F442181

General Info

Members Datasets Scaffolds Average Seq Length
430 220 425 381

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0112400|Ga0373925_0112400_44_1402
Length 452
Sequence LINTCLGADIHLTSEVTEEDRENNSRSQGPRMTDEASHCGDQSINRTIAASLKRSCKMKPAHRQAVSEVSILPDSRDDSLELSDLIGEVYDTVLDQSLWQGVIERAARFVRGSGASLFSKNVANQEGSVQYEFGIDPHYKRLYFEKYVMLDPATTGHFLAEIDQPVAVADLMSPAEFLETRFYREWVQPQGLVDFVSAVLDKSATSAALFGVFRSERDGMVDDETRRRMRLIVPHIRRAVLIGRMFDLKAAEAATFADTLDGLSVGMCLVDASGRIVHANAAGYAIIGAGEILRSAGGRLVAHDAQVDKTLRETFAAAGQGDGALGTMGIAVPLTGKDGERYVAHVLPLTSGARRRAGKTYTAAAALFVRKAAMEVPSAFEVIGKTFKLTPTELRVLLAIVDVGGVPEVAAALGVAVTTVKTHLGRLFEKTGATRQADLVKLVAGYATPLSG

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
3 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
4 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
214 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
219 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
220 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0.7
Rhizoplane 7.21
Rhizosphere 82.79
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10235605 3300003320 Bacteria 1951
2 Ga0070666_10145976 3300005335 Bacteria 1649
3 Ga0070680_100033603 3300005336 Bacteria 4136
4 Ga0070680_100058089 3300005336 Bacteria 3163
5 Ga0070689_100057735 3300005340 Bacteria 3013
6 Ga0070691_10051410 3300005341 Bacteria 1968
7 Ga0070667_100085940 3300005367 Bacteria 2698
8 Ga0070709_10019266 3300005434 Bacteria 3942
9 Ga0070714_100018663 3300005435 Bacteria 5640
10 Ga0070714_100024827 3300005435 Plasmid 4940
11 Ga0070713_100016223 3300005436 Bacteria 5598
12 Ga0070713_100026518 3300005436 Bacteria 4550
13 Ga0070711_100034904 3300005439 Bacteria 3358
14 Ga0070711_100308148 3300005439 Bacteria 1261
15 Ga0070663_100072584 3300005455 Bacteria 2508
16 Ga0070681_10006312 3300005458 Bacteria 11525
17 Ga0068867_100111419 3300005459 Bacteria 2103
18 Ga0070707_100292439 3300005468 Bacteria 1583
19 Ga0070684_100099903 3300005535 Bacteria 2590
20 Ga0068853_100237067 3300005539 Unclassified 1671
21 Ga0070672_100226179 3300005543 Unclassified 1570
22 Ga0070672_100250722 3300005543 Unclassified 1491
23 Ga0070693_100002862 3300005547 Bacteria 7955
24 Ga0068855_100133716 3300005563 Bacteria 2831
25 Ga0070664_100129486 3300005564 Unclassified 2216
26 Ga0068854_100149039 3300005578 Bacteria 1802
27 Ga0068856_100180419 3300005614 Bacteria 2124
28 Ga0068852_100013691 3300005616 Bacteria 6214
29 Ga0068852_100348416 3300005616 Bacteria 1445
30 Ga0068858_100119139 3300005842 Bacteria 2468
31 Ga0068858_100168568 3300005842 Bacteria 2064
32 Ga0068860_100001170 3300005843 Bacteria 28729
33 Ga0070717_10301701 3300006028 Bacteria 1424
34 Ga0070715_10026589 3300006163 Bacteria 2303
35 Ga0075366_10023294 3300006195 Bacteria 3607
36 Ga0075370_10016780 3300006353 Bacteria 3945
37 Ga0075428_100083537 3300006844 Bacteria 3484
38 Ga0075430_100025160 3300006846 Bacteria 5062
39 Ga0075431_100025700 3300006847 Bacteria 6035
40 Ga0075434_100070885 3300006871 Bacteria 3476
41 Ga0075434_100194560 3300006871 Unclassified 2048
42 Ga0075434_100315934 3300006871 Bacteria 1583
43 Ga0068865_100084476 3300006881 Unclassified 2287
44 Ga0075435_100020700 3300007076 Bacteria 5048
45 Ga0075435_100103242 3300007076 Bacteria 2364
46 Ga0099794_10001293 3300007265 Bacteria 8683
47 Ga0099794_10007247 3300007265 Bacteria 4544
48 Ga0099794_10007504 3300007265 Bacteria 4486
49 Ga0099794_10028280 3300007265 Bacteria 2607
50 Ga0099795_10002049 3300007788 Bacteria 4625
51 Ga0099795_10014082 3300007788 Bacteria 2471
52 Ga0105247_10014123 3300009101 Bacteria 4790
53 Ga0105247_10030717 3300009101 Bacteria 3258
54 Ga0105247_10084703 3300009101 Bacteria 2003
55 Ga0105243_10093684 3300009148 Bacteria 2479
56 Ga0105242_10100229 3300009176 Bacteria 2453
57 Ga0105242_10227718 3300009176 Bacteria 1669
58 Ga0105248_10013866 3300009177 Bacteria 8868
59 Ga0105238_10011135 3300009551 Bacteria 9044
60 Ga0105238_10059253 3300009551 Bacteria 3836
61 Ga0105249_10098335 3300009553 Bacteria 2748
62 Ga0105249_10248451 3300009553 Bacteria 1762
63 Ga0099796_10004574 3300010159 Bacteria 3366
64 Ga0099796_10004988 3300010159 Bacteria 3271
65 Ga0157369_10123607 3300013105 Bacteria 2745
66 Ga0157369_10138442 3300013105 Bacteria 2576
67 Ga0163162_10051142 3300013306 Plasmid 4145
68 Ga0157372_10221628 3300013307 Bacteria 2192
69 Ga0157375_10153859 3300013308 Bacteria 2437
70 Ga0157375_10207182 3300013308 Unclassified 2117
71 Ga0157380_10118066 3300014326 Bacteria 2242
72 Ga0157379_10029201 3300014968 Unclassified 4904
73 Ga0209758_1004833 3300025297 Bacteria 10872
74 Ga0207642_10048838 3300025899 Bacteria 1899
75 Ga0207699_10023237 3300025906 Bacteria 3372
76 Ga0207684_10107572 3300025910 Bacteria 2386
77 Ga0207671_10028082 3300025914 Bacteria 4206
78 Ga0207649_10060796 3300025920 Bacteria 2375
79 Ga0207694_10030228 3300025924 Bacteria 4136
80 Ga0207664_10036906 3300025929 Bacteria 3779
81 Ga0207644_10044157 3300025931 Plasmid 3165
82 Ga0207686_10053299 3300025934 Bacteria 2528
83 Ga0207669_10022604 3300025937 Bacteria 3344
84 Ga0207704_10114940 3300025938 Bacteria 1828
85 Ga0207691_10144061 3300025940 Bacteria 2098
86 Ga0207711_10037971 3300025941 Plasmid 4094
87 Ga0207712_10287823 3300025961 Bacteria 1343
88 Ga0207703_10057833 3300026035 Bacteria 3163
89 Ga0207639_10190665 3300026041 Bacteria 1751
90 Ga0207678_10012620 3300026067 Bacteria 7425
91 Ga0207702_10044679 3300026078 Bacteria 3724
92 Ga0207702_10296088 3300026078 Bacteria 1534
93 Ga0207648_10103620 3300026089 Bacteria 2495
94 Ga0207675_100084060 3300026118 Bacteria 2986
95 Ga0207683_10011267 3300026121 Bacteria 7623
96 Ga0207683_10125301 3300026121 Bacteria 2308
97 Ga0209179_1004784 3300027512 Bacteria 2071
98 Ga0209588_1001194 3300027671 Bacteria 6713
99 Ga0209588_1001892 3300027671 Bacteria 5595
100 Ga0268264_10000187 3300028381 Bacteria 129270
101 Ga0265334_10049706 3300028573 Bacteria 1612
102 Ga0265338_10010115 3300028800 Bacteria 11139
103 Ga0265330_10001924 3300031235 Bacteria 11547
104 Ga0265330_10010079 3300031235 Bacteria 4467
105 Ga0265330_10040755 3300031235 Bacteria 2061
106 Ga0265330_10065180 3300031235 Bacteria 1581
107 Ga0265332_10039469 3300031238 Bacteria 2045
108 Ga0265325_10001077 3300031241 Bacteria 19636
109 Ga0265325_10009734 3300031241 Bacteria 5602
110 Ga0265325_10068703 3300031241 Unclassified 1783
111 Ga0265340_10001944 3300031247 Bacteria 11812
112 Ga0265340_10005248 3300031247 Bacteria 7189
113 Ga0265340_10008807 3300031247 Bacteria 5439
114 Ga0265340_10010828 3300031247 Bacteria 4869
115 Ga0265339_10001714 3300031249 Bacteria 16152
116 Ga0265339_10003272 3300031249 Bacteria 11346
117 Ga0265339_10009285 3300031249 Bacteria 6195
118 Ga0265339_10017446 3300031249 Bacteria 4254
119 Ga0265331_10037198 3300031250 Bacteria 2385
120 Ga0307509_10111633 3300031507 Bacteria 2736
121 Ga0265313_10001394 3300031595 Bacteria 22666
122 Ga0265313_10007067 3300031595 Bacteria 7759
123 Ga0307508_10000049 3300031616 Bacteria 137413
124 Ga0307508_10000108 3300031616 Bacteria 97443
125 Ga0265314_10015519 3300031711 Bacteria 6045
126 Ga0265342_10000647 3300031712 Bacteria 36562
127 Ga0265342_10168209 3300031712 Bacteria 1208
128 Ga0373934_0006558 3300035086 Bacteria 4318
129 Ga0373934_0018441 3300035086 Bacteria 2670
130 Ga0373923_0004527 3300035111 Bacteria 4622
131 Ga0373923_0008627 3300035111 Bacteria 3647
132 Ga0373923_0053026 3300035111 Unclassified 1705
133 Ga0373936_0016213 3300035113 Bacteria 2865
134 Ga0373936_0029546 3300035113 Unclassified 2158
135 Ga0373953_0000891 3300035117 Bacteria 8357
136 Ga0373953_0003488 3300035117 Plasmid 4906
137 Ga0373953_0022144 3300035117 Bacteria 2393
138 Ga0373954_0002436 3300035118 Bacteria 7797
139 Ga0373954_0002569 3300035118 Bacteria 7629
140 Ga0373954_0015403 3300035118 Bacteria 3418
141 Ga0373954_0051086 3300035118 Bacteria 1941
142 Ga0373956_0002216 3300035119 Bacteria 8013
143 Ga0373956_0002595 3300035119 Bacteria 7325
144 Ga0373956_0016685 3300035119 Bacteria 3086
145 Ga0373956_0034017 3300035119 Bacteria 2244
146 Ga0373957_0000693 3300035120 Bacteria 8710
147 Ga0373957_0001767 3300035120 Bacteria 5958
148 Ga0373957_0021899 3300035120 Bacteria 2273
149 Ga0373960_0028824 3300035121 Bacteria 1535
150 Ga0373943_0001125 3300035170 Bacteria 11944
151 Ga0373943_0018860 3300035170 Bacteria 3171
152 Ga0373946_0015555 3300035171 Bacteria 2887
153 Ga0373946_0017207 3300035171 Bacteria 2763
154 Ga0373955_0000505 3300035172 Bacteria 16570
155 Ga0373955_0001690 3300035172 Bacteria 9435
156 Ga0373955_0010140 3300035172 Bacteria 4440
157 Ga0373955_0029629 3300035172 Plasmid 2848
158 Ga0373955_0034856 3300035172 Bacteria 2662
159 Ga0373962_0032185 3300035242 Bacteria 1442
160 Ga0373924_0007519 3300035410 Bacteria 3937
161 Ga0373924_0038822 3300035410 Bacteria 1943
162 Ga0373924_0078861 3300035410 Unclassified 1398
163 Ga0373935_0001061 3300035692 Bacteria 14985
164 Ga0373935_0023480 3300035692 Bacteria 3790
165 Ga0373935_0024920 3300035692 Bacteria 3685
166 Ga0373935_0120584 3300035692 Unclassified 1752
167 Ga0373927_0000136 3300035695 Bacteria 56656
168 Ga0373927_0005935 3300035695 Bacteria 8362
169 Ga0373927_0009654 3300035695 Bacteria 6470
170 Ga0373927_0012403 3300035695 Bacteria 5673
171 Ga0373927_0130575 3300035695 Bacteria 1641
172 Ga0373933_0001655 3300035724 Bacteria 12971
173 Ga0373933_0002077 3300035724 Bacteria 11497
174 Ga0373933_0003089 3300035724 Bacteria 9278
175 Ga0373947_0000107 3300035725 Bacteria 41080
176 Ga0373947_0018045 3300035725 Bacteria 4060
177 Ga0373947_0085765 3300035725 Bacteria 1956
178 Ga0373937_0007574 3300036401 Bacteria 9400
179 Ga0373937_0013955 3300036401 Bacteria 7083
180 Ga0373937_0065946 3300036401 Bacteria 3333
181 Ga0373937_0096221 3300036401 Bacteria 2746
182 Ga0373937_0107282 3300036401 Bacteria 2596
183 Ga0373937_0126899 3300036401 Unclassified 2381
184 Ga0373925_0001167 3300037068 Bacteria 23303
185 Ga0373925_0025936 3300037068 Bacteria 4285
186 Ga0373925_0038971 3300037068 Bacteria 3515
187 Ga0373925_0112400 3300037068 Bacteria 2106
188 Ga0373925_0212636 3300037068 Bacteria 1541
189 Ga0395898_0177285 3300037466 Bacteria 2037
190 Ga0395905_0033366 3300037471 Bacteria 4836
191 Ga0395901_0218867 3300038443 Bacteria 1991
192 Ga0466967_0017585 3300045976 Bacteria 5683
193 Ga0495592_0001464 3300046454 Bacteria 16415
194 Ga0495592_0004003 3300046454 Bacteria 10691
195 Ga0495592_0036203 3300046454 Bacteria 3717
196 Ga0495603_0000019 3300046455 Bacteria 65316
197 Ga0495603_0001255 3300046455 Bacteria 14802
198 Ga0495603_0024402 3300046455 Bacteria 3657
199 Ga0495629_0000071 3300046459 Bacteria 88879
200 Ga0495629_0000073 3300046459 Bacteria 87538
201 Ga0495629_0003400 3300046459 Bacteria 12036
202 Ga0495629_0004276 3300046459 Bacteria 10708
203 Ga0495638_0004221 3300046460 Bacteria 10936
204 Ga0495638_0011223 3300046460 Bacteria 6182
205 Ga0495641_0006516 3300046461 Bacteria 7546
206 Ga0495651_0001021 3300046462 Bacteria 21657
207 Ga0495651_0018312 3300046462 Bacteria 5423
208 Ga0495651_0031147 3300046462 Bacteria 4160
209 Ga0495651_0117865 3300046462 Unclassified 1954
210 Ga0495653_0003343 3300046463 Bacteria 12890
211 Ga0495653_0005985 3300046463 Bacteria 9956
212 Ga0495653_0029797 3300046463 Unclassified 4352
213 Ga0495653_0045329 3300046463 Bacteria 3409
214 Ga0495653_0088659 3300046463 Bacteria 2269
215 Ga0495580_0000057 3300046472 Bacteria 64650
216 Ga0495582_0000019 3300046473 Bacteria 91143
217 Ga0495582_0000111 3300046473 Bacteria 42751
218 Ga0495582_0044915 3300046473 Unclassified 2433
219 Ga0495639_0000003 3300046475 Bacteria 118479
220 Ga0495639_0000159 3300046475 Bacteria 34872
221 Ga0495639_0031213 3300046475 Unclassified 2371
222 Ga0495639_0067364 3300046475 Bacteria 1649
223 Ga0495662_0000087 3300046476 Bacteria 33327
224 Ga0495662_0004770 3300046476 Bacteria 6795
225 Ga0495662_0012060 3300046476 Plasmid 4224
226 Ga0495664_0001693 3300046477 Bacteria 11732
227 Ga0495664_0024950 3300046477 Bacteria 3477
228 Ga0495664_0025175 3300046477 Bacteria 3464
229 Ga0495664_0042391 3300046477 Bacteria 2695
230 Ga0495664_0048822 3300046477 Bacteria 2513
231 Ga0495594_0000249 3300046499 Bacteria 26130
232 Ga0495594_0007808 3300046499 Bacteria 5501
233 Ga0495608_0000349 3300046511 Bacteria 32301
234 Ga0495608_0006887 3300046511 Bacteria 8052
235 Ga0495608_0032951 3300046511 Bacteria 3503
236 Ga0495608_0134752 3300046511 Bacteria 1579
237 Ga0495610_0028533 3300046512 Bacteria 2950
238 Ga0495618_0002788 3300046514 Bacteria 11086
239 Ga0495618_0034678 3300046514 Bacteria 3166
240 Ga0495618_0068014 3300046514 Bacteria 2265
241 Ga0495618_0154828 3300046514 Bacteria 1463
242 Ga0495628_0004069 3300046516 Bacteria 13009
243 Ga0495628_0005745 3300046516 Bacteria 10869
244 Ga0495628_0227377 3300046516 Bacteria 1399
245 Ga0495630_0000929 3300046517 Bacteria 20449
246 Ga0495630_0012194 3300046517 Bacteria 6235
247 Ga0495630_0051845 3300046517 Unclassified 3071
248 Ga0495631_0036197 3300046518 Bacteria 2205
249 Ga0495637_0058551 3300046520 Bacteria 1588
250 Ga0495666_0094270 3300046526 Unclassified 1412
251 Ga0495666_0111989 3300046526 Bacteria 1281
252 Ga0495652_0010519 3300046529 Bacteria 8383
253 Ga0495652_0017779 3300046529 Bacteria 6345
254 Ga0495652_0027727 3300046529 Bacteria 4989
255 Ga0495654_0002933 3300046530 Bacteria 10683
256 Ga0495665_0000001 3300046531 Bacteria 156121
257 Ga0495665_0000093 3300046531 Bacteria 40936
258 Ga0495640_0001980 3300046533 Bacteria 16352
259 Ga0495640_0005349 3300046533 Bacteria 10210
260 Ga0495640_0023298 3300046533 Bacteria 4514
261 Ga0495640_0035567 3300046533 Bacteria 3525
262 Ga0495640_0046343 3300046533 Bacteria 3012
263 Ga0495640_0075929 3300046533 Bacteria 2243
264 Ga0495587_0001792 3300046536 Bacteria 14342
265 Ga0495587_0141955 3300046536 Bacteria 1370
266 Ga0495645_0005652 3300046543 Bacteria 8611
267 Ga0495645_0018064 3300046543 Bacteria 5060
268 Ga0495622_0000571 3300046557 Bacteria 22078
269 Ga0495622_0013786 3300046557 Bacteria 3748
270 Ga0495667_0001143 3300046559 Bacteria 17300
271 Ga0495667_0212530 3300046559 Bacteria 1236
272 Ga0495634_0000046 3300046642 Bacteria 97947
273 Ga0495634_0004469 3300046642 Bacteria 10972
274 Ga0495634_0010391 3300046642 Bacteria 6820
275 Ga0495634_0060276 3300046642 Bacteria 2525
276 Ga0495634_0067097 3300046642 Bacteria 2374
277 Ga0495634_0115602 3300046642 Bacteria 1722
278 Ga0495634_0170691 3300046642 Bacteria 1367
279 Ga0495635_0000322 3300046663 Bacteria 30913
280 Ga0495635_0000454 3300046663 Bacteria 25920
281 Ga0495635_0000534 3300046663 Bacteria 24127
282 Ga0495635_0001233 3300046663 Bacteria 17126
283 Ga0495635_0015830 3300046663 Bacteria 5267
284 Ga0495588_0002499 3300046674 Bacteria 7878
285 Ga0495657_0003422 3300046675 Bacteria 12954
286 Ga0495657_0020082 3300046675 Bacteria 4807
287 Ga0495599_0001118 3300046678 Bacteria 15101
288 Ga0495599_0007138 3300046678 Bacteria 6764
289 Ga0495599_0104287 3300046678 Bacteria 1766
290 Ga0495599_0118562 3300046678 Bacteria 1645
291 Ga0495623_0002907 3300046679 Bacteria 11279
292 Ga0495623_0018064 3300046679 Unclassified 4555
293 Ga0495646_0006567 3300046680 Bacteria 7381
294 Ga0495646_0008584 3300046680 Bacteria 6489
295 Ga0495646_0020724 3300046680 Bacteria 4158
296 Ga0495647_0000250 3300046681 Bacteria 14710
297 Ga0495647_0005246 3300046681 Bacteria 4243
298 Ga0495658_0000054 3300046683 Bacteria 57414
299 Ga0495658_0000285 3300046683 Bacteria 28523
300 Ga0495658_0118387 3300046683 Bacteria 1599
301 Ga0495658_0134170 3300046683 Bacteria 1510
302 Ga0495613_0020512 3300046689 Bacteria 4927
303 Ga0495613_0028588 3300046689 Bacteria 4147
304 Ga0495613_0035614 3300046689 Bacteria 3693
305 Ga0495613_0132784 3300046689 Bacteria 1782
306 Ga0495613_0173434 3300046689 Bacteria 1530
307 Ga0495624_0015204 3300046690 Bacteria 5205
308 Ga0495600_0041720 3300046809 Bacteria 2991
309 Ga0495660_0058625 3300046810 Bacteria 2073
310 Ga0495581_0000110 3300047315 Bacteria 34511
311 Ga0495581_0000247 3300047315 Bacteria 25790
312 Ga0495604_0001489 3300047317 Bacteria 19311
313 Ga0495604_0017185 3300047317 Bacteria 5787
314 Ga0495604_0131696 3300047317 Unclassified 1796
315 Ga0495674_0000031 3300047319 Bacteria 115867
316 Ga0495674_0000871 3300047319 Bacteria 28857
317 Ga0495674_0012705 3300047319 Bacteria 7934
318 Ga0495674_0032678 3300047319 Bacteria 4717
319 Ga0495674_0047782 3300047319 Bacteria 3792
320 Ga0495674_0051760 3300047319 Bacteria 3619
321 Ga0495674_0074010 3300047319 Bacteria 2935
322 Ga0495674_0167806 3300047319 Bacteria 1833
323 Ga0495676_0013934 3300047321 Bacteria 7208
324 Ga0495676_0145506 3300047321 Bacteria 1693
325 Ga0495676_0157394 3300047321 Unclassified 1610
326 Ga0495680_0005732 3300047322 Bacteria 11632
327 Ga0495680_0006969 3300047322 Bacteria 10427
328 Ga0495680_0014406 3300047322 Bacteria 6848
329 Ga0495680_0028628 3300047322 Bacteria 4567
330 Ga0495675_0006182 3300047444 Bacteria 7325
331 Ga0495675_0070934 3300047444 Bacteria 2199
332 Ga0495684_0001012 3300047471 Bacteria 22906
333 Ga0495684_0010338 3300047471 Bacteria 7218
334 Ga0495684_0160307 3300047471 Bacteria 1678
335 Ga0495686_0084355 3300047472 Bacteria 1936
336 Ga0495593_0000008 3300047673 Bacteria 87310
337 Ga0495593_0000652 3300047673 Bacteria 19971
338 Ga0495593_0005048 3300047673 Bacteria 7810
339 Ga0495593_0009851 3300047673 Bacteria 5545
340 Ga0495593_0032789 3300047673 Plasmid 2830
341 Ga0495602_0010805 3300048088 Bacteria 9461
342 Ga0495602_0031218 3300048088 Bacteria 5040
343 Ga0495602_0089294 3300048088 Bacteria 2563
344 Ga0495602_0198292 3300048088 Bacteria 1533
345 Ga0495614_0021139 3300048089 Plasmid 2813
346 Ga0496100_0054503 3300048903 Bacteria 2608
347 Ga0496101_0084592 3300048904 Unclassified 2349
348 Ga0496102_0017019 3300048905 Bacteria 6363
349 Ga0496102_0068448 3300048905 Plasmid 3257
350 Ga0496103_0028788 3300048906 Plasmid 3374
351 Ga0496104_0011011 3300048907 Bacteria 8092
352 Ga0496104_0080560 3300048907 Bacteria 3104
353 Ga0496105_0004737 3300048908 Bacteria 10266
354 Ga0496105_0011839 3300048908 Bacteria 6909
355 Ga0496106_0008931 3300048909 Bacteria 7407
356 Ga0496106_0047742 3300048909 Bacteria 3223
357 Ga0496107_0023292 3300048910 Plasmid 4378
358 Ga0496107_0170898 3300048910 Unclassified 1613
359 Ga0496108_0105461 3300048911 Bacteria 2406
360 Ga0496109_0121455 3300048912 Bacteria 2434
361 Ga0496110_0002086 3300048913 Bacteria 14892
362 Ga0496110_0025992 3300048913 Bacteria 5005
363 Ga0496110_0163795 3300048913 Bacteria 2016
364 Ga0496111_0018482 3300048914 Bacteria 4830
365 Ga0496111_0055480 3300048914 Bacteria 2865
366 Ga0496111_0121512 3300048914 Bacteria 1929
367 Ga0496112_0011552 3300048915 Bacteria 8069
368 Ga0496112_0046550 3300048915 Bacteria 4254
369 Ga0496112_0060842 3300048915 Bacteria 3721
370 Ga0496112_0115034 3300048915 Bacteria 2661
371 Ga0496113_0003304 3300048916 Bacteria 9626
372 Ga0496113_0025531 3300048916 Bacteria 4212
373 Ga0496113_0033077 3300048916 Bacteria 3762
374 Ga0496114_0038550 3300048917 Bacteria 3954
375 Ga0496115_0002928 3300048918 Bacteria 12305
376 Ga0496115_0153527 3300048918 Bacteria 1902
377 Ga0496116_0005365 3300048919 Bacteria 11931
378 Ga0496121_0002931 3300048924 Bacteria 24972
379 Ga0496121_0145375 3300048924 Unclassified 1753
380 Ga0496122_0042552 3300048925 Bacteria 3572
381 Ga0496123_0122353 3300048926 Bacteria 1460
382 Ga0496124_0135160 3300048927 Bacteria 1953
383 Ga0496125_0000063 3300048928 Bacteria 250260
384 Ga0496125_0000504 3300048928 Bacteria 67902
385 Ga0496125_0002796 3300048928 Bacteria 22060
386 Ga0496125_0021699 3300048928 Bacteria 5978
387 nmdc:mga0yw44_195297_c1 3300050492 Bacteria 1335
388 nmdc:mga0qj67_46267_c1 3300050509 Bacteria 3435
389 nmdc:mga06r32_18187_c1 3300050510 Bacteria 6430
390 nmdc:mga0n895_64691_c1 3300050512 Bacteria 3618
391 nmdc:mga0n895_71625_c1 3300050512 Bacteria 3437
392 nmdc:mga0rr50_25631_c1 3300050513 Bacteria 4102
393 nmdc:mga0rr50_50566_c1 3300050513 Bacteria 3080
394 Ga0495601_0000604 3300053077 Bacteria 19103
395 Ga0495601_0002270 3300053077 Bacteria 10851
396 Ga0495612_0002276 3300053078 Bacteria 7901
397 Ga0495612_0025343 3300053078 Bacteria 2381
398 Ga0500635_0007541 3300053080 Bacteria 2953
399 Ga0495655_0018395 3300053083 Unclassified 1535
400 Ga0495595_0000165 3300053084 Bacteria 26110
401 Ga0495595_0000465 3300053084 Bacteria 15378
402 Ga0495595_0001309 3300053084 Bacteria 9675
403 Ga0495619_0000016 3300053085 Bacteria 231442
404 Ga0495619_0001330 3300053085 Bacteria 16187
405 Ga0495619_0119436 3300053085 Bacteria 1807
406 Ga0495619_0119600 3300053085 Bacteria 1805
407 Ga0500643_001631 3300053087 Bacteria 12536
408 Ga0500647_0008345 3300053091 Bacteria 4494
409 Ga0500566_0001759 3300053094 Bacteria 12737
410 Ga0500566_0008264 3300053094 Bacteria 6155
411 Ga0500641_0002155 3300053096 Bacteria 6979
412 Ga0500554_001023 3300053102 Bacteria 5440
413 Ga0500556_0000002 3300053104 Bacteria 773626
414 Ga0500608_012770 3300053122 Bacteria 3696
415 Ga0500642_0000034 3300053130 Bacteria 110440
416 Ga0500652_000352 3300053131 Bacteria 16556
417 Ga0500658_0026240 3300053134 Bacteria 2243
418 Ga0500568_0000190 3300053139 Bacteria 53492
419 Ga0500586_000336 3300053145 Bacteria 9307
420 Ga0500603_000696 3300053150 Bacteria 8194
421 Ga0500616_0000036 3300053153 Bacteria 390769
422 Ga0500622_0000813 3300053156 Bacteria 26762
423 Ga0500636_0007061 3300053177 Bacteria 6479
424 Ga0500637_0000440 3300053178 Bacteria 15897
425 Ga0500661_000513 3300055283 Bacteria 7233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0024920 Ga0373935_0024920_36_1025 316
2 3300046809 Ga0495600_0041720 Ga0495600_0041720_1966_2955 316
3 3300035113 Ga0373936_0016213 Ga0373936_0016213_1310_2527 329
4 3300053091 Ga0500647_0008345 Ga0500647_0008345_3083_4252 334
5 3300053094 Ga0500566_0008264 Ga0500566_0008264_2263_3432 334
6 3300053122 Ga0500608_012770 Ga0500608_012770_1630_2799 334
7 3300053080 Ga0500635_0007541 Ga0500635_0007541_1190_2374 335
8 3300009551 Ga0105238_10011135 Ga0105238_100111355 341
9 3300025914 Ga0207671_10028082 Ga0207671_100280824 341
10 3300035695 Ga0373927_0130575 Ga0373927_0130575_539_1615 345
11 3300053153 Ga0500616_0000036 Ga0500616_0000036_244694_245857 345
12 3300005340 Ga0070689_100057735 Ga0070689_1000577353 347
13 3300005842 Ga0068858_100168568 Ga0068858_1001685681 347
14 3300006028 Ga0070717_10301701 Ga0070717_103017011 347
15 3300006871 Ga0075434_100315934 Ga0075434_1003159341 347
16 3300026118 Ga0207675_100084060 Ga0207675_1000840603 347
17 3300048912 Ga0496109_0121455 Ga0496109_0121455_290_1423 347
18 3300048913 Ga0496110_0025992 Ga0496110_0025992_234_1367 347
19 3300005434 Ga0070709_10019266 Ga0070709_100192663 348
20 3300005435 Ga0070714_100018663 Ga0070714_1000186634 348
21 3300025906 Ga0207699_10023237 Ga0207699_100232372 348
22 3300025929 Ga0207664_10036906 Ga0207664_100369062 348
23 3300037068 Ga0373925_0212636 Ga0373925_0212636_73_1209 348
24 3300048924 Ga0496121_0145375 Ga0496121_0145375_263_1369 348
25 iso_pu_bacteria 2876808645 2876813491 348
26 iso_pu_bacteria 2879110137 2879114741 348
27 3300006881 Ga0068865_100084476 Ga0068865_1000844762 349
28 3300007265 Ga0099794_10028280 Ga0099794_100282804 349
29 3300014326 Ga0157380_10118066 Ga0157380_101180661 349
30 3300025940 Ga0207691_10144061 Ga0207691_101440611 349
31 3300026121 Ga0207683_10125301 Ga0207683_101253012 349
32 3300027671 Ga0209588_1001892 Ga0209588_10018925 349
33 3300006844 Ga0075428_100083537 Ga0075428_1000835373 350
34 3300006846 Ga0075430_100025160 Ga0075430_1000251603 350
35 3300006847 Ga0075431_100025700 Ga0075431_1000257004 350
36 3300046516 Ga0495628_0227377 Ga0495628_0227377_38_1135 350
37 3300046526 Ga0495666_0111989 Ga0495666_0111989_174_1271 350
38 3300050509 nmdc:mga0qj67_46267_c1 nmdc:mga0qj67_46267_c1_1770_2891 350
39 3300050510 nmdc:mga06r32_18187_c1 nmdc:mga06r32_18187_c1_3303_4424 350
40 3300046683 Ga0495658_0134170 Ga0495658_0134170_88_1266 353
41 3300007265 Ga0099794_10007247 Ga0099794_100072473 354
42 3300048925 Ga0496122_0042552 Ga0496122_0042552_2034_3152 355
43 3300048928 Ga0496125_0000063 Ga0496125_0000063_182910_184028 355
44 3300035692 Ga0373935_0120584 Ga0373935_0120584_291_1496 356
45 3300007076 Ga0075435_100103242 Ga0075435_1001032422 357
46 3300025899 Ga0207642_10048838 Ga0207642_100488382 357
47 3300031507 Ga0307509_10111633 Ga0307509_101116333 357
48 3300031616 Ga0307508_10000108 Ga0307508_1000010853 357
49 3300050513 nmdc:mga0rr50_50566_c1 nmdc:mga0rr50_50566_c1_1275_2390 357
50 3300013308 Ga0157375_10153859 Ga0157375_101538591 358
51 3300031249 Ga0265339_10017446 Ga0265339_100174462 358
52 3300005535 Ga0070684_100099903 Ga0070684_1000999033 359
53 3300005539 Ga0068853_100237067 Ga0068853_1002370672 359
54 3300005543 Ga0070672_100250722 Ga0070672_1002507221 359
55 3300026041 Ga0207639_10190665 Ga0207639_101906651 359
56 3300028573 Ga0265334_10049706 Ga0265334_100497062 359
57 3300031235 Ga0265330_10040755 Ga0265330_100407552 359
58 3300031235 Ga0265330_10065180 Ga0265330_100651802 359
59 3300031247 Ga0265340_10005248 Ga0265340_1000524810 359
60 3300031712 Ga0265342_10168209 Ga0265342_101682091 359
61 3300035111 Ga0373923_0004527 Ga0373923_0004527_806_1918 359
62 3300035117 Ga0373953_0022144 Ga0373953_0022144_866_1978 359
63 3300035118 Ga0373954_0002569 Ga0373954_0002569_3234_4346 359
64 3300035118 Ga0373954_0051086 Ga0373954_0051086_564_1745 359
65 3300035119 Ga0373956_0002216 Ga0373956_0002216_2674_3786 359
66 3300035120 Ga0373957_0001767 Ga0373957_0001767_2595_3707 359
67 3300035170 Ga0373943_0001125 Ga0373943_0001125_1742_2923 359
68 3300035172 Ga0373955_0001690 Ga0373955_0001690_887_1999 359
69 3300035172 Ga0373955_0010140 Ga0373955_0010140_387_1568 359
70 3300035692 Ga0373935_0001061 Ga0373935_0001061_7178_8359 359
71 3300035695 Ga0373927_0000136 Ga0373927_0000136_38433_39614 359
72 3300035724 Ga0373933_0003089 Ga0373933_0003089_2155_3267 359
73 3300035725 Ga0373947_0000107 Ga0373947_0000107_36888_38069 359
74 3300036401 Ga0373937_0065946 Ga0373937_0065946_1889_3001 359
75 3300036401 Ga0373937_0096221 Ga0373937_0096221_450_1631 359
76 3300037068 Ga0373925_0001167 Ga0373925_0001167_5739_6920 359
77 3300046454 Ga0495592_0004003 Ga0495592_0004003_9537_10649 359
78 3300046454 Ga0495592_0036203 Ga0495592_0036203_2231_3412 359
79 3300046455 Ga0495603_0000019 Ga0495603_0000019_33946_35127 359
80 3300046459 Ga0495629_0000073 Ga0495629_0000073_83131_84312 359
81 3300046459 Ga0495629_0004276 Ga0495629_0004276_7571_8683 359
82 3300046463 Ga0495653_0003343 Ga0495653_0003343_1131_2243 359
83 3300046473 Ga0495582_0000019 Ga0495582_0000019_17168_18349 359
84 3300046475 Ga0495639_0000159 Ga0495639_0000159_16011_17192 359
85 3300046476 Ga0495662_0004770 Ga0495662_0004770_4500_5681 359
86 3300046477 Ga0495664_0024950 Ga0495664_0024950_1261_2442 359
87 3300046499 Ga0495594_0007808 Ga0495594_0007808_1089_2270 359
88 3300046511 Ga0495608_0032951 Ga0495608_0032951_2366_3478 359
89 3300046517 Ga0495630_0000929 Ga0495630_0000929_6626_7807 359
90 3300046531 Ga0495665_0000093 Ga0495665_0000093_22435_23616 359
91 3300046533 Ga0495640_0005349 Ga0495640_0005349_3171_4352 359
92 3300046533 Ga0495640_0046343 Ga0495640_0046343_488_1600 359
93 3300046557 Ga0495622_0000571 Ga0495622_0000571_10328_11509 359
94 3300046642 Ga0495634_0004469 Ga0495634_0004469_4391_5572 359
95 3300046663 Ga0495635_0000322 Ga0495635_0000322_19353_20534 359
96 3300046674 Ga0495588_0002499 Ga0495588_0002499_4443_5624 359
97 3300046678 Ga0495599_0001118 Ga0495599_0001118_712_1824 359
98 3300046678 Ga0495599_0104287 Ga0495599_0104287_361_1542 359
99 3300046680 Ga0495646_0020724 Ga0495646_0020724_2054_3166 359
100 3300046681 Ga0495647_0000250 Ga0495647_0000250_776_1957 359
101 3300046683 Ga0495658_0000054 Ga0495658_0000054_39781_40962 359
102 3300046689 Ga0495613_0028588 Ga0495613_0028588_1242_2423 359
103 3300046689 Ga0495613_0132784 Ga0495613_0132784_133_1245 359
104 3300046690 Ga0495624_0015204 Ga0495624_0015204_2071_3252 359
105 3300047315 Ga0495581_0000247 Ga0495581_0000247_8599_9780 359
106 3300047319 Ga0495674_0000871 Ga0495674_0000871_17107_18288 359
107 3300047319 Ga0495674_0051760 Ga0495674_0051760_981_2093 359
108 3300047321 Ga0495676_0013934 Ga0495676_0013934_1403_2584 359
109 3300047444 Ga0495675_0070934 Ga0495675_0070934_755_1867 359
110 3300047471 Ga0495684_0010338 Ga0495684_0010338_5508_6620 359
111 3300047673 Ga0495593_0000652 Ga0495593_0000652_2908_4089 359
112 3300047673 Ga0495593_0005048 Ga0495593_0005048_2694_3806 359
113 3300048911 Ga0496108_0105461 Ga0496108_0105461_466_1659 359
114 3300048914 Ga0496111_0018482 Ga0496111_0018482_1465_2658 359
115 3300048915 Ga0496112_0046550 Ga0496112_0046550_2372_3565 359
116 3300048916 Ga0496113_0033077 Ga0496113_0033077_237_1430 359
117 3300048918 Ga0496115_0153527 Ga0496115_0153527_46_1158 359
118 3300053083 Ga0495655_0018395 Ga0495655_0018395_95_1288 359
119 3300053085 Ga0495619_0119436 Ga0495619_0119436_265_1446 359
120 iso_pu_bacteria 2885409591 2885417107 359
121 3300037466 Ga0395898_0177285 Ga0395898_0177285_285_1415 360
122 3300037471 Ga0395905_0033366 Ga0395905_0033366_455_1585 360
123 3300038443 Ga0395901_0218867 Ga0395901_0218867_139_1269 360
124 3300048928 Ga0496125_0000504 Ga0496125_0000504_56007_57197 360
125 3300005335 Ga0070666_10145976 Ga0070666_101459761 361
126 3300005336 Ga0070680_100033603 Ga0070680_1000336034 361
127 3300005439 Ga0070711_100308148 Ga0070711_1003081481 361
128 3300005563 Ga0068855_100133716 Ga0068855_1001337162 361
129 3300005564 Ga0070664_100129486 Ga0070664_1001294862 361
130 3300005616 Ga0068852_100013691 Ga0068852_1000136914 361
131 3300009101 Ga0105247_10084703 Ga0105247_100847032 361
132 3300013105 Ga0157369_10123607 Ga0157369_101236072 361
133 3300026078 Ga0207702_10044679 Ga0207702_100446793 361
134 3300031235 Ga0265330_10010079 Ga0265330_100100794 361
135 3300031241 Ga0265325_10001077 Ga0265325_100010773 361
136 3300031249 Ga0265339_10001714 Ga0265339_100017145 361
137 3300031595 Ga0265313_10001394 Ga0265313_1000139416 361
138 3300031711 Ga0265314_10015519 Ga0265314_100155197 361
139 3300035172 Ga0373955_0029629 Ga0373955_0029629_259_1383 361
140 3300035724 Ga0373933_0002077 Ga0373933_0002077_1143_2267 361
141 3300046462 Ga0495651_0117865 Ga0495651_0117865_339_1463 361
142 3300046533 Ga0495640_0035567 Ga0495640_0035567_699_1823 361
143 3300046642 Ga0495634_0170691 Ga0495634_0170691_17_1141 361
144 3300047317 Ga0495604_0131696 Ga0495604_0131696_362_1486 361
145 3300047322 Ga0495680_0006969 Ga0495680_0006969_2072_3196 361
146 3300053077 Ga0495601_0002270 Ga0495601_0002270_7172_8296 361
147 3300053084 Ga0495595_0001309 Ga0495595_0001309_4706_5830 361
148 3300053085 Ga0495619_0000016 Ga0495619_0000016_4066_5190 361
149 3300053085 Ga0495619_0119600 Ga0495619_0119600_570_1790 361
150 3300009101 Ga0105247_10030717 Ga0105247_100307172 362
151 3300045976 Ga0466967_0017585 Ga0466967_0017585_3094_4221 362
152 3300046460 Ga0495638_0004221 Ga0495638_0004221_2560_3720 362
153 3300048908 Ga0496105_0011839 Ga0496105_0011839_4072_5208 362
154 3300053177 Ga0500636_0007061 Ga0500636_0007061_704_1855 362
155 3300005336 Ga0070680_100058089 Ga0070680_1000580893 363
156 3300005341 Ga0070691_10051410 Ga0070691_100514101 363
157 3300005367 Ga0070667_100085940 Ga0070667_1000859402 363
158 3300005435 Ga0070714_100024827 Ga0070714_1000248273 363
159 3300005436 Ga0070713_100016223 Ga0070713_1000162235 363
160 3300005436 Ga0070713_100026518 Ga0070713_1000265182 363
161 3300005439 Ga0070711_100034904 Ga0070711_1000349042 363
162 3300005455 Ga0070663_100072584 Ga0070663_1000725843 363
163 3300005458 Ga0070681_10006312 Ga0070681_1000631214 363
164 3300005459 Ga0068867_100111419 Ga0068867_1001114192 363
165 3300005468 Ga0070707_100292439 Ga0070707_1002924391 363
166 3300005543 Ga0070672_100226179 Ga0070672_1002261791 363
167 3300005547 Ga0070693_100002862 Ga0070693_1000028621 363
168 3300005578 Ga0068854_100149039 Ga0068854_1001490392 363
169 3300005614 Ga0068856_100180419 Ga0068856_1001804192 363
170 3300005616 Ga0068852_100348416 Ga0068852_1003484161 363
171 3300005843 Ga0068860_100001170 Ga0068860_10000117026 363
172 3300006163 Ga0070715_10026589 Ga0070715_100265892 363
173 3300006195 Ga0075366_10023294 Ga0075366_100232943 363
174 3300006353 Ga0075370_10016780 Ga0075370_100167802 363
175 3300006871 Ga0075434_100070885 Ga0075434_1000708852 363
176 3300006871 Ga0075434_100194560 Ga0075434_1001945603 363
177 3300007076 Ga0075435_100020700 Ga0075435_1000207006 363
178 3300007265 Ga0099794_10001293 Ga0099794_100012932 363
179 3300007265 Ga0099794_10007504 Ga0099794_100075046 363
180 3300007788 Ga0099795_10002049 Ga0099795_100020493 363
181 3300007788 Ga0099795_10014082 Ga0099795_100140822 363
182 3300009148 Ga0105243_10093684 Ga0105243_100936842 363
183 3300009176 Ga0105242_10100229 Ga0105242_101002293 363
184 3300009176 Ga0105242_10227718 Ga0105242_102277181 363
185 3300009177 Ga0105248_10013866 Ga0105248_100138662 363
186 3300009553 Ga0105249_10098335 Ga0105249_100983353 363
187 3300009553 Ga0105249_10248451 Ga0105249_102484511 363
188 3300010159 Ga0099796_10004574 Ga0099796_100045743 363
189 3300010159 Ga0099796_10004988 Ga0099796_100049883 363
190 3300013105 Ga0157369_10138442 Ga0157369_101384422 363
191 3300013306 Ga0163162_10051142 Ga0163162_100511422 363
192 3300013307 Ga0157372_10221628 Ga0157372_102216281 363
193 3300013308 Ga0157375_10207182 Ga0157375_102071821 363
194 3300014968 Ga0157379_10029201 Ga0157379_100292016 363
195 3300025297 Ga0209758_1004833 Ga0209758_10048337 363
196 3300025910 Ga0207684_10107572 Ga0207684_101075722 363
197 3300025920 Ga0207649_10060796 Ga0207649_100607962 363
198 3300025931 Ga0207644_10044157 Ga0207644_100441571 363
199 3300025934 Ga0207686_10053299 Ga0207686_100532992 363
200 3300025937 Ga0207669_10022604 Ga0207669_100226041 363
201 3300025938 Ga0207704_10114940 Ga0207704_101149401 363
202 3300025941 Ga0207711_10037971 Ga0207711_100379715 363
203 3300025961 Ga0207712_10287823 Ga0207712_102878231 363
204 3300026067 Ga0207678_10012620 Ga0207678_100126208 363
205 3300026078 Ga0207702_10296088 Ga0207702_102960881 363
206 3300026089 Ga0207648_10103620 Ga0207648_101036201 363
207 3300026121 Ga0207683_10011267 Ga0207683_100112677 363
208 3300027512 Ga0209179_1004784 Ga0209179_10047841 363
209 3300027671 Ga0209588_1001194 Ga0209588_10011948 363
210 3300028381 Ga0268264_10000187 Ga0268264_1000018776 363
211 3300028800 Ga0265338_10010115 Ga0265338_100101153 363
212 3300031235 Ga0265330_10001924 Ga0265330_100019245 363
213 3300031238 Ga0265332_10039469 Ga0265332_100394692 363
214 3300031241 Ga0265325_10009734 Ga0265325_100097344 363
215 3300031241 Ga0265325_10068703 Ga0265325_100687031 363
216 3300031247 Ga0265340_10001944 Ga0265340_100019449 363
217 3300031247 Ga0265340_10008807 Ga0265340_100088075 363
218 3300031247 Ga0265340_10010828 Ga0265340_100108282 363
219 3300031249 Ga0265339_10003272 Ga0265339_100032722 363
220 3300031249 Ga0265339_10009285 Ga0265339_100092854 363
221 3300031250 Ga0265331_10037198 Ga0265331_100371981 363
222 3300031595 Ga0265313_10007067 Ga0265313_100070671 363
223 3300031616 Ga0307508_10000049 Ga0307508_1000004944 363
224 3300031712 Ga0265342_10000647 Ga0265342_1000064716 363
225 3300035086 Ga0373934_0006558 Ga0373934_0006558_1977_3107 363
226 3300035086 Ga0373934_0018441 Ga0373934_0018441_836_1966 363
227 3300035111 Ga0373923_0008627 Ga0373923_0008627_1570_2700 363
228 3300035111 Ga0373923_0053026 Ga0373923_0053026_554_1684 363
229 3300035113 Ga0373936_0029546 Ga0373936_0029546_536_1666 363
230 3300035117 Ga0373953_0000891 Ga0373953_0000891_4522_5652 363
231 3300035117 Ga0373953_0003488 Ga0373953_0003488_1829_2959 363
232 3300035118 Ga0373954_0002436 Ga0373954_0002436_3273_4403 363
233 3300035118 Ga0373954_0015403 Ga0373954_0015403_1249_2379 363
234 3300035119 Ga0373956_0002595 Ga0373956_0002595_3198_4328 363
235 3300035119 Ga0373956_0016685 Ga0373956_0016685_1557_2687 363
236 3300035119 Ga0373956_0034017 Ga0373956_0034017_922_2112 363
237 3300035120 Ga0373957_0000693 Ga0373957_0000693_3135_4265 363
238 3300035120 Ga0373957_0021899 Ga0373957_0021899_1000_2130 363
239 3300035121 Ga0373960_0028824 Ga0373960_0028824_109_1296 363
240 3300035170 Ga0373943_0018860 Ga0373943_0018860_67_1197 363
241 3300035171 Ga0373946_0015555 Ga0373946_0015555_38_1168 363
242 3300035171 Ga0373946_0017207 Ga0373946_0017207_1034_2194 363
243 3300035172 Ga0373955_0000505 Ga0373955_0000505_12557_13687 363
244 3300035172 Ga0373955_0034856 Ga0373955_0034856_121_1251 363
245 3300035242 Ga0373962_0032185 Ga0373962_0032185_111_1271 363
246 3300035410 Ga0373924_0007519 Ga0373924_0007519_377_1507 363
247 3300035410 Ga0373924_0038822 Ga0373924_0038822_580_1773 363
248 3300035410 Ga0373924_0078861 Ga0373924_0078861_69_1259 363
249 3300035692 Ga0373935_0023480 Ga0373935_0023480_2428_3633 363
250 3300035695 Ga0373927_0005935 Ga0373927_0005935_641_1771 363
251 3300035695 Ga0373927_0009654 Ga0373927_0009654_1921_3108 363
252 3300035695 Ga0373927_0012403 Ga0373927_0012403_3755_4915 363
253 3300035724 Ga0373933_0001655 Ga0373933_0001655_5818_6948 363
254 3300035725 Ga0373947_0018045 Ga0373947_0018045_2143_3273 363
255 3300035725 Ga0373947_0085765 Ga0373947_0085765_522_1727 363
256 3300036401 Ga0373937_0007574 Ga0373937_0007574_5897_7027 363
257 3300036401 Ga0373937_0013955 Ga0373937_0013955_4718_5908 363
258 3300036401 Ga0373937_0107282 Ga0373937_0107282_144_1337 363
259 3300036401 Ga0373937_0126899 Ga0373937_0126899_1145_2275 363
260 3300037068 Ga0373925_0025936 Ga0373925_0025936_2519_3679 363
261 3300037068 Ga0373925_0038971 Ga0373925_0038971_2188_3318 363
262 3300037068 Ga0373925_0112400 Ga0373925_0112400_44_1402 363
263 3300046454 Ga0495592_0001464 Ga0495592_0001464_14455_15585 363
264 3300046455 Ga0495603_0001255 Ga0495603_0001255_10198_11328 363
265 3300046455 Ga0495603_0024402 Ga0495603_0024402_1770_2900 363
266 3300046459 Ga0495629_0000071 Ga0495629_0000071_431_1561 363
267 3300046459 Ga0495629_0003400 Ga0495629_0003400_3293_4423 363
268 3300046460 Ga0495638_0011223 Ga0495638_0011223_2461_3624 363
269 3300046461 Ga0495641_0006516 Ga0495641_0006516_1959_3089 363
270 3300046462 Ga0495651_0001021 Ga0495651_0001021_13484_14614 363
271 3300046462 Ga0495651_0018312 Ga0495651_0018312_2826_3956 363
272 3300046462 Ga0495651_0031147 Ga0495651_0031147_2244_3437 363
273 3300046463 Ga0495653_0005985 Ga0495653_0005985_7487_8617 363
274 3300046463 Ga0495653_0029797 Ga0495653_0029797_3089_4219 363
275 3300046463 Ga0495653_0045329 Ga0495653_0045329_1995_3188 363
276 3300046463 Ga0495653_0088659 Ga0495653_0088659_704_1864 363
277 3300046472 Ga0495580_0000057 Ga0495580_0000057_61342_62472 363
278 3300046473 Ga0495582_0000111 Ga0495582_0000111_39598_40728 363
279 3300046473 Ga0495582_0044915 Ga0495582_0044915_1287_2417 363
280 3300046475 Ga0495639_0000003 Ga0495639_0000003_110296_111426 363
281 3300046475 Ga0495639_0031213 Ga0495639_0031213_770_1900 363
282 3300046475 Ga0495639_0067364 Ga0495639_0067364_176_1381 363
283 3300046476 Ga0495662_0000087 Ga0495662_0000087_10858_11988 363
284 3300046476 Ga0495662_0012060 Ga0495662_0012060_1540_2670 363
285 3300046477 Ga0495664_0001693 Ga0495664_0001693_9794_10954 363
286 3300046477 Ga0495664_0025175 Ga0495664_0025175_29_1159 363
287 3300046477 Ga0495664_0042391 Ga0495664_0042391_568_1761 363
288 3300046477 Ga0495664_0048822 Ga0495664_0048822_489_1619 363
289 3300046499 Ga0495594_0000249 Ga0495594_0000249_13195_14325 363
290 3300046511 Ga0495608_0000349 Ga0495608_0000349_26547_27677 363
291 3300046511 Ga0495608_0006887 Ga0495608_0006887_1085_2215 363
292 3300046511 Ga0495608_0134752 Ga0495608_0134752_51_1187 363
293 3300046512 Ga0495610_0028533 Ga0495610_0028533_252_1415 363
294 3300046514 Ga0495618_0002788 Ga0495618_0002788_4748_5878 363
295 3300046514 Ga0495618_0034678 Ga0495618_0034678_49_1179 363
296 3300046514 Ga0495618_0068014 Ga0495618_0068014_35_1228 363
297 3300046514 Ga0495618_0154828 Ga0495618_0154828_25_1155 363
298 3300046516 Ga0495628_0004069 Ga0495628_0004069_402_1532 363
299 3300046516 Ga0495628_0005745 Ga0495628_0005745_402_1532 363
300 3300046517 Ga0495630_0012194 Ga0495630_0012194_1320_2450 363
301 3300046517 Ga0495630_0051845 Ga0495630_0051845_1798_2928 363
302 3300046518 Ga0495631_0036197 Ga0495631_0036197_271_1434 363
303 3300046520 Ga0495637_0058551 Ga0495637_0058551_263_1426 363
304 3300046526 Ga0495666_0094270 Ga0495666_0094270_56_1186 363
305 3300046529 Ga0495652_0010519 Ga0495652_0010519_4608_5738 363
306 3300046529 Ga0495652_0017779 Ga0495652_0017779_4291_5421 363
307 3300046529 Ga0495652_0027727 Ga0495652_0027727_500_1660 363
308 3300046530 Ga0495654_0002933 Ga0495654_0002933_5875_7038 363
309 3300046531 Ga0495665_0000001 Ga0495665_0000001_78719_79849 363
310 3300046533 Ga0495640_0001980 Ga0495640_0001980_1935_3065 363
311 3300046533 Ga0495640_0023298 Ga0495640_0023298_3178_4338 363
312 3300046533 Ga0495640_0075929 Ga0495640_0075929_754_1959 363
313 3300046536 Ga0495587_0001792 Ga0495587_0001792_3085_4215 363
314 3300046536 Ga0495587_0141955 Ga0495587_0141955_147_1340 363
315 3300046543 Ga0495645_0005652 Ga0495645_0005652_5157_6287 363
316 3300046543 Ga0495645_0018064 Ga0495645_0018064_1219_2349 363
317 3300046557 Ga0495622_0013786 Ga0495622_0013786_1122_2252 363
318 3300046559 Ga0495667_0001143 Ga0495667_0001143_13683_14843 363
319 3300046559 Ga0495667_0212530 Ga0495667_0212530_76_1212 363
320 3300046642 Ga0495634_0000046 Ga0495634_0000046_1973_3103 363
321 3300046642 Ga0495634_0010391 Ga0495634_0010391_1729_2859 363
322 3300046642 Ga0495634_0060276 Ga0495634_0060276_1172_2302 363
323 3300046642 Ga0495634_0067097 Ga0495634_0067097_613_1773 363
324 3300046642 Ga0495634_0115602 Ga0495634_0115602_107_1312 363
325 3300046663 Ga0495635_0000454 Ga0495635_0000454_15093_16223 363
326 3300046663 Ga0495635_0000534 Ga0495635_0000534_8975_10105 363
327 3300046663 Ga0495635_0001233 Ga0495635_0001233_2077_3207 363
328 3300046663 Ga0495635_0015830 Ga0495635_0015830_3861_5054 363
329 3300046675 Ga0495657_0003422 Ga0495657_0003422_293_1423 363
330 3300046675 Ga0495657_0020082 Ga0495657_0020082_1160_2290 363
331 3300046678 Ga0495599_0007138 Ga0495599_0007138_1708_2838 363
332 3300046678 Ga0495599_0118562 Ga0495599_0118562_164_1294 363
333 3300046679 Ga0495623_0002907 Ga0495623_0002907_7539_8669 363
334 3300046679 Ga0495623_0018064 Ga0495623_0018064_2539_3669 363
335 3300046680 Ga0495646_0006567 Ga0495646_0006567_3250_4380 363
336 3300046680 Ga0495646_0008584 Ga0495646_0008584_2730_3860 363
337 3300046681 Ga0495647_0005246 Ga0495647_0005246_940_2070 363
338 3300046683 Ga0495658_0000285 Ga0495658_0000285_13049_14179 363
339 3300046683 Ga0495658_0118387 Ga0495658_0118387_78_1238 363
340 3300046689 Ga0495613_0020512 Ga0495613_0020512_1280_2410 363
341 3300046689 Ga0495613_0035614 Ga0495613_0035614_1965_3095 363
342 3300046689 Ga0495613_0173434 Ga0495613_0173434_257_1450 363
343 3300046810 Ga0495660_0058625 Ga0495660_0058625_123_1286 363
344 3300047315 Ga0495581_0000110 Ga0495581_0000110_27902_29032 363
345 3300047317 Ga0495604_0001489 Ga0495604_0001489_9433_10563 363
346 3300047317 Ga0495604_0017185 Ga0495604_0017185_1213_2343 363
347 3300047319 Ga0495674_0000031 Ga0495674_0000031_46326_47456 363
348 3300047319 Ga0495674_0012705 Ga0495674_0012705_4004_5134 363
349 3300047319 Ga0495674_0032678 Ga0495674_0032678_2225_3385 363
350 3300047319 Ga0495674_0047782 Ga0495674_0047782_1299_2429 363
351 3300047319 Ga0495674_0074010 Ga0495674_0074010_498_1685 363
352 3300047319 Ga0495674_0167806 Ga0495674_0167806_56_1261 363
353 3300047321 Ga0495676_0145506 Ga0495676_0145506_441_1571 363
354 3300047321 Ga0495676_0157394 Ga0495676_0157394_154_1284 363
355 3300047322 Ga0495680_0005732 Ga0495680_0005732_3312_4472 363
356 3300047322 Ga0495680_0014406 Ga0495680_0014406_5645_6838 363
357 3300047322 Ga0495680_0028628 Ga0495680_0028628_113_1273 363
358 3300047444 Ga0495675_0006182 Ga0495675_0006182_3800_4930 363
359 3300047471 Ga0495684_0001012 Ga0495684_0001012_12865_13995 363
360 3300047471 Ga0495684_0160307 Ga0495684_0160307_386_1546 363
361 3300047472 Ga0495686_0084355 Ga0495686_0084355_261_1424 363
362 3300047673 Ga0495593_0000008 Ga0495593_0000008_8461_9591 363
363 3300047673 Ga0495593_0009851 Ga0495593_0009851_3972_5102 363
364 3300047673 Ga0495593_0032789 Ga0495593_0032789_1340_2470 363
365 3300048088 Ga0495602_0010805 Ga0495602_0010805_2645_3775 363
366 3300048088 Ga0495602_0031218 Ga0495602_0031218_1085_2215 363
367 3300048088 Ga0495602_0089294 Ga0495602_0089294_340_1470 363
368 3300048088 Ga0495602_0198292 Ga0495602_0198292_92_1285 363
369 3300048089 Ga0495614_0021139 Ga0495614_0021139_106_1236 363
370 3300048903 Ga0496100_0054503 Ga0496100_0054503_1025_2155 363
371 3300048904 Ga0496101_0084592 Ga0496101_0084592_303_1433 363
372 3300048905 Ga0496102_0017019 Ga0496102_0017019_4142_5329 363
373 3300048905 Ga0496102_0068448 Ga0496102_0068448_614_1744 363
374 3300048906 Ga0496103_0028788 Ga0496103_0028788_1159_2289 363
375 3300048907 Ga0496104_0011011 Ga0496104_0011011_4479_5666 363
376 3300048907 Ga0496104_0080560 Ga0496104_0080560_1262_2392 363
377 3300048908 Ga0496105_0004737 Ga0496105_0004737_8629_9894 363
378 3300048909 Ga0496106_0008931 Ga0496106_0008931_1025_2155 363
379 3300048909 Ga0496106_0047742 Ga0496106_0047742_731_1894 363
380 3300048910 Ga0496107_0023292 Ga0496107_0023292_525_1655 363
381 3300048910 Ga0496107_0170898 Ga0496107_0170898_308_1591 363
382 3300048913 Ga0496110_0002086 Ga0496110_0002086_5979_7244 363
383 3300048913 Ga0496110_0163795 Ga0496110_0163795_649_1779 363
384 3300048914 Ga0496111_0055480 Ga0496111_0055480_1382_2569 363
385 3300048914 Ga0496111_0121512 Ga0496111_0121512_643_1773 363
386 3300048915 Ga0496112_0011552 Ga0496112_0011552_208_1395 363
387 3300048915 Ga0496112_0060842 Ga0496112_0060842_333_1520 363
388 3300048915 Ga0496112_0115034 Ga0496112_0115034_1043_2173 363
389 3300048916 Ga0496113_0003304 Ga0496113_0003304_7399_8586 363
390 3300048916 Ga0496113_0025531 Ga0496113_0025531_130_1317 363
391 3300048917 Ga0496114_0038550 Ga0496114_0038550_2585_3772 363
392 3300048918 Ga0496115_0002928 Ga0496115_0002928_7742_9100 363
393 3300048919 Ga0496116_0005365 Ga0496116_0005365_741_1904 363
394 3300048924 Ga0496121_0002931 Ga0496121_0002931_10055_11218 363
395 3300048926 Ga0496123_0122353 Ga0496123_0122353_26_1189 363
396 3300048927 Ga0496124_0135160 Ga0496124_0135160_352_1515 363
397 3300048928 Ga0496125_0002796 Ga0496125_0002796_4903_6066 363
398 3300048928 Ga0496125_0021699 Ga0496125_0021699_4737_5900 363
399 3300050492 nmdc:mga0yw44_195297_c1 nmdc:mga0yw44_195297_c1_16_1203 363
400 3300050512 nmdc:mga0n895_64691_c1 nmdc:mga0n895_64691_c1_690_1826 363
401 3300050512 nmdc:mga0n895_71625_c1 nmdc:mga0n895_71625_c1_1941_3101 363
402 3300050513 nmdc:mga0rr50_25631_c1 nmdc:mga0rr50_25631_c1_2750_3886 363
403 3300053077 Ga0495601_0000604 Ga0495601_0000604_10740_11900 363
404 3300053078 Ga0495612_0002276 Ga0495612_0002276_5676_6806 363
405 3300053078 Ga0495612_0025343 Ga0495612_0025343_630_1823 363
406 3300053084 Ga0495595_0000165 Ga0495595_0000165_10433_11563 363
407 3300053084 Ga0495595_0000465 Ga0495595_0000465_7031_8161 363
408 3300053085 Ga0495619_0001330 Ga0495619_0001330_5798_6928 363
409 3300053087 Ga0500643_001631 Ga0500643_001631_3295_4458 363
410 3300053094 Ga0500566_0001759 Ga0500566_0001759_11274_12461 363
411 3300053096 Ga0500641_0002155 Ga0500641_0002155_5326_6489 363
412 3300053102 Ga0500554_001023 Ga0500554_001023_1452_2582 363
413 3300053104 Ga0500556_0000002 Ga0500556_0000002_216296_217459 363
414 3300053130 Ga0500642_0000034 Ga0500642_0000034_84985_86148 363
415 3300053131 Ga0500652_000352 Ga0500652_000352_13419_14582 363
416 3300053134 Ga0500658_0026240 Ga0500658_0026240_861_2024 363
417 3300053139 Ga0500568_0000190 Ga0500568_0000190_37183_38346 363
418 3300053145 Ga0500586_000336 Ga0500586_000336_1172_2332 363
419 3300053150 Ga0500603_000696 Ga0500603_000696_1604_2734 363
420 3300053156 Ga0500622_0000813 Ga0500622_0000813_10579_11742 363
421 3300053178 Ga0500637_0000440 Ga0500637_0000440_11123_12310 363
422 3300055283 Ga0500661_000513 Ga0500661_000513_5709_6896 363
423 iso_pu_bacteria 2513237094 2513640708 363
424 iso_pu_bacteria 8019648815 8019653139 363
425 3300003320 rootH2_10235605 rootH2_102356052 364
426 3300005842 Ga0068858_100119139 Ga0068858_1001191392 364
427 3300009101 Ga0105247_10014123 Ga0105247_100141232 364
428 3300009551 Ga0105238_10059253 Ga0105238_100592532 364
429 3300025924 Ga0207694_10030228 Ga0207694_100302283 364
430 3300026035 Ga0207703_10057833 Ga0207703_100578332 364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

388

443

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9488 300 359
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9455 300 357
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9452 300 357
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.945 301 357
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9412 301 357
ID Description Score Start End Superfamily
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9301 301 356 1.10.10.10
af_Q11028_1077_1158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9261 300 357 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9241 300 359 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9163 302 359 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9085 299 357 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A528FI50-F1-model_v4 LuxR family transcriptional regulator 0.882 5 212
AF-A0A329AMK5-F1-model_v4 deleted 0.8031 2 288
AF-A0A378ZY30-F1-model_v4 GAF domain-containing protein 0.7889 1 242
AF-A0A4P1ARH8-F1-model_v4 deleted 0.7704 1 212
AF-A0A528FI50-F1-model_v4 LuxR family transcriptional regulator 0.7634 5 212

Feature Viewer

pLDDT pTM Quality
77.35 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map