Ga0209564_10128652 187
324 3300025297 Ga0209758_1000090 Ga0209758_1000090188 187
325 3300025297 Ga0209758_1001034 Ga0209758_100103425 187
326 3300025297 Ga0209758_1001490 Ga0209758_10014903 187
327 3300025298 Ga0209050_1010028 Ga0209050_10100283 187
328 3300025299 Ga0209256_1001684 Ga0209256_10016841 187
329 3300025299 Ga0209256_1006009 Ga0209256_10060093 187
330 3300025302 Ga0207426_1000173 Ga0207426_100017332 187
331 3300025302 Ga0207426_1000276 Ga0207426_100027628 187
332 3300025303 Ga0209051_1000217 Ga0209051_100021779 187
333 3300025303 Ga0209051_1020121 Ga0209051_10201214 187
334 3300025303 Ga0209051_1020638 Ga0209051_10206383 187
335 3300025304 Ga0209257_1003258 Ga0209257_10032583 187
336 3300027312 Ga0209371_1003973 Ga0209371_10039732 187
337 3300031731 Ga0307405_10001214 Ga0307405_100012142 187
338 3300041496 Ga0451839_1141850 Ga0451839_1141850_105_668 187
339 3300041507 Ga0451851_0996587 Ga0451851_0996587_1100_1663 187
340 3300042007 Ga0439449_0079386 Ga0439449_0079386_534_1097 187
341 3300044694 Ga0466963_0006012 Ga0466963_0006012_2378_2941 187
342 3300044706 Ga0466964_0119789 Ga0466964_0119789_513_1076 187
343 3300044719 Ga0466971_0353596 Ga0466971_0353596_121_684 187
344 3300044765 Ga0466970_0002423 Ga0466970_0002423_4242_4805 187
345 3300045049 Ga0466959_0083086 Ga0466959_0083086_1152_1715 187
346 3300045836 Ga0466958_0028939 Ga0466958_0028939_2203_2766 187
347 3300046460 Ga0495638_0000309 Ga0495638_0000309_23453_24016 187
348 3300046474 Ga0495605_0044645 Ga0495605_0044645_121_684 187
349 3300046492 Ga0495585_0007664 Ga0495585_0007664_785_1384 187
350 3300046492 Ga0495585_0295888 Ga0495585_0295888_82_651 187
351 3300046501 Ga0495607_0036346 Ga0495607_0036346_1630_2193 187
352 3300046501 Ga0495607_0045858 Ga0495607_0045858_1731_2330 187
353 3300046506 Ga0495583_0010874 Ga0495583_0010874_823_1422 187
354 3300046507 Ga0495606_0032048 Ga0495606_0032048_1345_1914 187
355 3300046512 Ga0495610_0026318 Ga0495610_0026318_2198_2761 187
356 3300046513 Ga0495616_0138675 Ga0495616_0138675_528_1091 187
357 3300046515 Ga0495620_0027884 Ga0495620_0027884_1423_1986 187
358 3300046518 Ga0495631_0000183 Ga0495631_0000183_35043_35642 187
359 3300046519 Ga0495632_0026003 Ga0495632_0026003_240_803 187
360 3300046522 Ga0495643_0117557 Ga0495643_0117557_456_1019 187
361 3300046524 Ga0495648_0328647 Ga0495648_0328647_32_595 187
362 3300046530 Ga0495654_0056302 Ga0495654_0056302_171_770 187
363 3300046530 Ga0495654_0150289 Ga0495654_0150289_313_876 187
364 3300046538 Ga0495609_0020012 Ga0495609_0020012_1147_1746 187
365 3300046542 Ga0495597_0011754 Ga0495597_0011754_2436_2999 187
366 3300046558 Ga0495633_0022585 Ga0495633_0022585_1639_2202 187
367 3300046615 Ga0495656_0038794 Ga0495656_0038794_1251_1814 187
368 3300046616 Ga0495668_0003690 Ga0495668_0003690_7267_7830 187
369 3300046616 Ga0495668_0021414 Ga0495668_0021414_1499_2062 187
370 3300046660 Ga0495625_0000737 Ga0495625_0000737_7125_7724 187
371 3300046660 Ga0495625_0090226 Ga0495625_0090226_618_1181 187
372 3300046674 Ga0495588_0001583 Ga0495588_0001583_4291_4872 187
373 3300046691 Ga0495670_0017047 Ga0495670_0017047_2624_3223 187
374 3300046692 Ga0495671_0231196 Ga0495671_0231196_281_844 187
375 3300046694 Ga0495649_0033548 Ga0495649_0033548_2218_2781 187
376 3300046794 Ga0495589_0054692 Ga0495589_0054692_178_741 187
377 3300046810 Ga0495660_0032311 Ga0495660_0032311_1714_2313 187
378 3300047318 Ga0495636_0454111 Ga0495636_0454111_26_589 187
379 3300047320 Ga0495672_0037878 Ga0495672_0037878_2343_2906 187
380 3300047320 Ga0495672_0270160 Ga0495672_0270160_22_585 187
381 3300047443 Ga0495687_085084 Ga0495687_085084_147_710 187
382 3300047470 Ga0495681_0003433 Ga0495681_0003433_9063_9644 187
383 3300047470 Ga0495681_0148472 Ga0495681_0148472_97_660 187
384 3300047472 Ga0495686_0030092 Ga0495686_0030092_2812_3375 187
385 3300047472 Ga0495686_0038657 Ga0495686_0038657_1310_1873 187
386 3300047472 Ga0495686_0253194 Ga0495686_0253194_208_774 187
387 3300048917 Ga0496114_0733607 Ga0496114_0733607_144_707 187
388 3300048919 Ga0496116_0082089 Ga0496116_0082089_1133_1711 187
389 3300048922 Ga0496119_0095144 Ga0496119_0095144_605_1183 187
390 3300048922 Ga0496119_0098946 Ga0496119_0098946_1045_1608 187
391 3300048924 Ga0496121_0000003 Ga0496121_0000003_903469_904047 187
392 3300048924 Ga0496121_0016496 Ga0496121_0016496_2194_2757 187
393 3300048924 Ga0496121_0050369 Ga0496121_0050369_1540_2103 187
394 3300048925 Ga0496122_0062944 Ga0496122_0062944_760_1377 187
395 3300048925 Ga0496122_0204055 Ga0496122_0204055_342_920 187
396 3300048926 Ga0496123_0023449 Ga0496123_0023449_10_588 187
397 3300048927 Ga0496124_0000139 Ga0496124_0000139_54410_54991 187
398 3300048928 Ga0496125_0000170 Ga0496125_0000170_118162_118740 187
399 3300048928 Ga0496125_0065776 Ga0496125_0065776_905_1468 187
400 3300050489 nmdc:mga03683_3040_c1 nmdc:mga03683_3040_c1_2873_3436 187
401 3300050490 nmdc:mga03n38_21459_c1 nmdc:mga03n38_21459_c1_436_999 187
402 3300050490 nmdc:mga03n38_94363_c1 nmdc:mga03n38_94363_c1_648_1211 187
403 3300050492 nmdc:mga0yw44_206207_c1 nmdc:mga0yw44_206207_c1_33_596 187
404 3300050493 nmdc:mga0k408_10742_c1 nmdc:mga0k408_10742_c1_1546_2109 187
405 3300050494 nmdc:mga06z11_158899_c1 nmdc:mga06z11_158899_c1_189_752 187
406 3300050496 nmdc:mga07m45_131204_c1 nmdc:mga07m45_131204_c1_701_1264 187
407 3300053079 Ga0500610_0019161 Ga0500610_0019161_1634_2233 187
408 3300053083 Ga0495655_0166595 Ga0495655_0166595_73_636 187
409 3300053086 Ga0500578_0122182 Ga0500578_0122182_875_1438 187
410 3300053087 Ga0500643_028054 Ga0500643_028054_719_1318 187
411 3300053105 Ga0500557_003696 Ga0500557_003696_617_1216 187
412 3300053107 Ga0500560_001860 Ga0500560_001860_1879_2460 187
413 3300053107 Ga0500560_018739 Ga0500560_018739_1158_1739 187
414 3300053109 Ga0500569_000359 Ga0500569_000359_1179_1778 187
415 3300053118 Ga0500594_0013414 Ga0500594_0013414_1222_1785 187
416 3300053129 Ga0500628_160308 Ga0500628_160308_17_580 187
417 3300053130 Ga0500642_0171437 Ga0500642_0171437_55_654 187
418 3300053131 Ga0500652_182225 Ga0500652_182225_22_585 187
419 3300053134 Ga0500658_0090477 Ga0500658_0090477_19_582 187
420 3300053139 Ga0500568_0001296 Ga0500568_0001296_7154_7717 187
421 3300053142 Ga0500577_0117783 Ga0500577_0117783_517_1080 187
422 3300053146 Ga0500588_0121951 Ga0500588_0121951_12_611 187
423 3300053153 Ga0500616_0000980 Ga0500616_0000980_5696_6259 187
424 3300053157 Ga0500624_000559 Ga0500624_000559_9395_9976 187
425 3300053158 Ga0500627_0019145 Ga0500627_0019145_1003_1602 187
426 3300053161 Ga0500634_0050221 Ga0500634_0050221_480_1061 187
427 3300053161 Ga0500634_0056384 Ga0500634_0056384_168_743 187
428 3300053177 Ga0500636_0000245 Ga0500636_0000245_12057_12674 187
429 3300053727 Ga0500611_053942 Ga0500611_053942_332_895 187
430 iso_pu_bacteria 2933011516 2933013657 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

10

177

0.9

PF12867

DinB_2

DinB superfamily

21

149

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.828 7 164
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8045 13 150
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7933 1 158
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.788 10 158
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.7865 7 164
ID Description Score Start End Superfamily
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8208 12 164 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.783 12 164 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7574 16 148 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7566 3 150 1.20.120.450
2p1aA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7548 13 150 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A6I1JB80-F1-model_v4 Putative damage inducible protein 0.9867 5 143
AF-A0A3D0I7P7-F1-model_v4 Damage-inducible protein DinB 0.9778 7 179
AF-A0A7C1PF62-F1-model_v4 Damage-inducible protein DinB 0.9764 4 186
AF-A0A367U879-F1-model_v4 Damage-inducible protein DinB 0.9717 9 181
AF-A0A534V312-F1-model_v4 Damage-inducible protein DinB 0.9713 4 126

Feature Viewer

pLDDT pTM Quality
91.03 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map